3CCJZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccjZ00
1VQ4Z 1K9M1 1W2BZ 1YIT1 3CCE1 1W2BY 3G711 3G71Z 1N8R2 2QEX1 1QVGZ 1VQ81 2QEXZ 1VQ8Z 1K732 3OW2Z 1QVGY 3CMA1 3CMAZ 3OW2Y 3CCM1 3CCMZ 3CCS1 1Q811 1Q822 3CCSZ 2QA41 2QA4Z 3CCR1 3CCRZ 1YJN1 1YJNZ 1M901 3CME1 1VQM1 3CMEZ 3I551 1VQMZ 1M1K2 3I55Z 1Q861 3CXCZ 3CCJ1 1VQOZ 3CCJZ 3CXCY 2OTJ1 2OTJZ 1K8A1 1Q7Y1 1NJI1 1YIJ1 1KC82 1YIJZ 1KD12 1VQK1 1VQKZ 3CCUZ 1JJ2Z 3CPWZ 3CCQ1 1K9M2 3CCQZ 3CC41 1YI2Z 3CC4Z 3CPWY 1VQP1 1VQPZ 1KQSZ 3I561 3I56Z 1N8R1 1KQSY 1K731 1VQO1 1VQ91 1VQ61 1VQ9Z 1VQ6Z 1QVFZ 1Q821 3CCV1 3CCVZ 3G4S1 3G4SZ 1QVFY 1Q812 1VQN1 1VQ51 1VQNZ 1VQ5Z 1VQ71 1VQ7Z 1M1K1 3CCU1 1YITZ 1M902 3CCEZ 1YI21 1VQL1 1JJ2Y 3G6E1 1VQLZ 3G6EZ 3CCL1 3CC21 3CCLZ 3CC2Z 1YJ91 1YJW1 1YJ9Z 1YJWZ 3CD61 1Q862 2OTL1 3CD6Z 2OTLZ 1S721 1S72Z 1K8A2 1Q7Y2 3CC71 1YHQ1 3CC7Z 1NJI2 1YHQZ 1KC81 1KD11 1VQ41
chains in the Genus database with same CATH superfamily
4DGLA 3S16I 1YIT1 1WCMI 2NVXI 3GTLI 3VB9A 2P3YA 3FQMA 2VPYA 2F4OA 4NBCA 4A3LI 1RO4A 1YUAA 3FQQA 1K732 3HOWI 3PO3S 3CCMZ 2V8JA 1Q16A 5D1PA 2QA41 3CCRZ 4MONA 1YJN1 2W03A 1M901 1ZH1A 1VQM1 5FLXb 2JA6I 4BY1I 3GTJI 2R7ZI 3M3YI 2QRCB 3CCJ1 1WZNA 2E2JI 1Y1VS 4EWCA 1I3QI 2AYDA 2O53A 2OTJZ 3D9XA 1K8A1 1Q7Y1 1RO2A 1VLAA 3TE5B 4A3FI 1VQKZ 2VPWA 2VPXA 3VMIA 3GCFA 1JJ2Z 2V3VA 3CCQ1 3EEDA 1YI2Z 1VQP1 1K731 3ESWA 1VQ9Z 1VQ6Z 2JUBA 3CCV1 5C3EI 4S1TA 3S14I 3G4SZ 2QREB 1RO0A 1AA6A 5D1OB 4Y7NI 2OOYB 1YI21 4MD7A 2K5RA 3G6EZ 3CCLZ 1WW9A 2IV2X 3GTGI 4A3EI 1YJ91 1YJW1 2VPZA 2E9HA 1Q862 1LQLA 3FKII 5IT9b 1S721 4RVHA 2JIMA 4E33A 2JA8I 1VQ41 3S17I 1RQFA 3EERA 4E2WA 3IFUA 2RPRA 1W2BZ 3I4NI 4AYBA 1WIIA 2KI7B 1W2BY 4RVGA 1Y1WI 2G2KA 3G711 3J81f 2E2II 3QWUA 4NH1C 1QVGZ 1VQ81 3GTMI 1S7MA 1QVGY 2DE5A 4E31A 4MH4A 5IT9f 2M48A 3JAMf 2QA4Z 2W04A 2VUMI 3CQZI 4XX2A 1YJNZ 4A3BI 4RVFA 3CME1 3I551 1VQMZ 1M1K2 1P9NA 2R92I 4Y52I 1Q861 4E2YA 3GTKI 1QF8A 2RT9A 1VQOZ 2JMOA 3KIHA 3CCJZ 2JIOA 2R6MA 2V45A 1SFOI 5CM2M 2F4MA 1DL6A 4A93I 2HU9A 5T64A 1YIJ1 1KRLA 4NBEA 4A3CI 2Q51A 3HOUI 3CCQZ 3CC41 1VQPZ 4MXUA 5C4JI 3I07A 1TWFI 3J80b 3I4MI 5D1OA 1VQO1 