3CCJZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccjZ00
3CCJZ 2OTJ1 3CCS1 3CCRZ 3CCSZ 2OTJZ 3CC21 3CC2Z 3CCU1 1N8R2 3CCUZ 3CPWY 1VQM1 1VQ81 1VQ8Z 1NJI1 1K9M1 1YHQZ 3OW2Z 1Q811 1M1K1 3CCE1 1M901 3CCEZ 1YJN1 1YITZ 1YJNZ 3I56Z 3G6E1 1YIJZ 1VQ91 3G6EZ 3CC41 1VQ9Z 3CD61 3CC4Z 3CXCY 3I55Z 3CD6Z 1W2BY 1Q861 1VQ61 1VQ6Z 3CCL1 3CCLZ 2QA41 3CCR1 2QA4Z 1Q821 1KQSZ 3CPWZ 3CMEZ 1VQ71 1NJI2 1K9M2 1VQ7Z 1KQSY 3CCQZ 3CC71 3CC7Z 3G711 3G71Z 1KD11 1Q812 1M1K2 1M902 1YHQ1 1KC81 1VQOZ 1VQL1 1QVGY 1Q862 1VQLZ 1YIT1 3I561 1K8A1 1VQNZ 3CXCZ 1YIJ1 1W2BZ 3I551 1JJ2Y 1Q822 3CCVZ 2QEX1 2QEXZ 1VQK1 1VQ41 1VQKZ 1K731 1KD12 1VQ4Z 1VQ51 2OTLZ 3CME1 1VQ5Z 1QVFZ 3CCQ1 3G4S1 1KC82 3G4SZ 1QVFY 1Q7Y2 1YI2Z 1K8A2 3CMA1 1VQO1 3CMAZ 1Q7Y1 1QVGZ 1YJW1 1YJWZ 1VQN1 3CCM1 3CCMZ 1JJ2Z 1K732 3CCV1 2OTL1 1VQMZ 1N8R1 1S721 1YI21 1S72Z 1YJ91 3OW2Y 1YJ9Z 1VQP1 1VQPZ 3CCJ1
chains in the Genus database with same CATH superfamily
3CCJZ 5AN9F 4E30A 1PFTA 1DL6A 2OTJZ 3CC2Z 1N8R2 3CCUZ 3VTNA 1VQM1 3CQZI 3J80b 2PM9A 2JS4A 3D2LA 3IFUA 2JUBA 2NAPA 3CCEZ 3CC41 2K3RA 3I55Z 5C3EI 1Q861 1VQ61 2BJOA 5IP7I 2P3YA 1KQSZ 4NBBA 5FLMI 1VQ71 3BG1B 3H0GI 2V8IA 3CC71 5C44I 3G71Z 1KD11 4A3GI 3NH4A 1Q812 1M1K2 2W03A 4E2WA 4Y52I 4E2ZA 1YHQ1 1K83I 1KC81 3I07A 3J81b 3RZDI 3S15I 1P9NA 3I561 3GTKI 1YIJ1 1WJ2A 4MD8A 1Q822 5T67A 2QEX1 1RNIA 2DE6A 4A3MI 1VQKZ 2OTLZ 3CME1 3GTMI 2OOYB 1QYPA 1QVFY 2AYDA 3HKZA 1I3QI 1K8A2 1VQO1 2Y0SA 4A3II 1YJWZ 1Z02A 2OZKA 3Q87A 3CCM1 2V45A 3S1NI 1JJ2Z 1Q16A 1K732 4BY1I 1X3ZA 2VUGA 4E2YA 2QRDB 4NBEA 1VQMZ 2KI7B 3HOXI 2P28A 1TWFI 1ZB8A 2W04A 3HOZI 1YI21 2J6AA 1SIWA 2NVTI 2WAQA 1Z03A 2E9HA 3S16I 3GTGI 1TWHI 3I4MI 4BY7I 2JIQA 2LEXA 4MONA 3CCSZ 5FLXb 2O53A 1I50I 3NFZA 3IR7A 3S1MI 4A3BI 1I6HI 1VQ8Z 1NJI1 1YHQZ 4RVFA 3GCFA 2HU9A 1M901 4HGZA 2VUMI 1YJN1 5T64A 4TNUA 3I56Z 4NBFA 1YIJZ 1VQ91 2VPWA 3G6EZ 3CD61 1NUIA 3NH5A 3RZOI 2O4HA 1TWAI 2JIOA 5IP9I 3CCLZ 2QA41 1L1OC 4A3CI 3M3YI 3CPWZ 3CMEZ 3JAMf 3PO3S 3M4OI 1RO4A 3MZKB 1VQOZ 1Y1VI 5D1OB 4NBDA 4CL1A 1VQL1 1Q862 4MRIA 1W2BZ 3D9XA 4QTUA 1JJ2Y 1TWGI 3IF8A 4RVDA 5C4XI 2F4OA 3LUSA 3I4NI 