2M6NA

3d solution structure of emi1 (early mitotic inhibitor 1)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
SLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords F-box only protein 5
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2m6nA00
2M6NA 2M48A 2RT9A 4MD9A 3EEDA 2R6MA 1QF8A 1RQFA 4MD8A 1JWHC 4NH1C 4DGLA 2JMOA 4MD7A
chains in the Genus database with same CATH superfamily
1NJI1 2JA8I 1VQO1 1S72Z 5A2Qb 1L1OC 3CQZI 3CC41 3P5JB 1WJ2A 3CCQZ 3I4MI 5IP7I 1YJ91 1VQ41 1SFOI 1YJWZ 1KC82 2JA5I 4E2XA 1Y1WI 3G711 4QTTA 3CCJ1 3GTJI 4MH4A 1YI2Z 3M3YI 2VF1A 2O53A 2V3VA 3RZDI 3I4NI 2BJOA 3GTMI 3CPWY 2M48A 4TNUA 1K9M2 2F4MA 1TWCI 3MZKB 4E31A 3G6EZ 1K8A1 4RVGA 2NVXI 5AN9F 3KIHA 1X3ZA 1YIJ1 4NBAA 1YUKA 1KC81 3CCU1 5CM2M 3I551 3CCL1 5LL6f 5C4XI 3J80b 1VQM1 4DGLA 2OZKA 1KQSY 1QYPA 2JR6A 3CCQ1 3CC4Z 4A3FI 3MZLB 1VQK1 1K83I 1YHQ1 3H3VJ 2E2HI 1VQL1 3J7A4 3CCEZ 3F3PC 1VQ8Z 4A3DI 3CC7Z 4E30A 1VQPZ 1WCMI 2R92I 4MONA 1VQKZ 2V45A 1R9TI 1M1K2 3CCS1 3LUSA 1SIWA 1Q16A 4E33A 4S1TA 1NP6A 2E2II 1RLYA 1TWGI 1QVGY 1AA6A 5IT9b 2VUMI 4NBBA 5C3EI 4A3EI 1Q812 4NBCA 3CXCZ 2KPIA 4Y52I 1RQFA 2QRCB 1WZNA 3CMA1 2YADA 1N8R1 2WAQA 1JJ2Z 3VTNA 2YU9I 4E2WA 3BG1B 1S721 1QVGZ 2E7ZA 1RO2A 2JIQA 1ZB9A 3NDIA 3S15I 1YUAA 1YJW1 2NVQI 4RVHA 3CCMZ 4A93I 1YJNZ 3CC71 2DE5A 2GTHA 4HH4A 1JWHC 1WIIA 3HOUI 5FLXf 4MD8A 4A3II 3GKQA 5C4JI 3S16I 2JMOA 1N8R2 2Q51A 2V8IA 3CC21 3PO3I 2HF1A 5D1OA 1LQLA 2R6MA 2AKLA 2OTJ1 1VQLZ 5T67A 4BY1I 3GTGI 4HGZA 2JA7I 3KIFA 3G71Z 2I3CA 2VPXA 2PK7A 4E2ZA 2LFUA 3GTKI 2K5RA 1Q7Y1 3RZOI 3OW2Y 4A3JI 2H85A 2VPYA 1TWHI 1QVFZ 1VQ6Z 1I6HI 4NBEA 2W03A 1KQSZ 3HOWI 2Q4ZA 4NH1C 1M901 2JS4A 1VQ4Z 3J81b 4E2YA 4NBDA 2QR1B 3CCV1 1Z01A 2JIMA 4NB9A 3S2DI 4X6AI 1Y1VI 3CMEZ 1VQ5Z 3Q87A 1I3QI 2P3YA 4BBRI 1YIT1 2IZ3A 2R93I 2GTIA 3G4SZ 3MONA 2QEX1 1P9NA 2PMZA 3IFUA 1YHQZ 2ZAEB 3D6WA 4NB8A 3EERA 4DK1A 1YITZ 1S7MA 2VUGA 4A3BI 