3CCLZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cclZ00
3G71Z 3G4SZ 3CCMZ 2OTJ1 1K731 1VQK1 1QVGZ 3G6E1 1KC81 1Q811 3CD61 3CMA1 1NJI1 1Q822 1S721 3CCSZ 3I56Z 3CC41 1M1K2 1VQ41 1N8R1 1K9M2 1YJN1 3CC71 3CME1 1VQL1 2QEXZ 3CXCY 1VQ5Z 1K8A2 1Q7Y1 1M901 1VQ91 1W2BZ 3OW2Y 1VQN1 1VQO1 1JJ2Y 3CCJZ 2QA4Z 3G711 3G4S1 3I55Z 3CCEZ 3CCL1 1KQSY 3CCRZ 3OW2Z 1YIJ1 1KD11 1YHQ1 3CCS1 1KC82 1VQ81 3CC2Z 1VQMZ 1YJWZ 2OTLZ 2OTJZ 3CPWY 1Q821 1VQ7Z 2QEX1 1VQ51 3CCQ1 1VQ61 3CCU1 1VQPZ 3CCM1 3CCJ1 3CXCZ 2QA41 1Q861 3CCE1 3CC4Z 3CCR1 1JJ2Z 1YJNZ 3CC7Z 1YI2Z 1KQSZ 1K732 3I561 1YJ9Z 3CCVZ 1Q812 1QVGY 1VQ9Z 3CC21 1VQM1 1YITZ 1YJW1 2OTL1 1KD12 1NJI2 1VQKZ 3G6EZ 3CCLZ 1VQ71 1M1K1 1YIJZ 1K9M1 1N8R2 3CD6Z 3CPWZ 3CMAZ 1VQP1 1YHQZ 3I551 1S72Z 1K8A1 1Q7Y2 1M902 1VQ4Z 1QVFY 1VQ8Z 1W2BY 1YI21 3CMEZ 1VQLZ 1Q862 1YJ91 1QVFZ 3CCQZ 3CCV1 1VQNZ 1VQ6Z 1VQOZ 1YIT1 3CCUZ
chains in the Genus database with same CATH superfamily
3GTMI 3CCMZ 1Y1WI 2OTJ1 5A2Qf 2F4OA 2RBLA 1K731 1VQK1 1P9NA 1QVGZ 1ML8A 2GTHA 2M48A 1Q811 4E33A 2LIYA 3S1NI 2K5RA 4HH4A 2PM9A 2RT9A 2RPRA 1QF8A 1N8R1 1K9M2 1YJN1 3NH8A 4EWCA 4RVHA 1W2BZ 3I4MI 4E30A 3KIHA 1JJ2Y 3CCJZ 2V3VA 3I55Z 3CCL1 2JA7I 1YIJ1 4BY7I 2O53A 1JWHC 2V8KA 1TFIA 2JR6A 3Q87A 2IV2X 1WCMI 1Y8CA 1KC82 3GTOI 4NBGA 1VQMZ 3HOZI 1YJWZ 2QRCB 2JIOA 3RZOI 4MD9A 5FLXf 4NBDA 2DE6A 2R93I 2JIMA 3CCJ1 3CXCZ 5IT9f 3CC4Z 2VPYA 3ESWA 1WZNA 1YI2Z 4CL1A 1S7MA 4BY1I 4A3DI 1KQSZ 3D2LA 2VF1A 5C44I 1SIWA 2NVYI 1VQ9Z 1VQM1 1YJW1 5A2Qb 3S1MI 1KD12 1NJI2 2R7ZI 3HOXI 4BXXI 1M1K1 3FQQA 5IP7I 2VPXA 3CD6Z 4NBHA 1YHQZ 2QKDA 2W04A 3QWUA 1VQ4Z 2GTIA 2OOYB 1YI21 4A3BI 1Q862 5LL6f 1X3ZA 3I4NI 4NBAA 4NBFA 3S2DI 5C3EI 3GTGI 3S15I 3NFZA 3J81f 4Y52I 2BJOA 3HKZA 4NBCA 3CD61 2JIRA 1VQ41 4MONA 3CC71 1USPA 1Q16A 2P3YA 3P5JB 2R92I 1K8A2 3VB9A 5FLXb 1Q7Y1 4NB8A 3OW2Y 2DE7A 1PFTA 2QLVB 1WW9A 3CCRZ 3OW2Z 2HU9A 1USPB 2KPIA 3TDHB 2V8IA 1RO2A 2E2HI 3HOYI 5T6BA 2LEXA 2PK7A 3VMHA 2M6NA 3J80b 5IP9I 4RV9A 3GTKI 4E2ZA 1YUKA 3NH5A 4MD8A 4S1TA 1VQ61 3S1QI 4E2WA 3CCU1 4HGYA 3CCM1 4XX2A 3VTNA 4A3EI 3CCR1 1YUAA 2RHBA 1JJ2Z 2JA6I 5D1PA 2DE5A 1RNIA 