1VQ41 2IZ4A 1KD12 4NBCA 1VQ51 4NB8A 3TE5B 2JIRA 4MD7A 1N2FA 2OOXB 2HF1A 3G4S1 1KC82 2R7ZI 1YI2Z 2JIMA 2QREB 3CMAZ 2DE5A 3VB9A 1VQN1 5LL6f 2E2II 2RT9A 3IX0A 2V8JA 1ZH1A 2JMOA 1USPA 3GTOI 4AYBA 4E2XA 3J7A4 1X0TA 3P5JB 2JA8I 1Y1VS 2JNYA 3MONA 5A2Qf 1AA6A 2R92I 2M6NA 1S72Z 4NBGA 1YJ9Z 3HOUI 1VQPZ 1WW9A 5A2Qb 4DGLA 4A3JI 4DK1A 4NBHA 2KPIA 4A3FI 4A3DI 1TFIA 3CCJ1 1FDIA 4NBAA 2G2KA 1WIIA 4HH4A 2Q51A 2OTJ1 3S17I 3CC21 3CCU1 3CPWY 1QF8A 3S1QI 3ESWA 2K5RA 4RVHA 2F4MA 1JWHC 3VMHA 2IV2X 1K9M1 1NP6A 4A3KI 1YUKA 4BBSI 3H3VJ 1SFOI 4MD9A 4E32A 3CCE1 3FQQA 3GTPI 2EGTA 3CC4Z 1W2BY 2WB1A 3GTMS 2NVYI 1VQ6Z 3T4NB 3HOYI 3NH8A 3CCR1 3HOVI 3FKII 1NJI2 1KRLA 1VQ7Z 1KQSY 3CC7Z 3G711 3VMGA 1M902 2GTHA 2GU2A 4X6AI 3EEDA 3NDJA 3S2HI 1YUAA 4S1TA 4MH4A 4RV9A 1YIT1 1VQNZ 2PMZA 3CXCZ 1X3WA 2JA6I 2QLVB 4NB9A 3EERA 2QEXZ 1VQK1 1ML8A 3GTJI 3GKQA 2QRCB 1QVFZ 3KIHA 3CCQ1 5CM2M 4DQYB 2DE7A 2LIYA 1QVGZ 3JAMb 1YJW1 3J80f 3S14I 3CCMZ 2JIPA 1LQLA 3KIFA 4RS4A 2JA5I 1RO2A 3CCV1 5IT9f 3GTLI 1R9TI 3S2DI 1N8R1 3BG0B 2JA7I 4NFRA 1FDOA 2QR1B 5IT9b 4BXXI 1RO0A 2QKDA 4A3LI 2VPYA 4Y7NI 4A93I 3VMIA 5T6BA 2RHBA 3CCS1 1WCMI 3CCRZ 3J81f 2LFUA 2ZAEB 1VQ81 1WZNA 3U50C 5D1PA 1VLAA 2VF1A 3OW2Z 1RQFA 1Q811 2VPZA 1M1K1 2NVXI 1YITZ 1YJNZ 3G6E1 3HOWI 5D1OA 1VQ9Z 3CXCY 3CD6Z 2GTIA 3F3PC 1Y1WI 2YADA 4RVGA 3CCL1 2R6MA 2QA4Z 1Q821 3GTQI 1K9M2 2E2HI 3CCQZ 3S1RI 1Y8CA 2VPXA 2E7ZA 4XX2A 2NVQI 4EWCA 1QVGY 3MZLB 1VQLZ 1K8A1 2H85A 4QTTA 5C4JI 3I551 1S7MA 2RIQA 2V8KA 3NDIA 4BBRI 3CCVZ 4NOZA 2E2JI 1K731 2IZ3A 1VQ4Z 1VQ5Z 3G4SZ 3K7AI 1Q7Y2 2RPRA 3TDHB 1Z01A 1ZB9A 2PK7A 2RBLA 3CMA1 3F3FC 1Q7Y1 5FLXf 2R93I 3PO3I 4HGYA 2JR6A 3D6WA 2YU9I 2Q4ZA 4NH1C 3FQMA 4MXUA 2OTL1 1RLYA 2B63I 2AKLA 2M48A 4A3EI 1S721 1TWCI 4E31A 1YJ91 3OW2Y 3PO2I 1VQP1 2V3VA 4E33A 2I3CA 1QXFA 1USPB 3QWUA
chains in the Genus database with same CATH topology