3NDJA 1RO0A 3G4S1 1VQMZ 3QWUA 3I07A 2OTL1 4MRIA 4NBFA 3JAMf 5FLXb 2QA4Z 1K8A2 1USPB 1KD12 1JJ2Y 2VPWA 3FQMA 5FLMI 2OTJZ 4CL1A 3HKZA 1TWFI 1ZB8A 5T6BA 4A3CI 3HOYI 3GTOI 3G6E1 1YI21 1VQNZ 4NBHA 1PFTA 3CCVZ 2OOXB 5C44I 3CD6Z 1Q821 3I56Z 1K732 3CME1 2E9HA 3S1QI 4QTUA 3I55Z 1M902 3NFZA 1VLAA 3CCUZ 1QF8A 1VQ71 1QXFA 2RT9A 3NH4A 3GTMS 2LIYA 1Q861 3F3FC 4MD7A 2B63I 3CC2Z 3CCSZ 2F4OA 2NAPA 2O4HA 3T4NB 1W2BY 2K3RA 3CCM1 4EWCA 1VQ91 2Y0SA 3PO2I 4BY7I 3HOXI 3FQQA 2QRDB 3IX0A 3J80f 2LEXA 1WW9A 1W2BZ 1ZH1A 2DE6A 3CCE1 1VQ9Z 3VMGA 3D9XA 2JA6I 4NOZA 5IP9I 3HOZI 4RVFA 3CPWZ 3S1MI 3NH5A 3TE5B 3S1NI 1Q7Y2 2JIPA 1FDIA 1VQP1 1NJI2 4BXXI 1X3WA 2G2KA 1X0TA 3GTQI 1Q822 1K731 4RS4A 1I50I 1Z03A 4A3MI 1KRLA 2GU2A 2VPZA 3M4OI 1N2FA 4MD9A 2JNYA 4RV9A 3IF8A 4DQYB 1Y8CA 3FKII 3GCFA 2E2JI 3NH8A 3CXCY 3CCR1 1K9M1 3I561 3S1RI 4A3KI 2R7ZI 5A2Qf 2IZ4A 3IR7A 3H0GI 2DE7A 2V8JA 1Q862 4RVDA 4A3GI 3JAMb 2NVYI 3OW2Z 1VQ7Z 3J81f 2W04A 2J6AA 3PO3S 5D1OB 5T64A 1M1K1 4HGYA 1RNIA 2RIQA 2OOYB 3HOVI 4XX2A 3K7AI 4E32A 2QEXZ 4AYBA 5D1PA 1Y1VS 2QKDA 1Q811 2IV2X 3CCLZ 1TWAI 3VMIA 3D2LA 3ESWA 3CMAZ 1NUIA 1ML8A 2P28A 5IT9f 1KD11 4Y7NI 1YJN1 2JIRA 4NFRA 2QLVB 1VQOZ 2QA41 2QREB 1DL6A 1FDOA 4BBSI 3TDHB 2RPRA 1YJ9Z 3S2HI 2EGTA 1QVFY 2PM9A 3GTLI 1VQ61 2NVTI 3VB9A 3GTPI 2JUBA 3S14I 3S17I 1YIJZ 1Z02A 3CD61 2OTLZ 3CCRZ 2KI7B 2JIOA 4NBGA 3CCJZ 2HU9A 1RO4A 2RHBA 3BG0B 4A3LI 1TFIA 3VMHA 1VQ51 1VQN1 2AYDA 4MXUA 3U50C 2M6NA 1USPA 2WB1A 3EEDA 1VQ81 2RBLA 2V8KA
chains in the Genus database with same CATH topology
1NJI1 2JA8I 1VQO1 1S72Z 5A2Qb 1L1OC 3CQZI 3CC41 3P5JB 3CCQZ 3I4MI 5IP7I 1YJ91 1VQ41 1SFOI 1YJWZ 1KC82 2JA5I 4E2XA 1Y1WI 3G711 4QTTA 3CCJ1 3GTJI 4MH4A 1YI2Z 3M3YI 2VF1A 2O53A 3RZDI 3I4NI 2BJOA 3GTMI 3CPWY 2M48A 4TNUA 1K9M2 2F4MA 1TWCI 3MZKB 4E31A 3G6EZ 1K8A1 4RVGA 2NVXI 5AN9F 3KIHA 1X3ZA 1YIJ1 4NBAA 1YUKA 1KC81 3CCU1 5CM2M 3I551 3CCL1 5LL6f 5C4XI 