1YJ9Z 3CCVZ 3GKQA 2QRDB 1YITZ 1N2FA 1TWHI 3J7A4 2JUBA 2AYDA 2YU9I 4NH1C 1Z02A 4BBSI 2W03A 5T67A 4X6AI 3IX0A 3I551 1S72Z 4A3II 4E2XA 1M902 1QVFY 1NP6A 1VQ8Z 2V45A 1VQLZ 1X3WA 1NUIA 3MONA 1YJ91 1QVFZ 3CCQZ 4BBRI 3CCV1 4A3JI 3M3YI 1YIT1 1I3QI 5AN9F 4A3CI 3PO3S 4QTTA 4A93I 2I3CA 1RQFA 3S2HI 5T64A 3NH4A 1NJI1 1Q822 1S721 4NOZA 3I56Z 3CC41 3CCSZ 3RZDI 1FDOA 4NBEA 2R6MA 1M1K2 1QXFA 1ZB8A 4A3LI 1KRLA 3NDJA 4MH4A 3VMIA 4DGLA 1VQL1 2IZ4A 4Y7NI 1VQ5Z 2E2II 3K7AI 1VQ91 1R9TI 2Q4ZA 3HOVI 3S1RI 4DQYB 2QA4Z 1TWFI 2WAQA 1Z03A 1ZH1A 1YHQ1 1TWCI 1I50I 3CCS1 3CC2Z 2EGTA 4NFRA 3LUSA 2OTLZ 2E9HA 2OTJZ 3CPWY 1VQ7Z 1RO4A 4NB9A 4RVFA 1VQ51 1QYPA 2AKLA 5D1OA 3GTJI 2VUGA 1Z01A 2QA41 5IT9b 1Y1VS 2OOXB 3MZLB 1YJNZ 4HGZA 1K732 3H0GI 5D1OB 1Q812 2H85A 1QVGY 3CC21 3TE5B 2P28A 2OTL1 3H3VJ 3GTMS 3HOUI 3G6EZ 3CCLZ 2JIPA 1VQ71 2IZ3A 2ZAEB 1TWAI 1YIJZ 1K9M1 1N8R2 2PMZA 4A3FI 3IR7A 1RLYA 2KI7B 4QTUA 3CMAZ 3M4OI 4DK1A 4E32A 2JNYA 3S17I 2VPWA 1W2BY 1L1OC 3CMEZ 3PO2I 2E7ZA 1VQNZ 2GU2A 5C4JI 2QR1B 2J6AA 1VLAA 1VQOZ 2F4MA 3G71Z 1DL6A 3G4SZ 2QREB 3J81b 3JAMf 4A3KI 3G6E1 3IFUA 1KC81 4RVGA 1X0TA 2Y0SA 2VUMI 2JA8I 3CMA1 3CQZI 3GTPI 2B63I 1SFOI 4E31A 3CME1 2QEXZ 3CXCY 2JS4A 1M901 1VQN1 2E2JI 3KIFA 3FKII 1VQO1 4A3MI 1K83I 3S14I 2K3RA 4TNUA 3G711 3G4S1 3CCEZ 1KQSY 3NDIA 3PO3I 2HF1A 1KD11 3D6WA 3IF8A 2WB1A 3S16I 3VMGA 2NVXI 1I6HI 5C4XI 1VQ81 3I07A 3HOWI 2OZKA 2YADA 3BG0B 2LFUA 3BG1B 4MD7A 4AYBA 3GTQI 2Q51A 1Q821 3F3FC 3J80f 2QEX1 3CCQ1 2NVQI 2JA5I 5CM2M 1AA6A 2NVTI 1VQPZ 1TWGI 1FDIA 1Q861 3CCE1 2NAPA 4A3GI 2VPZA 1ZB9A 3T4NB 4RS4A 3CC7Z 4E2YA 2JMOA 2V8JA 3I561 3MZKB 2RIQA 2JIQA 3U50C 1RO0A 4NBBA 4MRIA 3JAMb 3FQMA 1VQKZ 3GTLI 3GCFA 1LQLA 3F3PC 1WJ2A 4RVDA 3CPWZ 1VQP1 1K8A1 1Q7Y2 1Y1VI 3EEDA 2G2KA 3D9XA 3EERA 2O4HA 1WIIA 1VQ6Z 4MXUA 5FLMI 3CCUZ
chains in the Genus database with same CATH topology