2I3CA 4HGZA 3NDJA 3CCVZ 3NH8A 3T4NB 3D2LA 3U50C 1Q812 1VQN1 1I6HI 1VQ71 3F3PC 1M1K1 4BXXI 3S2DI 4NFRA 3GTQI 4RS4A 1VQL1 1JJ2Y 3VMHA 3CC21 2J6AA 3F3FC 2LFUA 4X6AI 3IF8A 2BJOA 2JR6A 1YJ9Z 1YJWZ 3KIFA 2WAQA 1S72Z 5C4XI 3CC71 3J80f 1YHQ1 4NB8A 4A3GI 1TFIA 1VQ4Z 3P5JB 5LL6f 5FLMI 3J81b 2YU9I 1WJ2A 2V8KA 3G71Z 2H85A 1N8R2 3PO3I 2QEX1 1VQ8Z 2DE7A 4E2ZA 2GTHA 2LEXA 2ZAEB 3CMA1 4BY7I 3JAMb 4MRIA 4E32A 3CCS1 1Q811 1Q822 1USPB 2JNYA 2LIYA 5IP9I 1TWCI 5T67A 2RBLA 4E30A 1ZB9A 2JS4A 3CMEZ 5IP7I 3I55Z 1ML8A 4RVDA 3CXCZ 2E2HI 3CXCY 2DE6A 1RLYA 5T6BA 2EGTA 1Z03A 3VTNA 2PM9A 2IZ3A 2Y0SA 2NVQI 1NP6A 1KC82 1YIJZ 1KD12 1ZB8A 4A3II 3CCUZ 1K9M2 2O4HA 5A2Qf 3BG1B 3CC4Z 2VUGA 3H0GI 3RZDI 2QRDB 3I561 1N8R1 4DQYB 4NBGA 3H3VJ 4TNUA 4A3DI 1R9TI 4A3JI 1X3ZA 1Q821 2GTIA 4A3KI 2JA5I 2NVYI 1VQ51 1VQNZ 1X3WA 1VQ7Z 1TWAI 2HF1A 3CCU1 2VF1A 2AKLA 3CCEZ 1FDOA 1PFTA 3S1RI 1VQLZ 3HOZI 3CC2Z 1X0TA 2M6NA 3IR7A 3NFZA 3VMGA 2JIQA 3CD61 1NUIA 2PMZA 2OTL1 4MD9A 4NBFA 3M4OI 2PK7A 3CC7Z 1NJI2 1YHQZ 1KC81 4QTTA 1KD11 1K9M1 3J7A4 3CCE1 2WB1A 1USPA 1TWGI 2RHBA 3S1MI 2QEXZ 3BG0B 4HGYA 2V8IA 2R93I 3OW2Z 1Y8CA 3RZOI 3GTMS 3CMAZ 3NDIA 3OW2Y 3PO2I 3D6WA 3MZKB 1QXFA 3CCM1 3CCSZ 1YUKA 4NBAA 3CCR1 2B63I 1TWHI 1N2FA 4NB9A 3S2HI 3HOVI 1Z02A 2RIQA 4HH4A 2IZ4A 2OZKA 5FLXf 4A3MI 1K83I 2JIRA 3HKZA 2QR1B 2OOXB 2NVTI 2JA7I 4NOZA 3GTPI 2OTJ1 3NH5A 1SIWA 4CL1A 1NJI1 2QKDA 1I50I 1QYPA 5A2Qb 1L1OC 1VQK1 3CPWZ 3K7AI 5C44I 1JWHC 2Q4ZA 4RV9A 3CPWY 2QLVB 2K3RA 3Q87A 1KQSZ 3NH4A 2E7ZA 3I56Z 3S15I 1KQSY 5AN9F 1Y1VI 2NAPA 3GTOI 4NBHA 1VQ91 4BBRI 1VQ61 2JIPA 4QTUA 1QVFZ 1RNIA 3G4S1 1FDIA 3S1NI 3S1QI 1QVFY 1VQ5Z 3MZLB 4DK1A 3HOYI 1YITZ 1M902 3LUSA 3TDHB 4E2XA 3G6E1 2YADA 3CCL1 2GU2A 4MD8A 2KPIA 3HOXI 3CD6Z 4NBBA 2OTLZ 4NBDA 3MONA 1K8A2 2P28A 1Q7Y2 3IX0A 4BBSI 3GKQA 1Z01A
chains in the Genus database with same CATH topology