3CCJZ 5AN9F 4E30A 1PFTA 1DL6A 2OTJZ 3CC2Z 1N8R2 3CCUZ 3VTNA 1VQM1 3CQZI 3J80b 2PM9A 2JS4A 3IFUA 2JUBA 3CCEZ 3CC41 2K3RA 3I55Z 5C3EI 1Q861 1VQ61 2BJOA 5IP7I 2P3YA 1KQSZ 4NBBA 5FLMI 1VQ71 3BG1B 3H0GI 2V8IA 3CC71 5C44I 3G71Z 1KD11 4A3GI 3NH4A 1Q812 1M1K2 2W03A 4E2WA 4Y52I 4E2ZA 1YHQ1 1K83I 1KC81 3I07A 3J81b 3RZDI 3S15I 1P9NA 3I561 3GTKI 1YIJ1 4MD8A 1Q822 5T67A 2QEX1 1RNIA 2DE6A 4A3MI 1VQKZ 2OTLZ 3CME1 3GTMI 2OOYB 1QYPA 1QVFY 3HKZA 1I3QI 1K8A2 1VQO1 2Y0SA 4A3II 1YJWZ 1Z02A 2OZKA 3Q87A 3CCM1 3S1NI 1JJ2Z 1K732 4BY1I 1X3ZA 2VUGA 4E2YA 2QRDB 4NBEA 1VQMZ 2KI7B 3HOXI 2P28A 1TWFI 1ZB8A 2W04A 3HOZI 1YI21 2J6AA 2NVTI 2WAQA 1Z03A 2E9HA 3S16I 3GTGI 1TWHI 3I4MI 4BY7I 4MONA 3CCSZ 5FLXb 2O53A 1I50I 3NFZA 3S1MI 4A3BI 1I6HI 1VQ8Z 1NJI1 1YHQZ 4RVFA 3GCFA 2HU9A 1M901 4HGZA 2VUMI 1YJN1 5T64A 4TNUA 3I56Z 4NBFA 1YIJZ 1VQ91 3G6EZ 3CD61 1NUIA 3NH5A 3RZOI 2O4HA 1TWAI 5IP9I 3CCLZ 2QA41 1L1OC 4A3CI 3M3YI 3CPWZ 3CMEZ 3JAMf 3PO3S 3M4OI 1RO4A 3MZKB 1VQOZ 1Y1VI 5D1OB 4NBDA 4CL1A 1VQL1 1Q862 4MRIA 1W2BZ 3D9XA 4QTUA 1JJ2Y 1TWGI 3IF8A 4RVDA 5C4XI 2F4OA 3LUSA 3I4NI 1VQ41 2IZ4A 1KD12 4NBCA 1VQ51 4NB8A 3TE5B 4MD7A 1N2FA 2OOXB 2HF1A 3G4S1 1KC82 2R7ZI 1YI2Z 2QREB 3CMAZ 2DE5A 3VB9A 1VQN1 5LL6f 2E2II 2RT9A 3IX0A 2V8JA 1ZH1A 2JMOA 1USPA 3GTOI 4AYBA 4E2XA 3J7A4 1X0TA 3P5JB 2JA8I 1Y1VS 2JNYA 3MONA 5A2Qf 2R92I 2M6NA 1S72Z 4NBGA 1YJ9Z 3HOUI 1VQPZ 1WW9A 5A2Qb 4DGLA 4A3JI 4DK1A 4NBHA 2KPIA 4A3FI 4A3DI 1TFIA 3CCJ1 4NBAA 2G2KA 1WIIA 4HH4A 2Q51A 2OTJ1 3S17I 3CC21 3CCU1 3CPWY 1QF8A 3S1QI 3ESWA 2K5RA 4RVHA 2F4MA 1JWHC 3VMHA 1K9M1 1NP6A 4A3KI 1YUKA 4BBSI 3H3VJ 1SFOI 4MD9A 4E32A 3CCE1 3FQQA 3GTPI 2EGTA 3CC4Z 1W2BY 2WB1A 3GTMS 2NVYI 1VQ6Z 3T4NB 3HOYI 3NH8A 3CCR1 3HOVI 3FKII 1NJI2 1KRLA 1VQ7Z 1KQSY 3CC7Z 3G711 3VMGA 1M902 2GTHA 2GU2A 4X6AI 3EEDA 3NDJA 3S2HI 1YUAA 4S1TA 4MH4A 4RV9A 1YIT1 1VQNZ 2PMZA 3CXCZ 1X3WA 2JA6I 2QLVB 4NB9A 3EERA 2QEXZ 1VQK1 1ML8A 3GTJI 3GKQA 2QRCB 1QVFZ 3KIHA 3CCQ1 5CM2M 4DQYB 2DE7A 2LIYA 1QVGZ 3JAMb 1YJW1 3J80f 3S14I 3CCMZ 1LQLA 3KIFA 4RS4A 2JA5I 1RO2A 3CCV1 5IT9f 3GTLI 1R9TI 3S2DI 1N8R1 3BG0B 2JA7I 4NFRA 2QR1B 5IT9b 4BXXI 1RO0A 2QKDA 4A3LI 4Y7NI 4A93I 3VMIA 5T6BA 2RHBA 3CCS1 1WCMI 3CCRZ 3J81f 2LFUA 2ZAEB 1VQ81 3U50C 5D1PA 1VLAA 2VF1A 3OW2Z 1RQFA 1Q811 1M1K1 2NVXI 1YITZ 1YJNZ 3G6E1 3HOWI 5D1OA 1VQ9Z 3CXCY 3CD6Z 2GTIA 3F3PC 1Y1WI 2YADA 4RVGA 3CCL1 