3GTMI 3CCMZ 1Y1WI 2OTJ1 5A2Qf 2F4OA 2RBLA 1K731 1VQK1 1P9NA 1QVGZ 1ML8A 2GTHA 2M48A 1Q811 4E33A 2LIYA 3S1NI 2K5RA 4HH4A 2PM9A 2RT9A 2RPRA 1QF8A 1N8R1 1K9M2 1YJN1 3NH8A 4EWCA 4RVHA 1W2BZ 3I4MI 4E30A 3KIHA 1JJ2Y 3CCJZ 3I55Z 3CCL1 2JA7I 1YIJ1 4BY7I 2O53A 1JWHC 2V8KA 1TFIA 2JR6A 3Q87A 1WCMI 3GTOI 1KC82 4NBGA 1VQMZ 3HOZI 1YJWZ 2QRCB 3RZOI 4MD9A 5FLXf 4NBDA 2DE6A 2R93I 3CCJ1 3CXCZ 5IT9f 3CC4Z 3ESWA 1YI2Z 4CL1A 1S7MA 4BY1I 4A3DI 1KQSZ 2VF1A 5C44I 1VQ9Z 2NVYI 1VQM1 1YJW1 5A2Qb 3S1MI 1KD12 1NJI2 2R7ZI 3HOXI 4BXXI 1M1K1 3FQQA 5IP7I 3CD6Z 4NBHA 1YHQZ 2QKDA 2W04A 3QWUA 1VQ4Z 2GTIA 2OOYB 1YI21 4A3BI 1Q862 5LL6f 1X3ZA 3I4NI 4NBAA 4NBFA 3S2DI 5C3EI 3GTGI 3S15I 3NFZA 3J81f 4Y52I 2BJOA 3HKZA 4NBCA 3CD61 1VQ41 4MONA 3CC71 1USPA 2P3YA 3P5JB 2R92I 1K8A2 3VB9A 5FLXb 1Q7Y1 4NB8A 3OW2Y 2DE7A 1PFTA 2QLVB 1WW9A 3CCRZ 3OW2Z 2HU9A 1USPB 2KPIA 3TDHB 2V8IA 1RO2A 2E2HI 3HOYI 5T6BA 2PK7A 3VMHA 2M6NA 3J80b 5IP9I 4RV9A 3GTKI 4E2ZA 1YUKA 3NH5A 4MD8A 4S1TA 1VQ61 3S1QI 4E2WA 3CCU1 4HGYA 3CCM1 4XX2A 3VTNA 4A3EI 3CCR1 1YUAA 2RHBA 1JJ2Z 2JA6I 5D1PA 2DE5A 1RNIA 1YJ9Z 3CCVZ 3GKQA 2QRDB 1YITZ 1N2FA 1TWHI 3J7A4 2JUBA 2YU9I 4NH1C 1Z02A 4BBSI 2W03A 5T67A 4X6AI 3IX0A 3I551 1S72Z 4A3II 4E2XA 1M902 1QVFY 1NP6A 1VQ8Z 1VQLZ 1X3WA 1NUIA 3MONA 1YJ91 1QVFZ 3CCQZ 4BBRI 3CCV1 4A3JI 3M3YI 1YIT1 1I3QI 5AN9F 4A3CI 3PO3S 4QTTA 4A93I 2I3CA 1RQFA 3S2HI 5T64A 3NH4A 1NJI1 1Q822 1S721 4NOZA 3I56Z 3CC41 3CCSZ 3RZDI 4NBEA 2R6MA 1M1K2 1ZB8A 4A3LI 1KRLA 3NDJA 4MH4A 3VMIA 4DGLA 1VQL1 2IZ4A 4Y7NI 1VQ5Z 2E2II 3K7AI 1VQ91 1R9TI 2Q4ZA 3HOVI 3S1RI 4DQYB 2QA4Z 1TWFI 2WAQA 1Z03A 1ZH1A 1YHQ1 1TWCI 1I50I 3CCS1 3CC2Z 2EGTA 4NFRA 3LUSA 2OTLZ 2E9HA 2OTJZ 3CPWY 1VQ7Z 1RO4A 4NB9A 4RVFA 1VQ51 1QYPA 2AKLA 5D1OA 3GTJI 2VUGA 1Z01A 2QA41 5IT9b 1Y1VS 2OOXB 3MZLB 1YJNZ 4HGZA 1K732 3H0GI 5D1OB 1Q812 2H85A 1QVGY 3CC21 3TE5B 2P28A 2OTL1 3H3VJ 3GTMS 3HOUI 3G6EZ 3CCLZ 1VQ71 2IZ3A 2ZAEB 1TWAI 1YIJZ 1K9M1 1N8R2 2PMZA 4A3FI 1RLYA 2KI7B 4QTUA 3CMAZ 3M4OI 4DK1A 4E32A 2JNYA 3S17I 1W2BY 1L1OC 3CMEZ 3PO2I 1VQNZ 2GU2A 5C4JI 2QR1B 2J6AA 1VLAA 1VQOZ 2F4MA 3G71Z 1DL6A 3G4SZ 2QREB 3J81b 3JAMf 4A3KI 3G6E1 3IFUA 1KC81 4RVGA 1X0TA 2Y0SA 2VUMI 2JA8I 3CMA1 3CQZI 3GTPI 2B63I 1SFOI 4E31A 3CME1 2QEXZ 3CXCY 2JS4A 1M901 1VQN1 2E2JI 3KIFA 3FKII 1VQO1 4A3MI 1K83I 3S14I 2K3RA 4TNUA 3G711 3G4S1 3CCEZ 1KQSY 3NDIA 3PO3I 2HF1A 1KD11 