4DGLA 3S16I 1YIT1 1WCMI 2NVXI 3GTLI 3VB9A 2P3YA 3FQMA 2F4OA 4NBCA 4A3LI 1RO4A 1YUAA 3FQQA 1K732 3HOWI 3PO3S 3CCMZ 2V8JA 5D1PA 2QA41 3CCRZ 4MONA 1YJN1 2W03A 1M901 1ZH1A 1VQM1 5FLXb 2JA6I 4BY1I 3GTJI 2R7ZI 3M3YI 2QRCB 3CCJ1 2E2JI 1Y1VS 4EWCA 1I3QI 2O53A 2OTJZ 3D9XA 1K8A1 1Q7Y1 1RO2A 1VLAA 3TE5B 4A3FI 1VQKZ 3VMIA 3GCFA 1JJ2Z 3CCQ1 3EEDA 1YI2Z 1VQP1 1K731 3ESWA 1VQ9Z 1VQ6Z 2JUBA 3CCV1 5C3EI 4S1TA 3S14I 3G4SZ 2QREB 1RO0A 5D1OB 4Y7NI 2OOYB 1YI21 4MD7A 2K5RA 3G6EZ 3CCLZ 1WW9A 3GTGI 4A3EI 1YJ91 1YJW1 2E9HA 1Q862 1LQLA 3FKII 5IT9b 1S721 4RVHA 4E33A 2JA8I 1VQ41 3S17I 1RQFA 3EERA 4E2WA 3IFUA 2RPRA 1W2BZ 3I4NI 4AYBA 1WIIA 2KI7B 1W2BY 4RVGA 1Y1WI 2G2KA 3G711 3J81f 2E2II 3QWUA 4NH1C 1QVGZ 1VQ81 3GTMI 1S7MA 1QVGY 2DE5A 4E31A 4MH4A 5IT9f 2M48A 3JAMf 2QA4Z 2W04A 2VUMI 3CQZI 4XX2A 1YJNZ 4A3BI 4RVFA 3CME1 3I551 1VQMZ 1M1K2 1P9NA 2R92I 4Y52I 1Q861 4E2YA 3GTKI 1QF8A 2RT9A 1VQOZ 2JMOA 3KIHA 3CCJZ 2R6MA 1SFOI 5CM2M 2F4MA 1DL6A 4A93I 2HU9A 5T64A 1YIJ1 1KRLA 4NBEA 4A3CI 2Q51A 3HOUI 3CCQZ 3CC41 1VQPZ 4MXUA 5C4JI 3I07A 1TWFI 3J80b 3I4MI 5D1OA 1VQO1 2I3CA 4HGZA 3NDJA 3CCVZ 3NH8A 3T4NB 3U50C 1Q812 1VQN1 1I6HI 1VQ71 3F3PC 1M1K1 4BXXI 3S2DI 4NFRA 3GTQI 4RS4A 1VQL1 1JJ2Y 3VMHA 3CC21 2J6AA 3F3FC 2LFUA 4X6AI 3IF8A 2BJOA 2JR6A 1YJ9Z 1YJWZ 3KIFA 2WAQA 1S72Z 5C4XI 3CC71 3J80f 1YHQ1 4NB8A 4A3GI 1TFIA 1VQ4Z 3P5JB 5LL6f 5FLMI 3J81b 2YU9I 2V8KA 3G71Z 2H85A 1N8R2 3PO3I 2QEX1 1VQ8Z 2DE7A 4E2ZA 2GTHA 2ZAEB 3CMA1 4BY7I 3JAMb 4MRIA 4E32A 3CCS1 1Q811 1Q822 1USPB 2JNYA 2LIYA 5IP9I 1TWCI 5T67A 2RBLA 4E30A 1ZB9A 2JS4A 3CMEZ 5IP7I 3I55Z 1ML8A 4RVDA 3CXCZ 2E2HI 3CXCY 2DE6A 1RLYA 5T6BA 2EGTA 1Z03A 3VTNA 2PM9A 2IZ3A 2Y0SA 2NVQI 1NP6A 1KC82 1YIJZ 1KD12 1ZB8A 4A3II 3CCUZ 1K9M2 2O4HA 5A2Qf 3BG1B 3CC4Z 2VUGA 3H0GI 3RZDI 2QRDB 3I561 1N8R1 4DQYB 4NBGA 3H3VJ 4TNUA 4A3DI 1R9TI 4A3JI 1X3ZA 1Q821 2GTIA 4A3KI 2JA5I 2NVYI 1VQ51 1VQNZ 1X3WA 1VQ7Z 1TWAI 2HF1A 3CCU1 2VF1A 2AKLA 3CCEZ 1PFTA 3S1RI 1VQLZ 3HOZI 3CC2Z 1X0TA 2M6NA 3NFZA 3VMGA 3CD61 1NUIA 2PMZA 2OTL1 4MD9A 4NBFA 3M4OI 2PK7A 3CC7Z 1NJI2 1YHQZ 1KC81 4QTTA 1KD11 1K9M1 3J7A4 3CCE1 2WB1A 1USPA 1TWGI 2RHBA 3S1MI 2QEXZ 3BG0B 4HGYA 2V8IA 2R93I 3OW2Z 3RZOI 3GTMS 3NDIA 3CMAZ 3OW2Y 3PO2I 3D6WA 3MZKB 3CCM1 3CCSZ 1YUKA 4NBAA 3CCR1 2B63I 1TWHI 1N2FA 4NB9A 3S2HI 3HOVI 1Z02A 2RIQA 4HH4A 2IZ4A 2OZKA 5FLXf 4A3MI 1K83I 3HKZA 2QR1B 2OOXB 