2R6MA 2QA4Z 1Q821 3GTQI 1K9M2 2E2HI 3CCQZ 3S1RI 4XX2A 2NVQI 4EWCA 1QVGY 3MZLB 1VQLZ 1K8A1 2H85A 4QTTA 5C4JI 3I551 1S7MA 2RIQA 2V8KA 3NDIA 4BBRI 3CCVZ 4NOZA 2E2JI 1K731 2IZ3A 1VQ4Z 1VQ5Z 3G4SZ 3K7AI 1Q7Y2 2RPRA 3TDHB 1Z01A 1ZB9A 2PK7A 2RBLA 3CMA1 3F3FC 1Q7Y1 5FLXf 2R93I 3PO3I 4HGYA 2JR6A 3D6WA 2YU9I 2Q4ZA 4NH1C 3FQMA 4MXUA 2OTL1 1RLYA 2B63I 2AKLA 2M48A 4A3EI 1S721 1TWCI 4E31A 1YJ91 3OW2Y 3PO2I 1VQP1 4E33A 2I3CA 1USPB 3QWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ Z;  2OTJ 1;  3CCS 1;  3CCR Z;  3CCS Z;  2OTJ Z;  3CC2 1;  3CC2 Z;  3CCU 1;  1N8R 2;  3CCU Z;  3CPW Y;  1VQM 1;  1VQ8 1;  1VQ8 Z;  1NJI 1;  1K9M 1;  1YHQ Z;  3OW2 Z;  1Q81 1;  1M1K 1;  3CCE 1;  1M90 1;  3CCE Z;  1YJN 1;  1YIT Z;  1YJN Z;  3I56 Z;  3G6E 1;  1YIJ Z;  1VQ9 1;  3G6E Z;  3CC4 1;  1VQ9 Z;  3CD6 1;  3CC4 Z;  3CXC Y;  3I55 Z;  3CD6 Z;  1W2B Y;  1Q86 1;  1VQ6 1;  1VQ6 Z;  3CCL 1;  3CCL Z;  2QA4 1;  3CCR 1;  2QA4 Z;  1Q82 1;  1KQS Z;  3CPW Z;  3CME Z;  1VQ7 1;  1NJI 2;  1K9M 2;  1VQ7 Z;  1KQS Y;  3CCQ Z;  3CC7 1;  3CC7 Z;  3G71 1;  3G71 Z;  1KD1 1;  1Q81 2;  1M1K 2;  1M90 2;  1YHQ 1;  1KC8 1;  1VQO Z;  1VQL 1;  1QVG Y;  1Q86 2;  1VQL Z;  1YIT 1;  3I56 1;  1K8A 1;  1VQN Z;  3CXC Z;  1YIJ 1;  1W2B Z;  3I55 1;  1JJ2 Y;  1Q82 2;  3CCV Z;  2QEX 1;  2QEX Z;  1VQK 1;  1VQ4 1;  1VQK Z;  1K73 1;  1KD1 2;  1VQ4 Z;  1VQ5 1;  2OTL Z;  3CME 1;  1VQ5 Z;  1QVF Z;  3CCQ 1;  3G4S 1;  1KC8 2;  3G4S Z;  1QVF Y;  1Q7Y 2;  1YI2 Z;  1K8A 2;  3CMA 1;  1VQO 1;  3CMA Z;  1Q7Y 1;  1QVG Z;  1YJW 1;  1YJW Z;  1VQN 1;  3CCM 1;  3CCM Z;  1JJ2 Z;  1K73 2;  3CCV 1;  2OTL 1;  1VQM Z;  1N8R 1;  1S72 1;  1YI2 1;  1S72 Z;  1YJ9 1;  3OW2 Y;  1YJ9 Z;  1VQP 1;  1VQP Z;  3CCJ 1; 
#chains in the Genus database with same CATH topology
 3CCJ Z;  5AN9 F;  4E30 A;  1PFT A;  1DL6 A;  2OTJ Z;  3CC2 Z;  1N8R 2;  3CCU Z;  3VTN A;  1VQM 1;  3CQZ I;  3J80 b;  2PM9 A;  2JS4 A;  3D2L A;  3IFU A;  2JUB A;  2NAP A;  3CCE Z;  3CC4 1;  2K3R A;  3I55 Z;  5C3E I;  1Q86 1;  1VQ6 1;  2BJO A;  5IP7 I;  2P3Y A;  1KQS Z;  4NBB A;  5FLM I;  1VQ7 1;  3BG1 B;  3H0G I;  2V8I