3D6WA 3IF8A 2WB1A 3S16I 3VMGA 2NVXI 1I6HI 5C4XI 1VQ81 3I07A 3HOWI 2OZKA 2YADA 3BG0B 2LFUA 3BG1B 4MD7A 4AYBA 3GTQI 2Q51A 1Q821 3F3FC 3J80f 2QEX1 3CCQ1 2NVQI 2JA5I 5CM2M 2NVTI 1VQPZ 1TWGI 1Q861 3CCE1 4A3GI 1ZB9A 3T4NB 4RS4A 3CC7Z 4E2YA 2JMOA 2V8JA 3I561 3MZKB 2RIQA 3U50C 1RO0A 4NBBA 4MRIA 3JAMb 3FQMA 1VQKZ 3GTLI 3GCFA 1LQLA 3F3PC 4RVDA 3CPWZ 1VQP1 1K8A1 1Q7Y2 1Y1VI 3EEDA 2G2KA 3D9XA 3EERA 2O4HA 1WIIA 1VQ6Z 4MXUA 5FLMI 3CCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Z;  3G4S Z;  3CCM Z;  2OTJ 1;  1K73 1;  1VQK 1;  1QVG Z;  3G6E 1;  1KC8 1;  1Q81 1;  3CD6 1;  3CMA 1;  1NJI 1;  1Q82 2;  1S72 1;  3CCS Z;  3I56 Z;  3CC4 1;  1M1K 2;  1VQ4 1;  1N8R 1;  1K9M 2;  1YJN 1;  3CC7 1;  3CME 1;  1VQL 1;  2QEX Z;  3CXC Y;  1VQ5 Z;  1K8A 2;  1Q7Y 1;  1M90 1;  1VQ9 1;  1W2B Z;  3OW2 Y;  1VQN 1;  1VQO 1;  1JJ2 Y;  3CCJ Z;  2QA4 Z;  3G71 1;  3G4S 1;  3I55 Z;  3CCE Z;  3CCL 1;  1KQS Y;  3CCR Z;  3OW2 Z;  1YIJ 1;  1KD1 1;  1YHQ 1;  3CCS 1;  1KC8 2;  1VQ8 1;  3CC2 Z;  1VQM Z;  1YJW Z;  2OTL Z;  2OTJ Z;  3CPW Y;  1Q82 1;  1VQ7 Z;  2QEX 1;  1VQ5 1;  3CCQ 1;  1VQ6 1;  3CCU 1;  1VQP Z;  3CCM 1;  3CCJ 1;  3CXC Z;  2QA4 1;  1Q86 1;  3CCE 1;  3CC4 Z;  3CCR 1;  1JJ2 Z;  1YJN Z;  3CC7 Z;  1YI2 Z;  1KQS Z;  1K73 2;  3I56 1;  1YJ9 Z;  3CCV Z;  1Q81 2;  1QVG Y;  1VQ9 Z;  3CC2 1;  1VQM 1;  1YIT Z;  1YJW 1;  2OTL 1;  1KD1 2;  1NJI 2;  1VQK Z;  3G6E Z;  3CCL Z;  1VQ7 1;  1M1K 1;  1YIJ Z;  1K9M 1;  1N8R 2;  3CD6 Z;  3CPW Z;  3CMA Z;  1VQP 1;  1YHQ Z;  3I55 1;  1S72 Z;  1K8A 1;  1Q7Y 2;  1M90 2;  1VQ4 Z;  1QVF Y;  1VQ8 Z;  1W2B Y;  1YI2 1;  3CME Z;  1VQL Z;  1Q86 2;  1YJ9 1;  1QVF Z;  3CCQ Z;  3CCV 1;  1VQN Z;  1VQ6 Z;  1VQO Z;  1YIT 1;  3CCU Z; 
#chains in the Genus database with same CATH topology
 3GTM I;  3CCM Z;  1Y1W I;  2OTJ 1;  5A2Q f;  2F4O A;  2RBL A;  1K73 1;  1VQK 1;  1P9N A;  1QVG Z;  1ML8 A;  2GTH A;  2M48 A;  1Q81 1;  4E33 A;  2LIY A;  3S1N I;  2K5R A;  4HH4 A;  2PM9 A;  2RT9 A;  2RPR A;  1QF8 A;  1N8R 1;  1K9M 2;  1YJN 1;  3NH8 A;  4EWC A;  4RVH A;  1W2B Z;  3I4M I;  4E30 A;  3KIH A;  1JJ2 Y;  3CCJ Z;  2V3V A;  3I55 Z;  3CCL 1;  2JA7 I;  1YIJ 1;  4BY7 I;  2O53 A;  1JWH C;  2V8K A;  1TFI A;  2JR6 A;  3Q87 A;  2IV2 X;  1WCM I;  1Y8C A;  1KC8 2;  3GTO I;  4NBG A;  1VQM Z;  3HOZ I;  1YJW Z;  2QRC B;  2JIO A;  3RZO I;  4MD9 A;  5FLX f;  4NBD A;  2DE6 A;  2R93 I;  2JIM A;  3CCJ 1;  3CXC Z;  5IT9 f;  3CC4 Z;  2VPY A;  3ESW A;  1WZN A;  1YI2 Z;  4CL1 A;  1S7M A;  4BY1 I;  4A3D I;  1KQS Z;  3D2L A;  2VF1 A;  5C44 I;  1SIW A;  2NVY I;  1VQ9 Z;  1VQM 1;  1YJW 1;  5A2Q b;  3S1M I;  1KD1 2;  1NJI 2;  2R7Z I;  3HOX I;  4BXX I;  1M1K 1;  3FQQ A;  5IP7 I;  2VPX A;  3CD6 Z;  4NBH A;  1YHQ Z;  2QKD A;  2W04 A;  3QWU A;  1VQ4 Z;  2GTI A;  2OOY B;  1YI2 1;  4A3B I;  1Q86 2;  5LL6 f;  1X3Z A;  3I4N I;  4NBA A;  4NBF A;  3S2D I;  5C3E I;  3GTG I;  3S15 I;  3NFZ A;  3J81 f;  4Y52 I;  2BJO A;  3HKZ A;  4NBC A;  3CD6 1;  2JIR A;  1VQ4 1;  4MON A;  3CC7 1;  1USP A;  1Q16 A;  2P3Y A;  3P5J B;  2R92 I;  1K8A 2;  3VB9 A;  5FLX b;  1Q7Y 1;  4NB8 A;  3OW2 Y;  2DE7 A;  1PFT A;  2QLV B;  1WW9 A;  3CCR Z;  3OW2 Z;  2HU9 A;  1USP B;  2KPI A;  3TDH B;  2V8I A;  1RO2 A;  2E2H I;  3HOY I;  5T6B A;  2LEX A;  2PK7 A;  3VMH A;  2M6N A;  3J80 b;  5IP9 I;  4RV9 A;  3GTK I;  4E2Z A;  1YUK A;  3NH5 A;  4MD8 A;  4S1T A;  1VQ6 1;  3S1Q I;  4E2W A;  3CCU 1;  4HGY A;  3CCM 1;  4XX2 A;  3VTN A;  4A3E I;  3CCR 1;  1YUA A;  2RHB A;  1JJ2 Z;  2JA6 I;  5D1P A;  2DE5 A;  1RNI A;  1YJ9 Z;  3CCV Z;  3GKQ A;  2QRD B;  1YIT Z;  1N2F A;  1TWH I;  3J7A 4;  2JUB A;  2AYD A;  2YU9 I;  4NH1 C;  1Z02 A;  4BBS I;  2W03 A;  5T67 A;  4X6A I;  3IX0 A;  3I55 1;  1S72 Z;  4A3I I;  4E2X A;  1M90 2;  1QVF Y;  1NP6 A;  1VQ8 Z;  2V45 A;  1VQL Z;  1X3W A;  1NUI A;  3MON A;  1YJ9 1;  1QVF Z;  3CCQ Z;  4BBR I;  3CCV 1;  4A3J I;  3M3Y I;  1YIT 1;  1I3Q I;  5AN9 F;  4A3C I;  3PO3 S;  4QTT A;  4A93 I;  2I3C A;  1RQF A;  3S2H I;  5T64 A;  3NH4 A;  1NJI 1;  1Q82 2;  1S72 1;  4NOZ A;  3I56 Z;  3CC4 1;  3CCS Z;  3RZD I;  1FDO A;  4NBE A;  2R6M A;  1M1K 2;  1QXF A;  1ZB8 A;  4A3L I;  1KRL A;  3NDJ A;  4MH4 A;  3VMI A;  4DGL A;  1VQL 1;  2IZ4 A;  4Y7N I;  