2NVTI 2JA7I 4NOZA 3GTPI 2OTJ1 3NH5A 4CL1A 1NJI1 2QKDA 1I50I 1QYPA 5A2Qb 1L1OC 1VQK1 3CPWZ 3K7AI 5C44I 1JWHC 2Q4ZA 4RV9A 3CPWY 2QLVB 2K3RA 3Q87A 1KQSZ 3NH4A 3I56Z 3S15I 1KQSY 5AN9F 1Y1VI 3GTOI 4NBHA 1VQ91 4BBRI 1VQ61 4QTUA 1QVFZ 1RNIA 3G4S1 3S1NI 3S1QI 1QVFY 1VQ5Z 3MZLB 4DK1A 3HOYI 1YITZ 1M902 3LUSA 3TDHB 4E2XA 3G6E1 2YADA 3CCL1 2GU2A 4MD8A 2KPIA 3HOXI 3CD6Z 4NBBA 2OTLZ 4NBDA 3MONA 1K8A2 2P28A 1Q7Y2 3IX0A 4BBSI 3GKQA 1Z01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Z;  1K9M 1;  1W2B Z;  1YIT 1;  3CCE 1;  1W2B Y;  3G71 1;  3G71 Z;  1N8R 2;  2QEX 1;  1QVG Z;  1VQ8 1;  2QEX Z;  1VQ8 Z;  1K73 2;  3OW2 Z;  1QVG Y;  3CMA 1;  3CMA Z;  3OW2 Y;  3CCM 1;  3CCM Z;  3CCS 1;  1Q81 1;  1Q82 2;  3CCS Z;  2QA4 1;  2QA4 Z;  3CCR 1;  3CCR Z;  1YJN 1;  1YJN Z;  1M90 1;  3CME 1;  1VQM 1;  3CME Z;  3I55 1;  1VQM Z;  1M1K 2;  3I55 Z;  1Q86 1;  3CXC Z;  3CCJ 1;  1VQO Z;  3CCJ Z;  3CXC Y;  2OTJ 1;  2OTJ Z;  1K8A 1;  1Q7Y 1;  1NJI 1;  1YIJ 1;  1KC8 2;  1YIJ Z;  1KD1 2;  1VQK 1;  1VQK Z;  3CCU Z;  1JJ2 Z;  3CPW Z;  3CCQ 1;  1K9M 2;  3CCQ Z;  3CC4 1;  1YI2 Z;  3CC4 Z;  3CPW Y;  1VQP 1;  1VQP Z;  1KQS Z;  3I56 1;  3I56 Z;  1N8R 1;  1KQS Y;  1K73 1;  1VQO 1;  1VQ9 1;  1VQ6 1;  1VQ9 Z;  1VQ6 Z;  1QVF Z;  1Q82 1;  3CCV 1;  3CCV Z;  3G4S 1;  3G4S Z;  1QVF Y;  1Q81 2;  1VQN 1;  1VQ5 1;  1VQN Z;  1VQ5 Z;  1VQ7 1;  1VQ7 Z;  1M1K 1;  3CCU 1;  1YIT Z;  1M90 2;  3CCE Z;  1YI2 1;  1VQL 1;  1JJ2 Y;  3G6E 1;  1VQL Z;  3G6E Z;  3CCL 1;  3CC2 1;  3CCL Z;  3CC2 Z;  1YJ9 1;  1YJW 1;  1YJ9 Z;  1YJW Z;  3CD6 1;  1Q86 2;  2OTL 1;  3CD6 Z;  2OTL Z;  1S72 1;  1S72 Z;  1K8A 2;  1Q7Y 2;  3CC7 1;  1YHQ 1;  3CC7 Z;  1NJI 2;  1YHQ Z;  1KC8 1;  1KD1 1;  1VQ4 1; 
#chains in the Genus database with same CATH topology
 4DGL A;  3S16 I;  1YIT 1;  1WCM I;  2NVX I;  3GTL I;  3VB9 A;  2P3Y A;  3FQM A;  2VPY A;  2F4O A;  4NBC A;  4A3L I;  1RO4 A;  1YUA A;  3FQQ A;  1K73 2;  3HOW I;  3PO3 S;  3CCM Z;  2V8J A;  1Q16 A;  5D1P A;  2QA4 1;  3CCR Z;  4MON A;  1YJN 1;  2W03 A;  1M90 1;  1ZH1 A;  1VQM 1;  5FLX b;  2JA6 I;  4BY1 I;  3GTJ I;  2R7Z