2M6NA

3d solution structure of emi1 (early mitotic inhibitor 1)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
SLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 5
publication title Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2m6nA00
1JWHC 2M48A 2RT9A 4MD9A 2JMOA 1QF8A 1RQFA 2R6MA 3EEDA 4DGLA 4MD7A 4NH1C 2M6NA 4MD8A
chains in the Genus database with same CATH superfamily
4A3II 2QKDA 1VQO1 3PO3S 3CCSZ 1L1OC 4NFRA 3GTMI 1Z02A 4RVFA 1JWHC 1QVGY 3G4SZ 3MZLB 1YIJ1 4E2XA 1VQ4Z 1KC82 2Q51A 3CXCY 4NBEA 1M901 1KRLA 1QF8A 1QYPA 2JNYA 1KD12 3H0GI 1K732 3BG1B 3PO3I 2IZ3A 2VUMI 1FDOA 1I50I 2QRCB 4BBSI 3F3FC 3TE5B 1VQ81 4NOZA 1W2BZ 3CMEZ 3J80b 1VQM1 3RZDI 2JIRA 4A3KI 3GTOI 1RO4A 3CCV1 5IP9I 3JAMf 1NJI1 1VQ7Z 3M4OI 2NVQI 3EEDA 5IT9b 3CCJZ 2R92I 2QEXZ 5LL6f 3HOVI 3NDIA 3I4NI 3TDHB 1VQ91 2WAQA 3HOWI 3I07A 1S7MA 2E2JI 5A2Qb 2IV2X 1VQOZ 5T67A 3HKZA 3G711 4MD8A 1K8A2 4E2WA 3D6WA 1TWFI 5IT9f 3KIHA 4DK1A 1YIJZ 2OOXB 3I561 5D1PA 2V8JA 3FQMA 1WZNA 4A3JI 1Q7Y1 3GTQI 3S2DI 2JIMA 2O53A 2P3YA 3HOYI 5A2Qf 4MRIA 2HU9A 3NH8A 3I551 1YUKA 1VQ8Z 1X3ZA 2JUBA 5T6BA 2R7ZI 4A3CI 3GTMS 1VQP1 1VQMZ 2QREB 5C4JI 3CCVZ 2Q4ZA 1KD11 1TWGI 1Y8CA 4A3DI 1AA6A 4MH4A 1K731 3GTKI 2BJOA 3D9XA 4NBBA 3IR7A 1VQ51 4RVDA 2KI7B 2VPWA 1YUAA 3CCQ1 1YJ91 1VQK1 3CCR1 4A93I 4QTUA 1VQ9Z 4EWCA 3HOZI 2W04A 2GTIA 2E9HA 1M1K2 2LFUA 3M3YI 3JAMb 4MD9A 1YJN1 2QA41 2VUGA 4RS4A 3CQZI 4NBHA 3G71Z 1YJW1 4BY7I 1Y1VS 2OZKA 2V3VA 2EGTA 2JA8I 1P9NA 3I56Z 2YU9I 3ESWA 2LIYA 3VMHA 3P5JB 4DGLA 4A3FI 3S15I 1YI21 2DE6A 3S1NI 1K8A1 2F4OA 3H3VJ 3CCM1 5D1OB 1ZB8A 3I55Z 3J81b 3LUSA 2G2KA 1Y1VI 1RLYA 1VQPZ 1Q862 1VQ61 3CCL1 3CC71 1WW9A 1SFOI 1VQ5Z 4MONA 2IZ4A 3IX0A 2NVXI 1TWAI 3NH4A 2M48A 2W03A 1ZH1A 4RVGA 3CCQZ 1RO2A 1VQKZ 3CCRZ 2QRDB 5C4XI 1Q812 2NVTI 3CMA1 2K3RA 3BG0B 5C3EI 1Z03A 3J81f 