1VQ5 Z;  2E2I I;  3K7A I;  1VQ9 1;  1R9T I;  2Q4Z A;  3HOV I;  3S1R I;  4DQY B;  2QA4 Z;  1TWF I;  2WAQ A;  1Z03 A;  1ZH1 A;  1YHQ 1;  1TWC I;  1I50 I;  3CCS 1;  3CC2 Z;  2EGT A;  4NFR A;  3LUS A;  2OTL Z;  2E9H A;  2OTJ Z;  3CPW Y;  1VQ7 Z;  1RO4 A;  4NB9 A;  4RVF A;  1VQ5 1;  1QYP A;  2AKL A;  5D1O A;  3GTJ I;  2VUG A;  1Z01 A;  2QA4 1;  5IT9 b;  1Y1V S;  2OOX B;  3MZL B;  1YJN Z;  4HGZ A;  1K73 2;  3H0G I;  5D1O B;  1Q81 2;  2H85 A;  1QVG Y;  3CC2 1;  3TE5 B;  2P28 A;  2OTL 1;  3H3V J;  3GTM S;  3HOU I;  3G6E Z;  3CCL Z;  2JIP A;  1VQ7 1;  2IZ3 A;  2ZAE B;  1TWA I;  1YIJ Z;  1K9M 1;  1N8R 2;  2PMZ A;  4A3F I;  3IR7 A;  1RLY A;  2KI7 B;  4QTU A;  3CMA Z;  3M4O I;  4DK1 A;  4E32 A;  2JNY A;  3S17 I;  2VPW A;  1W2B Y;  1L1O C;  3CME Z;  3PO2 I;  2E7Z A;  1VQN Z;  2GU2 A;  5C4J I;  2QR1 B;  2J6A A;  1VLA A;  1VQO Z;  2F4M A;  3G71 Z;  1DL6 A;  3G4S Z;  2QRE B;  3J81 b;  3JAM f;  4A3K I;  3G6E 1;  3IFU A;  1KC8 1;  4RVG A;  1X0T A;  2Y0S A;  2VUM I;  2JA8 I;  3CMA 1;  3CQZ I;  3GTP I;  2B63 I;  1SFO I;  4E31 A;  3CME 1;  2QEX Z;  3CXC Y;  2JS4 A;  1M90 1;  1VQN 1;  2E2J I;  3KIF A;  3FKI I;  1VQO 1;  4A3M I;  1K83 I;  3S14 I;  2K3R A;  4TNU A;  3G71 1;  3G4S 1;  3CCE Z;  1KQS Y;  3NDI A;  3PO3 I;  2HF1 A;  1KD1 1;  3D6W A;  3IF8 A;  2WB1 A;  3S16 I;  3VMG A;  2NVX I;  1I6H I;  5C4X I;  1VQ8 1;  3I07 A;  3HOW I;  2OZK A;  2YAD A;  3BG0 B;  2LFU A;  3BG1 B;  4MD7 A;  4AYB A;  3GTQ I;  2Q51 A;  1Q82 1;  3F3F C;  3J80 f;  2QEX 1;  3CCQ 1;  2NVQ I;  2JA5 I;  5CM2 M;  1AA6 A;  2NVT I;  1VQP Z;  1TWG I;  1FDI A;  1Q86 1;  3CCE 1;  2NAP A;  4A3G I;  2VPZ A;  1ZB9 A;  3T4N B;  4RS4 A;  3CC7 Z;  4E2Y A;  2JMO A;  2V8J A;  3I56 1;  3MZK B;  2RIQ A;  2JIQ A;  3U50 C;  1RO0 A;  4NBB A;  4MRI A;  3JAM b;  3FQM A;  1VQK Z;  3GTL I;  3GCF A;  1LQL A;  3F3P C;  1WJ2 A;  4RVD A;  3CPW Z;  1VQP 1;  1K8A 1;  1Q7Y 2;  1Y1V I;  3EED A;  2G2K A;  3D9X A;  3EER A;  2O4H A;  1WII A;  1VQ6 Z;  4MXU A;  5FLM I;  3CCU Z; 
#chains in the Genus database with same CATH homology