I;  3M3Y I;  2QRC B;  3CCJ 1;  1WZN A;  2E2J I;  1Y1V S;  4EWC A;  1I3Q I;  2AYD A;  2O53 A;  2OTJ Z;  3D9X A;  1K8A 1;  1Q7Y 1;  1RO2 A;  1VLA A;  3TE5 B;  4A3F I;  1VQK Z;  2VPW A;  2VPX A;  3VMI A;  3GCF A;  1JJ2 Z;  2V3V A;  3CCQ 1;  3EED A;  1YI2 Z;  1VQP 1;  1K73 1;  3ESW A;  1VQ9 Z;  1VQ6 Z;  2JUB A;  3CCV 1;  5C3E I;  4S1T A;  3S14 I;  3G4S Z;  2QRE B;  1RO0 A;  1AA6 A;  5D1O B;  4Y7N I;  2OOY B;  1YI2 1;  4MD7 A;  2K5R A;  3G6E Z;  3CCL Z;  1WW9 A;  2IV2 X;  3GTG I;  4A3E I;  1YJ9 1;  1YJW 1;  2VPZ A;  2E9H A;  1Q86 2;  1LQL A;  3FKI I;  5IT9 b;  1S72 1;  4RVH A;  2JIM A;  4E33 A;  2JA8 I;  1VQ4 1;  3S17 I;  1RQF A;  3EER A;  4E2W A;  3IFU A;  2RPR A;  1W2B Z;  3I4N I;  4AYB A;  1WII A;  2KI7 B;  1W2B Y;  4RVG A;  1Y1W I;  2G2K A;  3G71 1;  3J81 f;  2E2I I;  3QWU A;  4NH1 C;  1QVG Z;  1VQ8 1;  3GTM I;  1S7M A;  1QVG Y;  2DE5 A;  4E31 A;  4MH4 A;  5IT9 f;  2M48 A;  3JAM f;  2QA4 Z;  2W04 A;  2VUM I;  3CQZ I;  4XX2 A;  1YJN Z;  4A3B I;  4RVF A;  3CME 1;  3I55 1;  1VQM Z;  1M1K 2;  1P9N A;  2R92 I;  4Y52 I;  1Q86 1;  4E2Y A;  3GTK I;  1QF8 A;  2RT9 A;  1VQO Z;  2JMO A;  3KIH A;  3CCJ Z;  2JIO A;  2R6M A;  2V45 A;  1SFO I;  5CM2 M;  2F4M A;  1DL6 A;  4A93 I;  2HU9 A;  5T64 A;  1YIJ 1;  1KRL A;  4NBE A;  4A3C I;  2Q51 A;  3HOU I;  3CCQ Z;  3CC4 1;  1VQP Z;  4MXU A;  5C4J I;  3I07 A;  1TWF I;  3J80 b;  3I4M I;  5D1O A;  1VQO 1;  2I3C A;  4HGZ A;  3NDJ A;  3CCV Z;  3NH8 A;  3T4N B;  3D2L A;  3U50 C;  1Q81 2;  1VQN 1;  1I6H I;  1VQ7 1;  3F3P C;  1M1K 1;  4BXX I;  3S2D I;  4NFR A;  3GTQ I;  4RS4 A;  1VQL 1;  1JJ2 Y;  3VMH A;  3CC2 1;  2J6A A;  3F3F C;  2LFU A;  4X6A I;  3IF8 A;  2BJO A;  2JR6 A;  1YJ9 Z;  1YJW Z;  3KIF A;  2WAQ A;  1S72 Z;  5C4X I;  3CC7 1;  3J80 f;  1YHQ 1;  4NB8 A;  4A3G I;  1TFI A;  1VQ4 Z;  3P5J B;  5LL6 f;  5FLM I;  3J81 b;  2YU9 I;  1WJ2 A;  2V8K A;  3G71 Z;  2H85 A;  1N8R 2;  3PO3 I;  2QEX 1;  1VQ8 Z;  2DE7 A;  4E2Z A;  2GTH A;  2LEX A;  2ZAE B;  3CMA 1;  4BY7 I;  3JAM b;  4MRI A;  4E32 A;  3CCS 1;  1Q81 1;  1Q82 2;  1USP B;  2JNY A;  2LIY A;  5IP9 I;  