3S1RI 1X0TA 1Q822 2LEXA 4BBRI 4E2ZA 4E30A 4HGZA 2PM9A 2P28A 2NVYI 1YJNZ 2QA4Z 1SIWA 1K9M2 1YJWZ 2KPIA 1Z01A 2GTHA 3CC41 4E32A 1N2FA 3S1QI 3VMGA 1I3QI 3T4NB 4Y7NI 3F3PC 3G6E1 1VLAA 3S14I 1ZB9A 2AKLA 3FQQA 2VPZA 3KIFA 1YI2Z 1KC81 3GTGI 4NH1C 2AYDA 1NJI2 2DE5A 3GTLI 2YADA 3CCMZ 3CCU1 2JR6A 1QXFA 4MD7A 2JIPA 3CC21 4S1TA 1USPB 3HOXI 1VQ6Z 2RBLA 4NB9A 4Y52I 3CCLZ 4HH4A 3CPWZ 1ML8A 2QR1B 3VB9A 3CC7Z 1YHQ1 1N8R2 4NBFA 3NH5A 4NBAA 1LQLA 1S721 1Q861 3GTPI 3GKQA 3CMAZ 3GTJI 4A3EI 2RIQA 3FKII 1VQN1 2OTJ1 2O4HA 3K7AI 1Q7Y2 2QLVB 4TNUA 1RNIA 1YIT1 5FLMI 4NBGA 4MXUA 2JA5I 1Q811 1R9TI 4HGYA 3CC4Z 3EERA 2OTL1 3OW2Y 2B63I 5T64A 1Q821 4E31A 1JJ2Y 3G6EZ 1K83I 4BY1I 2JA6I 3VMIA 3Q87A 5CM2M 2RHBA 5C44I 2NAPA 2V8KA 2RT9A 1VQL1 4BXXI 1K9M1 3CPWY 1PFTA 5FLXb 4A3GI 3CCUZ 3CCE1 3NFZA 4NB8A 1TFIA 2JIOA 1QVFZ 3CC2Z 1FDIA 4CL1A 2GU2A 2R93I 4DQYB 2JA7I 3IFUA 2M6NA 5D1OA 3MZKB 1WJ2A 3S1MI 3CD61 1RO0A 1YHQZ 1YJ9Z 2HF1A 3MONA 3S2HI 2VPXA 2WB1A 1X3WA 1NP6A 1KQSZ 1I6HI 4RVHA 2V45A 1Y1WI 2E7ZA 1S72Z 2R6MA 4E33A 3I4MI 5FLXf 2JS4A 1WIIA 1M902 3CCS1 1N8R1 1VQNZ 2OTJZ 2I3CA 3G4S1 2JIQA 3J80f 3PO2I 1YITZ 2K5RA 1M1K1 1VQ41 4A3LI 1TWCI 2PMZA 3U50C 2PK7A 1WCMI 2OTLZ 3RZOI 1TWHI 2OOYB 2E2II 1QVFY 1QVGZ 3NDJA 2ZAEB 4QTTA 4A3BI 3OW2Z 1W2BY 4X6AI 2Y0SA 1DL6A 1VQLZ 2E2HI 1Q16A 1JJ2Z 3J7A4 3CXCZ 2J6AA 3CCEZ 3CME1 3S16I 1RQFA 2F4MA 2VF1A 3VTNA 3QWUA 3HOUI 1KQSY 4A3MI 1VQ71 2V8IA 4RV9A 4AYBA 3GCFA 4E2YA 3CCJ1 3D2LA 2QEX1 3IF8A 4NBCA 3CD6Z 2DE7A 1USPA 5AN9F 1NUIA 2H85A 2RPRA 4XX2A 2JMOA 2VPYA 5IP7I 3S17I 4NBDA
chains in the Genus database with same CATH topology