 3GTM I;  3CCM Z;  1Y1W I;  2OTJ 1;  5A2Q f;  2F4O A;  2RBL A;  1K73 1;  1VQK 1;  1P9N A;  1QVG Z;  1ML8 A;  2GTH A;  2M48 A;  1Q81 1;  4E33 A;  2LIY A;  3S1N I;  2K5R A;  4HH4 A;  2PM9 A;  2RT9 A;  2RPR A;  1QF8 A;  1N8R 1;  1K9M 2;  1YJN 1;  3NH8 A;  4EWC A;  4RVH A;  1W2B Z;  3I4M I;  4E30 A;  3KIH A;  1JJ2 Y;  3CCJ Z;  3I55 Z;  3CCL 1;  2JA7 I;  1YIJ 1;  4BY7 I;  2O53 A;  1JWH C;  2V8K A;  1TFI A;  2JR6 A;  3Q87 A;  1WCM I;  3GTO I;  1KC8 2;  4NBG A;  1VQM Z;  3HOZ I;  1YJW Z;  2QRC B;  3RZO I;  4MD9 A;  5FLX f;  4NBD A;  2DE6 A;  2R93 I;  3CCJ 1;  3CXC Z;  5IT9 f;  3CC4 Z;  3ESW A;  1YI2 Z;  4CL1 A;  1S7M A;  4BY1 I;  4A3D I;  1KQS Z;  2VF1 A;  5C44 I;  1VQ9 Z;  2NVY I;  1VQM 1;  1YJW 1;  5A2Q b;  3S1M I;  1KD1 2;  1NJI 2;  2R7Z I;  3HOX I;  4BXX I;  1M1K 1;  3FQQ A;  5IP7 I;  3CD6 Z;  4NBH A;  1YHQ Z;  2QKD A;  2W04 A;  3QWU A;  1VQ4 Z;  2GTI A;  2OOY B;  1YI2 1;  4A3B I;  1Q86 2;  5LL6 f;  1X3Z A;  3I4N I;  4NBA A;  4NBF A;  3S2D I;  5C3E I;  3GTG I;  3S15 I;  3NFZ A;  3J81 f;  4Y52 I;  2BJO A;  3HKZ A;  4NBC A;  3CD6 1;  1VQ4 1;  4MON A;  3CC7 1;  1USP A;  2P3Y A;  3P5J B;  2R92 I;  1K8A 2;  3VB9 A;  5FLX b;  1Q7Y 1;  4NB8 A;  3OW2 Y;  2DE7 A;  1PFT A;  2QLV B;  1WW9 A;  3CCR Z;  3OW2 Z;  2HU9 A;  1USP B;  2KPI A;  3TDH B;  2V8I A;  1RO2 A;  2E2H I;  3HOY I;  5T6B A;  2PK7 A;  3VMH A;  2M6N A;  3J80 b;  5IP9 I;  4RV9 A;  3GTK I;  4E2Z A;  1YUK A;  3NH5 A;  4MD8 A;  4S1T A;  1VQ6 1;  3S1Q I;  4E2W A;  3CCU 1;  4HGY A;  3CCM 1;  4XX2 A;  3VTN A;  4A3E I;  3CCR 1;  1YUA A;  2RHB A;  1JJ2 Z;  2JA6 I;  5D1P A;  2DE5 A;  1RNI A;  1YJ9 Z;  3CCV Z;  3GKQ A;  2QRD B;  1YIT Z;  1N2F A;  1TWH I;  3J7A 4;  2JUB A;  2YU9 I;  4NH1 C;  1Z02 A;  4BBS I;  2W03 A;  5T67 A;  4X6A I;  3IX0 A;  3I55 1;  1S72 Z;  4A3I I;  4E2X A;  1M90 2;  1QVF Y;  1NP6 A;  1VQ8 Z;  1VQL Z;  1X3W A;  1NUI A;  3MON A;  1YJ9 1;  1QVF Z;  3CCQ Z;  4BBR I;  3CCV 1;  4A3J I;  3M3Y I;  1YIT 1;  1I3Q I;  5AN9 F;  4A3C I;  3PO3 S;  4QTT A;  4A93 I;  2I3C A;  1RQF A;  3S2H I;  5T64 A;  3NH4 A;  1NJI 1;  1Q82 2;  1S72 1;  4NOZ A;  3I56 Z;  3CC4 1;  3CCS