A;  3CC7 1;  5C44 I;  3G71 Z;  1KD1 1;  4A3G I;  3NH4 A;  1Q81 2;  1M1K 2;  2W03 A;  4E2W A;  4Y52 I;  4E2Z A;  1YHQ 1;  1K83 I;  1KC8 1;  3I07 A;  3J81 b;  3RZD I;  3S15 I;  1P9N A;  3I56 1;  3GTK I;  1YIJ 1;  1WJ2 A;  4MD8 A;  1Q82 2;  5T67 A;  2QEX 1;  1RNI A;  2DE6 A;  4A3M I;  1VQK Z;  2OTL Z;  3CME 1;  3GTM I;  2OOY B;  1QYP A;  1QVF Y;  2AYD A;  3HKZ A;  1I3Q I;  1K8A 2;  1VQO 1;  2Y0S A;  4A3I I;  1YJW Z;  1Z02 A;  2OZK A;  3Q87 A;  3CCM 1;  2V45 A;  3S1N I;  1JJ2 Z;  1Q16 A;  1K73 2;  4BY1 I;  1X3Z A;  2VUG A;  4E2Y A;  2QRD B;  4NBE A;  1VQM Z;  2KI7 B;  3HOX I;  2P28 A;  1TWF I;  1ZB8 A;  2W04 A;  3HOZ I;  1YI2 1;  2J6A A;  1SIW A;  2NVT I;  2WAQ A;  1Z03 A;  2E9H A;  3S16 I;  3GTG I;  1TWH I;  3I4M I;  4BY7 I;  2JIQ A;  2LEX A;  4MON A;  3CCS Z;  5FLX b;  2O53 A;  1I50 I;  3NFZ A;  3IR7 A;  3S1M I;  4A3B I;  1I6H I;  1VQ8 Z;  1NJI 1;  1YHQ Z;  4RVF A;  3GCF A;  2HU9 A;  1M90 1;  4HGZ A;  2VUM I;  1YJN 1;  5T64 A;  4TNU A;  3I56 Z;  4NBF A;  1YIJ Z;  1VQ9 1;  2VPW A;  3G6E Z;  3CD6 1;  1NUI A;  3NH5 A;  3RZO I;  2O4H A;  1TWA I;  2JIO A;  5IP9 I;  3CCL Z;  2QA4 1;  1L1O C;  4A3C I;  3M3Y I;  3CPW Z;  3CME Z;  3JAM f;  3PO3 S;  3M4O I;  1RO4 A;  3MZK B;  1VQO Z;  1Y1V I;  5D1O B;  4NBD A;  4CL1 A;  1VQL 1;  1Q86 2;  4MRI A;  1W2B Z;  3D9X A;  4QTU A;  1JJ2 Y;  1TWG I;  3IF8 A;  4RVD A;  5C4X I;  2F4O A;  3LUS A;  3I4N I;  1VQ4 1;  2IZ4 A;  1KD1 2;  4NBC A;  1VQ5 1;  4NB8 A;  3TE5 B;  2JIR A;  4MD7 A;  1N2F A;  2OOX B;  2HF1 A;  3G4S 1;  1KC8 2;  2R7Z I;  1YI2 Z;  2JIM A;  2QRE B;  3CMA Z;  2DE5 A;  3VB9 A;  1VQN 1;  5LL6 f;  2E2I I;  2RT9 A;  3IX0 A;  2V8J A;  1ZH1 A;  2JMO A;  1USP A;  3GTO I;  4AYB A;  4E2X A;  3J7A 4;  1X0T A;  3P5J B;  2JA8 I;  1Y1V S;  2JNY A;  3MON A;  5A2Q f;  1AA6 A;  2R92 I;  2M6N A;  1S72 Z;  4NBG A;  1YJ9 Z;  3HOU I;  1VQP Z;  1WW9 A;  5A2Q b;  4DGL A;  4A3J I;  4DK1 A;  4NBH A;  2KPI A;  4A3F I;  4A3D I;  1TFI A;  3CCJ 1;  1FDI A;  4NBA A;  2G2K A;  1WII A;  4HH4 A;  2Q51 A;  2OTJ 1;  3S17 I;  3CC2 1;  3CCU 1;  3CPW Y;  1QF8 A;  3S1Q I;  