1TWC I;  5T67 A;  2RBL A;  4E30 A;  1ZB9 A;  2JS4 A;  3CME Z;  5IP7 I;  3I55 Z;  1ML8 A;  4RVD A;  3CXC Z;  2E2H I;  3CXC Y;  2DE6 A;  1RLY A;  5T6B A;  2EGT A;  1Z03 A;  3VTN A;  2PM9 A;  2IZ3 A;  2Y0S A;  2NVQ I;  1NP6 A;  1KC8 2;  1YIJ Z;  1KD1 2;  1ZB8 A;  4A3I I;  3CCU Z;  1K9M 2;  2O4H A;  5A2Q f;  3BG1 B;  3CC4 Z;  2VUG A;  3H0G I;  3RZD I;  2QRD B;  3I56 1;  1N8R 1;  4DQY B;  4NBG A;  3H3V J;  4TNU A;  4A3D I;  1R9T I;  4A3J I;  1X3Z A;  1Q82 1;  2GTI A;  4A3K I;  2JA5 I;  2NVY I;  1VQ5 1;  1VQN Z;  1X3W A;  1VQ7 Z;  1TWA I;  2HF1 A;  3CCU 1;  2VF1 A;  2AKL A;  3CCE Z;  1FDO A;  1PFT A;  3S1R I;  1VQL Z;  3HOZ I;  3CC2 Z;  1X0T A;  2M6N A;  3IR7 A;  3NFZ A;  3VMG A;  2JIQ A;  3CD6 1;  1NUI A;  2PMZ A;  2OTL 1;  4MD9 A;  4NBF A;  3M4O I;  2PK7 A;  3CC7 Z;  1NJI 2;  1YHQ Z;  1KC8 1;  4QTT A;  1KD1 1;  1K9M 1;  3J7A 4;  3CCE 1;  2WB1 A;  1USP A;  1TWG I;  2RHB A;  3S1M I;  2QEX Z;  3BG0 B;  4HGY A;  2V8I A;  2R93 I;  3OW2 Z;  1Y8C A;  3RZO I;  3GTM S;  3CMA Z;  3NDI A;  3OW2 Y;  3PO2 I;  3D6W A;  3MZK B;  1QXF A;  3CCM 1;  3CCS Z;  1YUK A;  4NBA A;  3CCR 1;  2B63 I;  1TWH I;  1N2F A;  4NB9 A;  3S2H I;  3HOV I;  1Z02 A;  2RIQ A;  4HH4 A;  2IZ4 A;  2OZK A;  5FLX f;  4A3M I;  1K83 I;  2JIR A;  3HKZ A;  2QR1 B;  2OOX B;  2NVT I;  2JA7 I;  4NOZ A;  3GTP I;  2OTJ 1;  3NH5 A;  1SIW A;  4CL1 A;  1NJI 1;  2QKD A;  1I50 I;  1QYP A;  5A2Q b;  1L1O C;  1VQK 1;  3CPW Z;  3K7A I;  5C44 I;  1JWH C;  2Q4Z A;  4RV9 A;  3CPW Y;  2QLV B;  2K3R A;  3Q87 A;  1KQS Z;  3NH4 A;  2E7Z A;  3I56 Z;  3S15 I;  1KQS Y;  5AN9 F;  1Y1V I;  2NAP A;  3GTO I;  4NBH A;  1VQ9 1;  4BBR I;  1VQ6 1;  2JIP A;  4QTU A;  1QVF Z;  1RNI A;  3G4S 1;  1FDI A;  3S1N I;  3S1Q I;  1QVF Y;  1VQ5 Z;  3MZL B;  4DK1 A;  3HOY I;  1YIT Z;  1M90 2;  3LUS A;  3TDH B;  4E2X A;  3G6E 1;  2YAD A;  3CCL 1;  2GU2 A;  4MD8 A;  2KPI A;  3HOX I;  3CD6 Z;  4NBB A;  2OTL Z;  4NBD A;  3MON A;  1K8A 2;  2P28 A;  1Q7Y 2;  3IX0 A;  4BBS I;  3GKQ A;  1Z01 A; 
#chains in the Genus database with same CATH homology