3J80b 1VQM1 4DGLA 2OZKA 1KQSY 1QYPA 2JR6A 3CCQ1 3CC4Z 4A3FI 3MZLB 1VQK1 1K83I 1YHQ1 3H3VJ 2E2HI 1VQL1 3J7A4 3CCEZ 3F3PC 1VQ8Z 4A3DI 3CC7Z 4E30A 1VQPZ 1WCMI 2R92I 4MONA 1VQKZ 1R9TI 1M1K2 3CCS1 3LUSA 4E33A 4S1TA 1NP6A 2E2II 1RLYA 1TWGI 1QVGY 5IT9b 2VUMI 4NBBA 5C3EI 4A3EI 1Q812 4NBCA 3CXCZ 2KPIA 4Y52I 1RQFA 2QRCB 3CMA1 2YADA 1N8R1 2WAQA 1JJ2Z 3VTNA 2YU9I 4E2WA 3BG1B 1S721 1QVGZ 1RO2A 3S15I 1ZB9A 3NDIA 1YUAA 1YJW1 2NVQI 4RVHA 3CCMZ 4A93I 1YJNZ 3CC71 2DE5A 2GTHA 4HH4A 1JWHC 1WIIA 3HOUI 5FLXf 4MD8A 4A3II 3GKQA 5C4JI 3S16I 2JMOA 1N8R2 2Q51A 2V8IA 3CC21 3PO3I 2HF1A 5D1OA 1LQLA 2R6MA 2AKLA 2OTJ1 1VQLZ 5T67A 4BY1I 3GTGI 4HGZA 2JA7I 3KIFA 3G71Z 2I3CA 2PK7A 4E2ZA 2LFUA 3GTKI 2K5RA 1Q7Y1 3RZOI 3OW2Y 4A3JI 2H85A 1TWHI 1QVFZ 1VQ6Z 1I6HI 4NBEA 2W03A 1KQSZ 3HOWI 2Q4ZA 4NH1C 1M901 2JS4A 1VQ4Z 3J81b 4E2YA 4NBDA 2QR1B 3CCV1 1Z01A 4NB9A 3S2DI 4X6AI 1Y1VI 3CMEZ 1VQ5Z 3Q87A 1I3QI 2P3YA 4BBRI 1YIT1 2IZ3A 2R93I 2GTIA 3G4SZ 3MONA 2QEX1 1P9NA 2PMZA 3IFUA 1YHQZ 2ZAEB 3D6WA 4NB8A 3EERA 4DK1A 1YITZ 1S7MA 2VUGA 4A3BI 3NDJA 1RO0A 3G4S1 1VQMZ 3QWUA 3I07A 2OTL1 4MRIA 4NBFA 3JAMf 5FLXb 2QA4Z 1K8A2 1USPB 1KD12 1JJ2Y 3FQMA 5FLMI 2OTJZ 4CL1A 3HKZA 1TWFI 1ZB8A 5T6BA 4A3CI 3HOYI 3GTOI 3G6E1 1YI21 1VQNZ 4NBHA 1PFTA 3CCVZ 2OOXB 5C44I 3CD6Z 1K732 1Q821 3I56Z 3CME1 2E9HA 3S1QI 4QTUA 3I55Z 1M902 3NFZA 1VLAA 3CCUZ 1QF8A 1VQ71 2RT9A 3NH4A 3GTMS 2LIYA 1Q861 3F3FC 4MD7A 2B63I 3CC2Z 3CCSZ 2F4OA 2O4HA 3T4NB 1W2BY 2K3RA 3CCM1 4EWCA 1VQ91 2Y0SA 3PO2I 4BY7I 3HOXI 3FQQA 2QRDB 3IX0A 3J80f 1WW9A 1W2BZ 1ZH1A 2DE6A 3CCE1 1VQ9Z 3VMGA 3D9XA 2JA6I 4NOZA 5IP9I 3HOZI 4RVFA 3CPWZ 3S1MI 3NH5A 3TE5B 3S1NI 1Q7Y2 1VQP1 1NJI2 4BXXI 1X3WA 2G2KA 1X0TA 3GTQI 1Q822 1K731 4RS4A 1I50I 1Z03A 4A3MI 1KRLA 2GU2A 3M4OI 1N2FA 4MD9A 2JNYA 4RV9A 3IF8A 4DQYB 3FKII 3GCFA 2E2JI 3NH8A 3CXCY 3CCR1 1K9M1 3I561 3S1RI 4A3KI 2R7ZI 5A2Qf 2IZ4A 3H0GI 2DE7A 2V8JA 1Q862 4RVDA 4A3GI 3JAMb 