3ESW A;  2K5R A;  4RVH A;  2F4M A;  1JWH C;  3VMH A;  2IV2 X;  1K9M 1;  1NP6 A;  4A3K I;  1YUK A;  4BBS I;  3H3V J;  1SFO I;  4MD9 A;  4E32 A;  3CCE 1;  3FQQ A;  3GTP I;  2EGT A;  3CC4 Z;  1W2B Y;  2WB1 A;  3GTM S;  2NVY I;  1VQ6 Z;  3T4N B;  3HOY I;  3NH8 A;  3CCR 1;  3HOV I;  3FKI I;  1NJI 2;  1KRL A;  1VQ7 Z;  1KQS Y;  3CC7 Z;  3G71 1;  3VMG A;  1M90 2;  2GTH A;  2GU2 A;  4X6A I;  3EED A;  3NDJ A;  3S2H I;  1YUA A;  4S1T A;  4MH4 A;  4RV9 A;  1YIT 1;  1VQN Z;  2PMZ A;  3CXC Z;  1X3W A;  2JA6 I;  2QLV B;  4NB9 A;  3EER A;  2QEX Z;  1VQK 1;  1ML8 A;  3GTJ I;  3GKQ A;  2QRC B;  1QVF Z;  3KIH A;  3CCQ 1;  5CM2 M;  4DQY B;  2DE7 A;  2LIY A;  1QVG Z;  3JAM b;  1YJW 1;  3J80 f;  3S14 I;  3CCM Z;  2JIP A;  1LQL A;  3KIF A;  4RS4 A;  2JA5 I;  1RO2 A;  3CCV 1;  5IT9 f;  3GTL I;  1R9T I;  3S2D I;  1N8R 1;  3BG0 B;  2JA7 I;  4NFR A;  1FDO A;  2QR1 B;  5IT9 b;  4BXX I;  1RO0 A;  2QKD A;  4A3L I;  2VPY A;  4Y7N I;  4A93 I;  3VMI A;  5T6B A;  2RHB A;  3CCS 1;  1WCM I;  3CCR Z;  3J81 f;  2LFU A;  2ZAE B;  1VQ8 1;  1WZN A;  3U50 C;  5D1P A;  1VLA A;  2VF1 A;  3OW2 Z;  1RQF A;  1Q81 1;  2VPZ A;  1M1K 1;  2NVX I;  1YIT Z;  1YJN Z;  3G6E 1;  3HOW I;  5D1O A;  1VQ9 Z;  3CXC Y;  3CD6 Z;  2GTI A;  3F3P C;  1Y1W I;  2YAD A;  4RVG A;  3CCL 1;  2R6M A;  2QA4 Z;  1Q82 1;  3GTQ I;  1K9M 2;  2E2H I;  3CCQ Z;  3S1R I;  1Y8C A;  2VPX A;  2E7Z A;  4XX2 A;  2NVQ I;  4EWC A;  1QVG Y;  3MZL B;  1VQL Z;  1K8A 1;  2H85 A;  4QTT A;  5C4J I;  3I55 1;  1S7M A;  2RIQ A;  2V8K A;  3NDI A;  4BBR I;  3CCV Z;  4NOZ A;  2E2J I;  1K73 1;  2IZ3 A;  1VQ4 Z;  1VQ5 Z;  3G4S Z;  3K7A I;  1Q7Y 2;  2RPR A;  3TDH B;  1Z01 A;  1ZB9 A;  2PK7 A;  2RBL A;  3CMA 1;  3F3F C;  1Q7Y 1;  5FLX f;  2R93 I;  3PO3 I;  4HGY A;  2JR6 A;  3D6W A;  2YU9 I;  2Q4Z A;  4NH1 C;  3FQM A;  4MXU A;  2OTL 1;  1RLY A;  2B63 I;  2AKL A;  2M48 A;  4A3E I;  1S72 1;  1TWC I;  4E31 A;  1YJ9 1;  3OW2 Y;  3PO2 I;  1VQP 1;  2V3V A;  4E33 A;  2I3C A;  1QXF A;  1USP B;  3QWU A; 
#chains in the Genus database with same CATH homology