 4DGL A;  3S16 I;  1YIT 1;  1WCM I;  2NVX I;  3GTL I;  3VB9 A;  2P3Y A;  3FQM A;  2F4O A;  4NBC A;  4A3L I;  1RO4 A;  1YUA A;  3FQQ A;  1K73 2;  3HOW I;  3PO3 S;  3CCM Z;  2V8J A;  5D1P A;  2QA4 1;  3CCR Z;  4MON A;  1YJN 1;  2W03 A;  1M90 1;  1ZH1 A;  1VQM 1;  5FLX b;  2JA6 I;  4BY1 I;  3GTJ I;  2R7Z I;  3M3Y I;  2QRC B;  3CCJ 1;  2E2J I;  1Y1V S;  4EWC A;  1I3Q I;  2O53 A;  2OTJ Z;  3D9X A;  1K8A 1;  1Q7Y 1;  1RO2 A;  1VLA A;  3TE5 B;  4A3F I;  1VQK Z;  3VMI A;  3GCF A;  1JJ2 Z;  3CCQ 1;  3EED A;  1YI2 Z;  1VQP 1;  1K73 1;  3ESW A;  1VQ9 Z;  1VQ6 Z;  2JUB A;  3CCV 1;  5C3E I;  4S1T A;  3S14 I;  3G4S Z;  2QRE B;  1RO0 A;  5D1O B;  4Y7N I;  2OOY B;  1YI2 1;  4MD7 A;  2K5R A;  3G6E Z;  3CCL Z;  1WW9 A;  3GTG I;  4A3E I;  1YJ9 1;  1YJW 1;  2E9H A;  1Q86 2;  1LQL A;  3FKI I;  5IT9 b;  1S72 1;  4RVH A;  4E33 A;  2JA8 I;  1VQ4 1;  3S17 I;  1RQF A;  3EER A;  4E2W A;  3IFU A;  2RPR A;  1W2B Z;  3I4N I;  4AYB A;  1WII A;  2KI7 B;  1W2B Y;  4RVG A;  1Y1W I;  2G2K A;  3G71 1;  3J81 f;  2E2I I;  3QWU A;  4NH1 C;  1QVG Z;  1VQ8 1;  3GTM I;  1S7M A;  1QVG Y;  2DE5 A;  4E31 A;  4MH4 A;  5IT9 f;  2M48 A;  3JAM f;  2QA4 Z;  2W04 A;  2VUM I;  3CQZ I;  4XX2 A;  1YJN Z;  4A3B I;  4RVF A;  3CME 1;  3I55 1;  1VQM Z;  1M1K 2;  1P9N A;  2R92 I;  4Y52 I;  1Q86 1;  4E2Y A;  3GTK I;  1QF8 A;  2RT9 A;  1VQO Z;  2JMO A;  3KIH A;  3CCJ Z;  2R6M A;  1SFO I;  5CM2 M;  2F4M A;  1DL6 A;  4A93 I;  2HU9 A;  5T64 A;  1YIJ 1;  1KRL A;  4NBE A;  4A3C I;  2Q51 A;  3HOU I;  3CCQ Z;  3CC4 1;  1VQP Z;  4MXU A;  5C4J I;  3I07 A;  1TWF I;  3J80 b;  3I4M I;  5D1O A;  1VQO 1;  2I3C A;  4HGZ A;  3NDJ A;  3CCV Z;  3NH8 A;  3T4N B;  3U50 C;  1Q81 2;  1VQN 1;  1I6H I;  1VQ7 1;  3F3P C;  1M1K 1;  4BXX I;  3S2D I;  4NFR A;  3GTQ I;  4RS4 A;  1VQL 1;  1JJ2 Y;  3VMH A;  3CC2 1;  2J6A A;  3F3F C;  2LFU A;  4X6A I;  3IF8 A;  2BJO A;  2JR6 A;  1YJ9 Z;  1YJW Z;  3KIF A;  2WAQ A;  1S72 Z;  5C4X I;  3CC7 1;  3J80 f;  1YHQ 1;  4NB8 A;  4A3G I;  1TFI A;  1VQ4 Z;  3P5J B;  5LL6 f;  5FLM I;  3J81 b;  2YU9 I;  2V8K A;  3G71 Z;  2H85 A;  1N8R 2;  3PO3 I;  2QEX 1;  1VQ8 Z;  2DE7 A;  