2NVYI 3OW2Z 1VQ7Z 3J81f 2W04A 2J6AA 3PO3S 5D1OB 5T64A 1M1K1 4HGYA 1RNIA 2RIQA 2OOYB 3HOVI 4XX2A 3K7AI 4E32A 2QEXZ 4AYBA 5D1PA 1Y1VS 2QKDA 1Q811 1TWAI 3CCLZ 3VMIA 3ESWA 3CMAZ 1NUIA 1ML8A 2P28A 5IT9f 1KD11 4Y7NI 1YJN1 4NFRA 2QLVB 1VQOZ 2QA41 2QREB 1DL6A 4BBSI 3TDHB 2RPRA 1YJ9Z 3S2HI 2EGTA 1QVFY 2PM9A 3GTLI 1VQ61 2NVTI 3VB9A 3GTPI 2JUBA 3S14I 3S17I 1YIJZ 1Z02A 3CD61 2OTLZ 3CCRZ 2KI7B 4NBGA 3CCJZ 2HU9A 1RO4A 2RHBA 3BG0B 4A3LI 1TFIA 3VMHA 1VQ51 1VQN1 4MXUA 3U50C 2M6NA 1USPA 2WB1A 3EEDA 1VQ81 2RBLA 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6N A;  2M48 A;  2RT9 A;  4MD9 A;  3EED A;  2R6M A;  1QF8 A;  1RQF A;  4MD8 A;  1JWH C;  4NH1 C;  4DGL A;  2JMO A;  4MD7 A; 
#chains in the Genus database with same CATH topology
 1NJI 1;  2JA8 I;  1VQO 1;  1S72 Z;  5A2Q b;  1L1O C;  3CQZ I;  3CC4 1;  3P5J B;  1WJ2 A;  3CCQ Z;  3I4M I;  5IP7 I;  1YJ9 1;  1VQ4 1;  1SFO I;  1YJW Z;  1KC8 2;  2JA5 I;  4E2X A;  1Y1W I;  3G71 1;  4QTT A;  3CCJ 1;  3GTJ I;  4MH4 A;  1YI2 Z;  3M3Y I;  2VF1 A;  2O53 A;  2V3V A;  3RZD I;  3I4N I;  2BJO A;  3GTM I;  3CPW Y;  2M48 A;  4TNU A;  1K9M 2;  2F4M A;  1TWC I;  3MZK B;  4E31 A;  3G6E Z;  1K8A 1;  4RVG A;  2NVX I;  5AN9 F;  3KIH A;  1X3Z A;  1YIJ 1;  4NBA A;  1YUK A;  1KC8 1;  3CCU 1;  5CM2 M;  3I55 1;  3CCL 1;  5LL6 f;  5C4X I;  3J80 b;  1VQM 1;  4DGL A;  2OZK A;  1KQS Y;  1QYP A;  2JR6 A;  3CCQ 1;  3CC4 Z;  4A3F I;  3MZL B;  1VQK 1;  1K83 I;  1YHQ 1;  3H3V J;  2E2H I;  1VQL 1;  3J7A 4;  3CCE Z;  3F3P C;  1VQ8 Z;  4A3D I;  3CC7 Z;  4E30 A;  1VQP Z;  1WCM I;  2R92 I;  4MON A;  1VQK Z;  2V45 A;  1R9T I;  1M1K 2;  3CCS 1;  3LUS A;  1SIW A;  1Q16 A;  4E33 A;  4S1T A;  1NP6 A;  2E2I I;  1RLY A;  1TWG I;  1QVG Y;  1AA6 A;  5IT9 b;  2VUM I;  4NBB A;  5C3E I;  4A3E I;  1Q81 2;  4NBC A;  3CXC Z;  2KPI A;  4Y52 I;  1RQF A;  2QRC B;  1WZN A;  3CMA 1;  2YAD A;  1N8R 1;  2WAQ A;  