 3CCJ Z;  5AN9 F;  4E30 A;  1PFT A;  1DL6 A;  2OTJ Z;  3CC2 Z;  1N8R 2;  3CCU Z;  3VTN A;  1VQM 1;  3CQZ I;  3J80 b;  2PM9 A;  2JS4 A;  3IFU A;  2JUB A;  3CCE Z;  3CC4 1;  2K3R A;  3I55 Z;  5C3E I;  1Q86 1;  1VQ6 1;  2BJO A;  5IP7 I;  2P3Y A;  1KQS Z;  4NBB A;  5FLM I;  1VQ7 1;  3BG1 B;  3H0G I;  2V8I A;  3CC7 1;  5C44 I;  3G71 Z;  1KD1 1;  4A3G I;  3NH4 A;  1Q81 2;  1M1K 2;  2W03 A;  4E2W A;  4Y52 I;  4E2Z A;  1YHQ 1;  1K83 I;  1KC8 1;  3I07 A;  3J81 b;  3RZD I;  3S15 I;  1P9N A;  3I56 1;  3GTK I;  1YIJ 1;  4MD8 A;  1Q82 2;  5T67 A;  2QEX 1;  1RNI A;  2DE6 A;  4A3M I;  1VQK Z;  2OTL Z;  3CME 1;  3GTM I;  2OOY B;  1QYP A;  1QVF Y;  3HKZ A;  1I3Q I;  1K8A 2;  1VQO 1;  2Y0S A;  4A3I I;  1YJW Z;  1Z02 A;  2OZK A;  3Q87 A;  3CCM 1;  3S1N I;  1JJ2 Z;  1K73 2;  4BY1 I;  1X3Z A;  2VUG A;  4E2Y A;  2QRD B;  4NBE A;  1VQM Z;  2KI7 B;  3HOX I;  2P28 A;  1TWF I;  1ZB8 A;  2W04 A;  3HOZ I;  1YI2 1;  2J6A A;  2NVT I;  2WAQ A;  1Z03 A;  2E9H A;  3S16 I;  3GTG I;  1TWH I;  3I4M I;  4BY7 I;  4MON A;  3CCS Z;  5FLX b;  2O53 A;  1I50 I;  3NFZ A;  3S1M I;  4A3B I;  1I6H I;  1VQ8 Z;  1NJI 1;  1YHQ Z;  4RVF A;  3GCF A;  2HU9 A;  1M90 1;  4HGZ A;  2VUM I;  1YJN 1;  5T64 A;  4TNU A;  3I56 Z;  4NBF A;  1YIJ Z;  1VQ9 1;  3G6E Z;  3CD6 1;  1NUI A;  3NH5 A;  3RZO I;  2O4H A;  1TWA I;  5IP9 I;  3CCL Z;  2QA4 1;  1L1O C;  4A3C I;  3M3Y I;  3CPW Z;  3CME Z;  3JAM f;  3PO3 S;  3M4O I;  1RO4 A;  3MZK B;  1VQO Z;  1Y1V I;  5D1O B;  4NBD A;  4CL1 A;  1VQL 1;  1Q86 2;  4MRI A;  1W2B Z;  3D9X A;  4QTU A;  1JJ2 Y;  1TWG I;  3IF8 A;  4RVD A;  5C4X I;  2F4O A;  3LUS A;  3I4N I;  1VQ4 1;  2IZ4 A;  1KD1 2;  4NBC A;  1VQ5 1;  4NB8 A;  3TE5 B;  4MD7 A;  1N2F A;  2OOX B;  2HF1 A;  3G4S 1;  1KC8 2;  2R7Z I;  1YI2 Z;  2QRE B;  3CMA Z;  2DE5 A;  3VB9 A;  1VQN 1;  5LL6 f;  2E2I I;  2RT9 A;  3IX0 A;  2V8J A;  1ZH1 A;  2JMO A;  1USP A;  3GTO I;  4AYB A;  4E2X A;  3J7A 4;  1X0T A;  3P5J B;  2JA8 I;  1Y1V S;  2JNY A;  3MON A;  5A2Q f;  2R92 I;  2M6N A;  1S72 Z;  4NBG A;  1YJ9 Z;  3HOU I;  1VQP Z;  1WW9 A;  5A2Q b;  4DGL A;  4A3J I;  4DK1 A;  4NBH A;  2KPI A;  4A3F