Z;  3RZD I;  4NBE A;  2R6M A;  1M1K 2;  1ZB8 A;  4A3L I;  1KRL A;  3NDJ A;  4MH4 A;  3VMI A;  4DGL A;  1VQL 1;  2IZ4 A;  4Y7N I;  1VQ5 Z;  2E2I I;  3K7A I;  1VQ9 1;  1R9T I;  2Q4Z A;  3HOV I;  3S1R I;  4DQY B;  2QA4 Z;  1TWF I;  2WAQ A;  1Z03 A;  1ZH1 A;  1YHQ 1;  1TWC I;  1I50 I;  3CCS 1;  3CC2 Z;  2EGT A;  4NFR A;  3LUS A;  2OTL Z;  2E9H A;  2OTJ Z;  3CPW Y;  1VQ7 Z;  1RO4 A;  4NB9 A;  4RVF A;  1VQ5 1;  1QYP A;  2AKL A;  5D1O A;  3GTJ I;  2VUG A;  1Z01 A;  2QA4 1;  5IT9 b;  1Y1V S;  2OOX B;  3MZL B;  1YJN Z;  4HGZ A;  1K73 2;  3H0G I;  5D1O B;  1Q81 2;  2H85 A;  1QVG Y;  3CC2 1;  3TE5 B;  2P28 A;  2OTL 1;  3H3V J;  3GTM S;  3HOU I;  3G6E Z;  3CCL Z;  1VQ7 1;  2IZ3 A;  2ZAE B;  1TWA I;  1YIJ Z;  1K9M 1;  1N8R 2;  2PMZ A;  4A3F I;  1RLY A;  2KI7 B;  4QTU A;  3CMA Z;  3M4O I;  4DK1 A;  4E32 A;  2JNY A;  3S17 I;  1W2B Y;  1L1O C;  3CME Z;  3PO2 I;  1VQN Z;  2GU2 A;  5C4J I;  2QR1 B;  2J6A A;  1VLA A;  1VQO Z;  2F4M A;  3G71 Z;  1DL6 A;  3G4S Z;  2QRE B;  3J81 b;  3JAM f;  4A3K I;  3G6E 1;  3IFU A;  1KC8 1;  4RVG A;  1X0T A;  2Y0S A;  2VUM I;  2JA8 I;  3CMA 1;  3CQZ I;  3GTP I;  2B63 I;  1SFO I;  4E31 A;  3CME 1;  2QEX Z;  3CXC Y;  2JS4 A;  1M90 1;  1VQN 1;  2E2J I;  3KIF A;  3FKI I;  1VQO 1;  4A3M I;  1K83 I;  3S14 I;  2K3R A;  4TNU A;  3G71 1;  3G4S 1;  3CCE Z;  1KQS Y;  3NDI A;  3PO3 I;  2HF1 A;  1KD1 1;  3D6W A;  3IF8 A;  2WB1 A;  3S16 I;  3VMG A;  2NVX I;  1I6H I;  5C4X I;  1VQ8 1;  3I07 A;  3HOW I;  2OZK A;  2YAD A;  3BG0 B;  2LFU A;  3BG1 B;  4MD7 A;  4AYB A;  3GTQ I;  2Q51 A;  1Q82 1;  3F3F C;  3J80 f;  2QEX 1;  3CCQ 1;  2NVQ I;  2JA5 I;  5CM2 M;  2NVT I;  1VQP Z;  1TWG I;  1Q86 1;  3CCE 1;  4A3G I;  1ZB9 A;  3T4N B;  4RS4 A;  3CC7 Z;  4E2Y A;  2JMO A;  2V8J A;  3I56 1;  3MZK B;  2RIQ A;  3U50 C;  1RO0 A;  4NBB A;  4MRI A;  3JAM b;  3FQM A;  1VQK Z;  3GTL I;  3GCF A;  1LQL A;  3F3P C;  4RVD A;  3CPW Z;  1VQP 1;  1K8A 1;  1Q7Y 2;  1Y1V I;  3EED A;  2G2K A;  3D9X A;  3EER A;  2O4H A;  1WII A;  1VQ6 Z;  4MXU A;  5FLM I;  3CCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...