1JJ2 Z;  3VTN A;  2YU9 I;  4E2W A;  3BG1 B;  1S72 1;  1QVG Z;  2E7Z A;  1RO2 A;  2JIQ A;  1ZB9 A;  3NDI A;  3S15 I;  1YUA A;  1YJW 1;  2NVQ I;  4RVH A;  3CCM Z;  4A93 I;  1YJN Z;  3CC7 1;  2DE5 A;  2GTH A;  4HH4 A;  1JWH C;  1WII A;  3HOU I;  5FLX f;  4MD8 A;  4A3I I;  3GKQ A;  5C4J I;  3S16 I;  2JMO A;  1N8R 2;  2Q51 A;  2V8I A;  3CC2 1;  3PO3 I;  2HF1 A;  5D1O A;  1LQL A;  2R6M A;  2AKL A;  2OTJ 1;  1VQL Z;  5T67 A;  4BY1 I;  3GTG I;  4HGZ A;  2JA7 I;  3KIF A;  3G71 Z;  2I3C A;  2VPX A;  2PK7 A;  4E2Z A;  2LFU A;  3GTK I;  2K5R A;  1Q7Y 1;  3RZO I;  3OW2 Y;  4A3J I;  2H85 A;  2VPY A;  1TWH I;  1QVF Z;  1VQ6 Z;  1I6H I;  4NBE A;  2W03 A;  1KQS Z;  3HOW I;  2Q4Z A;  4NH1 C;  1M90 1;  2JS4 A;  1VQ4 Z;  3J81 b;  4E2Y A;  4NBD A;  2QR1 B;  3CCV 1;  1Z01 A;  2JIM A;  4NB9 A;  3S2D I;  4X6A I;  1Y1V I;  3CME Z;  1VQ5 Z;  3Q87 A;  1I3Q I;  2P3Y A;  4BBR I;  1YIT 1;  2IZ3 A;  2R93 I;  2GTI A;  3G4S Z;  3MON A;  2QEX 1;  1P9N A;  2PMZ A;  3IFU A;  1YHQ Z;  2ZAE B;  3D6W A;  4NB8 A;  3EER A;  4DK1 A;  1YIT Z;  1S7M A;  2VUG A;  4A3B I;  3NDJ A;  1RO0 A;  3G4S 1;  1VQM Z;  3QWU A;  3I07 A;  2OTL 1;  4MRI A;  4NBF A;  3JAM f;  5FLX b;  2QA4 Z;  1K8A 2;  1USP B;  1KD1 2;  1JJ2 Y;  2VPW A;  3FQM A;  5FLM I;  2OTJ Z;  4CL1 A;  3HKZ A;  1TWF I;  1ZB8 A;  5T6B A;  4A3C I;  3HOY I;  3GTO I;  3G6E 1;  1YI2 1;  1VQN Z;  4NBH A;  1PFT A;  3CCV Z;  2OOX B;  5C44 I;  3CD6 Z;  1Q82 1;  3I56 Z;  1K73 2;  3CME 1;  2E9H A;  3S1Q I;  4QTU A;  3I55 Z;  1M90 2;  3NFZ A;  1VLA A;  3CCU Z;  1QF8 A;  1VQ7 1;  1QXF A;  2RT9 A;  3NH4 A;  3GTM S;  2LIY A;  1Q86 1;  3F3F C;  4MD7 A;  2B63 I;  3CC2 Z;  3CCS Z;  2F4O A;  2NAP A;  2O4H A;  3T4N B;  1W2B Y;  2K3R A;  3CCM 1;  4EWC A;  1VQ9 1;  2Y0S A;  3PO2 I;  4BY7 I;  3HOX I;  3FQQ A;  2QRD B;  3IX0 A;  3J80 f;  2LEX A;  1WW9 A;  1W2B Z;  1ZH1 A;  2DE6 A;  3CCE 1;  1VQ9 Z;  