I;  4A3D I;  1TFI A;  3CCJ 1;  4NBA A;  2G2K A;  1WII A;  4HH4 A;  2Q51 A;  2OTJ 1;  3S17 I;  3CC2 1;  3CCU 1;  3CPW Y;  1QF8 A;  3S1Q I;  3ESW A;  2K5R A;  4RVH A;  2F4M A;  1JWH C;  3VMH A;  1K9M 1;  1NP6 A;  4A3K I;  1YUK A;  4BBS I;  3H3V J;  1SFO I;  4MD9 A;  4E32 A;  3CCE 1;  3FQQ A;  3GTP I;  2EGT A;  3CC4 Z;  1W2B Y;  2WB1 A;  3GTM S;  2NVY I;  1VQ6 Z;  3T4N B;  3HOY I;  3NH8 A;  3CCR 1;  3HOV I;  3FKI I;  1NJI 2;  1KRL A;  1VQ7 Z;  1KQS Y;  3CC7 Z;  3G71 1;  3VMG A;  1M90 2;  2GTH A;  2GU2 A;  4X6A I;  3EED A;  3NDJ A;  3S2H I;  1YUA A;  4S1T A;  4MH4 A;  4RV9 A;  1YIT 1;  1VQN Z;  2PMZ A;  3CXC Z;  1X3W A;  2JA6 I;  2QLV B;  4NB9 A;  3EER A;  2QEX Z;  1VQK 1;  1ML8 A;  3GTJ I;  3GKQ A;  2QRC B;  1QVF Z;  3KIH A;  3CCQ 1;  5CM2 M;  4DQY B;  2DE7 A;  2LIY A;  1QVG Z;  3JAM b;  1YJW 1;  3J80 f;  3S14 I;  3CCM Z;  1LQL A;  3KIF A;  4RS4 A;  2JA5 I;  1RO2 A;  3CCV 1;  5IT9 f;  3GTL I;  1R9T I;  3S2D I;  1N8R 1;  3BG0 B;  2JA7 I;  4NFR A;  2QR1 B;  5IT9 b;  4BXX I;  1RO0 A;  2QKD A;  4A3L I;  4Y7N I;  4A93 I;  3VMI A;  5T6B A;  2RHB A;  3CCS 1;  1WCM I;  3CCR Z;  3J81 f;  2LFU A;  2ZAE B;  1VQ8 1;  3U50 C;  5D1P A;  1VLA A;  2VF1 A;  3OW2 Z;  1RQF A;  1Q81 1;  1M1K 1;  2NVX I;  1YIT Z;  1YJN Z;  3G6E 1;  3HOW I;  5D1O A;  1VQ9 Z;  3CXC Y;  3CD6 Z;  2GTI A;  3F3P C;  1Y1W I;  2YAD A;  4RVG A;  3CCL 1;  2R6M A;  2QA4 Z;  1Q82 1;  3GTQ I;  1K9M 2;  2E2H I;  3CCQ Z;  3S1R I;  4XX2 A;  2NVQ I;  4EWC A;  1QVG Y;  3MZL B;  1VQL Z;  1K8A 1;  2H85 A;  4QTT A;  5C4J I;  3I55 1;  1S7M A;  2RIQ A;  2V8K A;  3NDI A;  4BBR I;  3CCV Z;  4NOZ A;  2E2J I;  1K73 1;  2IZ3 A;  1VQ4 Z;  1VQ5 Z;  3G4S Z;  3K7A I;  1Q7Y 2;  2RPR A;  3TDH B;  1Z01 A;  1ZB9 A;  2PK7 A;  2RBL A;  3CMA 1;  3F3F C;  1Q7Y 1;  5FLX f;  2R93 I;  3PO3 I;  4HGY A;  2JR6 A;  3D6W A;  2YU9 I;  2Q4Z A;  4NH1 C;  3FQM A;  4MXU A;  2OTL 1;  1RLY A;  2B63 I;  2AKL A;  2M48 A;  4A3E I;  1S72 1;  1TWC I;  4E31 A;  1YJ9 1;  3OW2 Y;  3PO2 I;  1VQP 1;  4E33 A;  2I3C A;  1USP B;  3QWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...