4E2Z A;  2GTH A;  2ZAE B;  3CMA 1;  4BY7 I;  3JAM b;  4MRI A;  4E32 A;  3CCS 1;  1Q81 1;  1Q82 2;  1USP B;  2JNY A;  2LIY A;  5IP9 I;  1TWC I;  5T67 A;  2RBL A;  4E30 A;  1ZB9 A;  2JS4 A;  3CME Z;  5IP7 I;  3I55 Z;  1ML8 A;  4RVD A;  3CXC Z;  2E2H I;  3CXC Y;  2DE6 A;  1RLY A;  5T6B A;  2EGT A;  1Z03 A;  3VTN A;  2PM9 A;  2IZ3 A;  2Y0S A;  2NVQ I;  1NP6 A;  1KC8 2;  1YIJ Z;  1KD1 2;  1ZB8 A;  4A3I I;  3CCU Z;  1K9M 2;  2O4H A;  5A2Q f;  3BG1 B;  3CC4 Z;  2VUG A;  3H0G I;  3RZD I;  2QRD B;  3I56 1;  1N8R 1;  4DQY B;  4NBG A;  3H3V J;  4TNU A;  4A3D I;  1R9T I;  4A3J I;  1X3Z A;  1Q82 1;  2GTI A;  4A3K I;  2JA5 I;  2NVY I;  1VQ5 1;  1VQN Z;  1X3W A;  1VQ7 Z;  1TWA I;  2HF1 A;  3CCU 1;  2VF1 A;  2AKL A;  3CCE Z;  1PFT A;  3S1R I;  1VQL Z;  3HOZ I;  3CC2 Z;  1X0T A;  2M6N A;  3NFZ A;  3VMG A;  3CD6 1;  1NUI A;  2PMZ A;  2OTL 1;  4MD9 A;  4NBF A;  3M4O I;  2PK7 A;  3CC7 Z;  1NJI 2;  1YHQ Z;  1KC8 1;  4QTT A;  1KD1 1;  1K9M 1;  3J7A 4;  3CCE 1;  2WB1 A;  1USP A;  1TWG I;  2RHB A;  3S1M I;  2QEX Z;  3BG0 B;  4HGY A;  2V8I A;  2R93 I;  3OW2 Z;  3RZO I;  3GTM S;  3NDI A;  3CMA Z;  3OW2 Y;  3PO2 I;  3D6W A;  3MZK B;  3CCM 1;  3CCS Z;  1YUK A;  4NBA A;  3CCR 1;  2B63 I;  1TWH I;  1N2F A;  4NB9 A;  3S2H I;  3HOV I;  1Z02 A;  2RIQ A;  4HH4 A;  2IZ4 A;  2OZK A;  5FLX f;  4A3M I;  1K83 I;  3HKZ A;  2QR1 B;  2OOX B;  2NVT I;  2JA7 I;  4NOZ A;  3GTP I;  2OTJ 1;  3NH5 A;  4CL1 A;  1NJI 1;  2QKD A;  1I50 I;  1QYP A;  5A2Q b;  1L1O C;  1VQK 1;  3CPW Z;  3K7A I;  5C44 I;  1JWH C;  2Q4Z A;  4RV9 A;  3CPW Y;  2QLV B;  2K3R A;  3Q87 A;  1KQS Z;  3NH4 A;  3I56 Z;  3S15 I;  1KQS Y;  5AN9 F;  1Y1V I;  3GTO I;  4NBH A;  1VQ9 1;  4BBR I;  1VQ6 1;  4QTU A;  1QVF Z;  1RNI A;  3G4S 1;  3S1N I;  3S1Q I;  1QVF Y;  1VQ5 Z;  3MZL B;  4DK1 A;  3HOY I;  1YIT Z;  1M90 2;  3LUS A;  3TDH B;  4E2X A;  3G6E 1;  2YAD A;  3CCL 1;  2GU2 A;  4MD8 A;  2KPI A;  3HOX I;  3CD6 Z;  4NBB A;  2OTL Z;  4NBD A;  3MON A;  1K8A 2;  2P28 A;  1Q7Y 2;  3IX0 A;  4BBS I;  3GKQ A;  1Z01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...