3VMG A;  3D9X A;  2JA6 I;  4NOZ A;  5IP9 I;  3HOZ I;  4RVF A;  3CPW Z;  3S1M I;  3NH5 A;  3TE5 B;  3S1N I;  1Q7Y 2;  2JIP A;  1FDI A;  1VQP 1;  1NJI 2;  4BXX I;  1X3W A;  2G2K A;  1X0T A;  3GTQ I;  1Q82 2;  1K73 1;  4RS4 A;  1I50 I;  1Z03 A;  4A3M I;  1KRL A;  2GU2 A;  2VPZ A;  3M4O I;  1N2F A;  4MD9 A;  2JNY A;  4RV9 A;  3IF8 A;  4DQY B;  1Y8C A;  3FKI I;  3GCF A;  2E2J I;  3NH8 A;  3CXC Y;  3CCR 1;  1K9M 1;  3I56 1;  3S1R I;  4A3K I;  2R7Z I;  5A2Q f;  2IZ4 A;  3IR7 A;  3H0G I;  2DE7 A;  2V8J A;  1Q86 2;  4RVD A;  4A3G I;  3JAM b;  2NVY I;  3OW2 Z;  1VQ7 Z;  3J81 f;  2W04 A;  2J6A A;  3PO3 S;  5D1O B;  5T64 A;  1M1K 1;  4HGY A;  1RNI A;  2RIQ A;  2OOY B;  3HOV I;  4XX2 A;  3K7A I;  4E32 A;  2QEX Z;  4AYB A;  5D1P A;  1Y1V S;  2QKD A;  1Q81 1;  2IV2 X;  3CCL Z;  1TWA I;  3VMI A;  3D2L A;  3ESW A;  3CMA Z;  1NUI A;  1ML8 A;  2P28 A;  5IT9 f;  1KD1 1;  4Y7N I;  1YJN 1;  2JIR A;  4NFR A;  2QLV B;  1VQO Z;  2QA4 1;  2QRE B;  1DL6 A;  1FDO A;  4BBS I;  3TDH B;  2RPR A;  1YJ9 Z;  3S2H I;  2EGT A;  1QVF Y;  2PM9 A;  3GTL I;  1VQ6 1;  2NVT I;  3VB9 A;  3GTP I;  2JUB A;  3S14 I;  3S17 I;  1YIJ Z;  1Z02 A;  3CD6 1;  2OTL Z;  3CCR Z;  2KI7 B;  2JIO A;  4NBG A;  3CCJ Z;  2HU9 A;  1RO4 A;  2RHB A;  3BG0 B;  4A3L I;  1TFI A;  3VMH A;  1VQ5 1;  1VQN 1;  2AYD A;  4MXU A;  3U50 C;  2M6N A;  1USP A;  2WB1 A;  3EED A;  1VQ8 1;  2RBL A;  2V8K A; 
#chains in the Genus database with same CATH homology
 1NJI 1;  2JA8 I;  1VQO 1;  1S72 Z;  5A2Q b;  1L1O C;  3CQZ I;  3CC4 1;  3P5J B;  3CCQ Z;  3I4M I;  5IP7 I;  1YJ9 1;  1VQ4 1;  1SFO I;  1YJW Z;  1KC8 2;  2JA5 I;  4E2X A;  1Y1W I;  3G71 1;  4QTT A;  3CCJ 1;  3GTJ I;  4MH4 A;  1YI2 Z;  3M3Y I;  2VF1 A;  2O53 A;  3RZD I;  3I4N I;  2BJO A;  3GTM I;  3CPW Y;  2M48 A;  4TNU A;  1K9M 2;  2F4M A;  1TWC I;  3MZK B;  4E31 A;  3G6E Z;  1K8A 1;  4RVG A;  2NVX I;  5AN9 F;  3KIH A;  1X3Z A;  1YIJ 1;  4NBA A;  1YUK A;  1KC8 1;  3CCU 1;  5CM2 M;  3I55 1;  3CCL 1;  5LL6 f;  5C4X I;  3J80 b;  1VQM 1;  4DGL A;  2OZK A;  1KQS Y;  1QYP A;  2JR6 A;  3CCQ 1;  3CC4 Z;  4A3F I;  3MZL B;  1VQK 1;  1K83 I;  1YHQ 1;  3H3V J;  2E2H I;  1VQL 1;  3J7A 4;  3CCE Z;  3F3P C;  1VQ8 Z;  4A3D I;  3CC7 Z;  4E30 A;  1VQP Z;  1WCM I;  2R92 I;  4MON A;  1VQK Z;  1R9T I;  1M1K 2;  3CCS 1;  3LUS A;  4E33 A;  4S1T A;  1NP6 A;  2E2I I;  1RLY A;  1TWG I;  1QVG Y;  5IT9 b;  2VUM I;  4NBB A;  5C3E I;  4A3E I;  1Q81 2;  4NBC A;  3CXC Z;  2KPI A;  4Y52 I;  1RQF A;  2QRC B;  3CMA 1;  2YAD A;  1N8R 1;  2WAQ A;  1JJ2 Z;  3VTN A;  2YU9 I;  4E2W A;  3BG1 B;  1S72 1;  1QVG Z;  1RO2 A;  3S15 I;  1ZB9 A;  3NDI A;  1YUA A;  1YJW 1;  2NVQ I;  4RVH A;  3CCM Z;  4A93 I;  1YJN Z;  3CC7 1;  2DE5 A;  2GTH A;  4HH4 A;  1JWH C;  1WII A;  3HOU I;  5FLX f;  4MD8 A;  4A3I I;  3GKQ A;  5C4J I;  3S16 I;  2JMO A;  1N8R 2;  2Q51 A;  2V8I A;  3CC2 1;  3PO3 I;  2HF1 A;  5D1O A;  1LQL A;  2R6M A;  2AKL A;  2OTJ 1;  1VQL Z;  5T67 A;  4BY1 I;  3GTG I;  4HGZ A;  2JA7 I;  3KIF A;  3G71 Z;  2I3C A;  2PK7 A;  4E2Z A;  2LFU A;  3GTK I;  2K5R A;  1Q7Y 1;  3RZO I;  3OW2 Y;  4A3J I;  2H85 A;  1TWH I;  1QVF Z;  1VQ6 Z;  1I6H I;  4NBE A;  2W03 A;  1KQS Z;  3HOW I;  2Q4Z A;  4NH1 C;  1M90 1;  2JS4 A;  1VQ4 Z;  3J81 b;  4E2Y A;  4NBD A;  2QR1 B;  3CCV 1;  1Z01 A;  4NB9 A;  3S2D I;  4X6A I;  1Y1V I;  3CME Z;  1VQ5 Z;  3Q87 A;  1I3Q I;  2P3Y A;  4BBR I;  1YIT 1;  2IZ3 A;  2R93 I;  2GTI A;  3G4S Z;  3MON A;  2QEX 1;  1P9N A;  2PMZ A;  3IFU A;  1YHQ Z;  2ZAE B;  3D6W A;  4NB8 A;  3EER A;  4DK1 A;  1YIT Z;  1S7M A;  2VUG A;  4A3B I;  3NDJ A;  1RO0 A;  3G4S 1;  1VQM Z;  3QWU A;  3I07 A;  2OTL 1;  4MRI A;  4NBF A;  3JAM f;  5FLX b;  2QA4 Z;  1K8A 2;  1USP B;  1KD1 2;  1JJ2 Y;  3FQM A;  5FLM I;  2OTJ Z;  4CL1 A;  3HKZ A;  1TWF I;  1ZB8 A;  5T6B A;  4A3C I;  3HOY I;  3GTO I;  3G6E 1;  1YI2 1;  1VQN Z;  4NBH A;  1PFT A;  3CCV Z;  2OOX B;  5C44 I;  3CD6 Z;  1K73 2;  1Q82 1;  3I56 Z;  3CME 1;  2E9H A;  3S1Q I;  4QTU A;  3I55 Z;  1M90 2;  3NFZ A;  1VLA A;  3CCU Z;  1QF8 A;  1VQ7 1;  2RT9 A;  3NH4 A;  3GTM S;  2LIY A;  1Q86 1;  3F3F C;  4MD7 A;  2B63 I;  3CC2 Z;  3CCS Z;  2F4O A;  2O4H A;  3T4N B;  1W2B Y;  2K3R A;  3CCM 1;  4EWC A;  1VQ9 1;  2Y0S A;  3PO2 I;  4BY7 I;  3HOX I;  3FQQ A;  2QRD B;  3IX0 A;  3J80 f;  1WW9 A;  1W2B Z;  1ZH1 A;  2DE6 A;  3CCE 1;  1VQ9 Z;  3VMG A;  3D9X A;  2JA6 I;  4NOZ A;  5IP9 I;  3HOZ I;  4RVF A;  3CPW Z;  3S1M I;  3NH5 A;  3TE5 B;  3S1N I;  1Q7Y 2;  1VQP 1;  1NJI 2;  4BXX I;  1X3W A;  2G2K A;  1X0T A;  3GTQ I;  1Q82 2;  1K73 1;  4RS4 A;  1I50 I;  1Z03 A;  4A3M I;  1KRL A;  2GU2 A;  3M4O I;  1N2F A;  4MD9 A;  2JNY A;  4RV9 A;  3IF8 A;  4DQY B;  3FKI I;  3GCF A;  2E2J I;  3NH8 A;  3CXC Y;  3CCR 1;  1K9M 1;  3I56 1;  3S1R I;  4A3K I;  2R7Z I;  5A2Q f;  2IZ4 A;  3H0G I;  2DE7 A;  2V8J A;  1Q86 2;  4RVD A;  4A3G I;  3JAM b;  2NVY I;  3OW2 Z;  1VQ7 Z;  3J81 f;  2W04 A;  2J6A A;  3PO3 S;  5D1O B;  5T64 A;  1M1K 1;  4HGY A;  1RNI A;  2RIQ A;  2OOY B;  3HOV I;  4XX2 A;  3K7A I;  4E32 A;  2QEX Z;  4AYB A;  5D1P A;  1Y1V S;  2QKD A;  1Q81 1;  1TWA I;  3CCL Z;  3VMI A;  3ESW A;  3CMA Z;  1NUI A;  1ML8 A;  2P28 A;  5IT9 f;  1KD1 1;  4Y7N I;  1YJN 1;  4NFR A;  2QLV B;  1VQO Z;  2QA4 1;  2QRE B;  1DL6 A;  4BBS I;  3TDH B;  2RPR A;  1YJ9 Z;  3S2H I;  2EGT A;  1QVF Y;  2PM9 A;  3GTL I;  1VQ6 1;  2NVT I;  3VB9 A;  3GTP I;  2JUB A;  3S14 I;  3S17 I;  1YIJ Z;  1Z02 A;  3CD6 1;  2OTL Z;  3CCR Z;  2KI7 B;  4NBG A;  3CCJ Z;  2HU9 A;  1RO4 A;  2RHB A;  3BG0 B;  4A3L I;  1TFI A;  3VMH A;  1VQ5 1;  1VQN 1;  4MXU A;  3U50 C;  2M6N A;  1USP A;  2WB1 A;  3EED A;  1VQ8 1;  2RBL A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...