4A3II 2QKDA 1VQO1 3PO3S 3CCSZ 1L1OC 4NFRA 3GTMI 1Z02A 4RVFA 1JWHC 1QVGY 3G4SZ 3MZLB 1YIJ1 4E2XA 1VQ4Z 1KC82 2Q51A 3CXCY 4NBEA 1M901 1KRLA 1QF8A 1QYPA 2JNYA 1KD12 3H0GI 1K732 3BG1B 3PO3I 2IZ3A 2VUMI 1I50I 2QRCB 4BBSI 3F3FC 3TE5B 1VQ81 4NOZA 1W2BZ 3CMEZ 3J80b 1VQM1 3RZDI 4A3KI 3GTOI 1RO4A 3CCV1 5IP9I 3JAMf 1NJI1 1VQ7Z 3M4OI 2NVQI 3EEDA 5IT9b 3CCJZ 2R92I 2QEXZ 5LL6f 3HOVI 3NDIA 3I4NI 3TDHB 1VQ91 2WAQA 3HOWI 3I07A 1S7MA 2E2JI 5A2Qb 1VQOZ 5T67A 3HKZA 3G711 4MD8A 1K8A2 4E2WA 3D6WA 1TWFI 5IT9f 3KIHA 4DK1A 1YIJZ 2OOXB 3I561 5D1PA 2V8JA 3FQMA 4A3JI 1Q7Y1 3GTQI 3S2DI 2O53A 2P3YA 3HOYI 5A2Qf 4MRIA 2HU9A 3NH8A 3I551 1YUKA 1VQ8Z 1X3ZA 2JUBA 5T6BA 2R7ZI 4A3CI 3GTMS 1VQP1 1VQMZ 2QREB 5C4JI 3CCVZ 2Q4ZA 1KD11 1TWGI 4A3DI 4MH4A 1K731 3GTKI 2BJOA 3D9XA 4NBBA 1VQ51 4RVDA 2KI7B 1YUAA 3CCQ1 1YJ91 1VQK1 3CCR1 4A93I 4QTUA 1VQ9Z 4EWCA 3HOZI 2W04A 2GTIA 2E9HA 1M1K2 2LFUA 3M3YI 3JAMb 4MD9A 1YJN1 2QA41 2VUGA 4RS4A 3CQZI 4NBHA 3G71Z 1YJW1 4BY7I 1Y1VS 2OZKA 2EGTA 2JA8I 1P9NA 3I56Z 2YU9I 3ESWA 2LIYA 3VMHA 3P5JB 4DGLA 4A3FI 3S15I 1YI21 2DE6A 3S1NI 1K8A1 2F4OA 3H3VJ 3CCM1 5D1OB 1ZB8A 3I55Z 3J81b 3LUSA 2G2KA 1Y1VI 1RLYA 1VQPZ 1Q862 1VQ61 3CCL1 3CC71 1WW9A 1SFOI 1VQ5Z 4MONA 2IZ4A 3IX0A 2NVXI 1TWAI 3NH4A 2M48A 2W03A 1ZH1A 4RVGA 3CCQZ 1RO2A 1VQKZ 2QRDB 3CCRZ 5C4XI 1Q812 2NVTI 3CMA1 2K3RA 3BG0B 5C3EI 1Z03A 3J81f 3S1RI 1X0TA 1Q822 4BBRI 4E2ZA 4E30A 4HGZA 2PM9A 2P28A 2NVYI 1YJNZ 2QA4Z 1K9M2 1YJWZ 2KPIA 1Z01A 2GTHA 3CC41 4E32A 1N2FA 3S1QI 3VMGA 1I3QI 3T4NB 4Y7NI 3F3PC 3G6E1 1VLAA 3S14I 1ZB9A 2AKLA 3FQQA 3KIFA 1YI2Z 1KC81 3GTGI 4NH1C 1NJI2 2DE5A 3GTLI 2YADA 3CCMZ 3CCU1 2JR6A 4MD7A 3CC21 4S1TA 1USPB 3HOXI 1VQ6Z 2RBLA 4NB9A 4Y52I 3CCLZ 4HH4A 3CPWZ 1ML8A 2QR1B 3VB9A 3CC7Z 1YHQ1 1N8R2 4NBFA 3NH5A 4NBAA 1LQLA 1S721 1Q861 3GTPI 3GKQA 3CMAZ 3GTJI 4A3EI 2RIQA 3FKII 1VQN1 2OTJ1 2O4HA 3K7AI 1Q7Y2 2QLVB 4TNUA 1RNIA 1YIT1 5FLMI 4NBGA 4MXUA 2JA5I 1Q811 1R9TI 4HGYA 3CC4Z 3EERA 2OTL1 3OW2Y 2B63I 5T64A 1Q821 4E31A 1JJ2Y 3G6EZ 1K83I 4BY1I 2JA6I 3VMIA 3Q87A 5CM2M 2RHBA 5C44I 2V8KA 2RT9A 1VQL1 4BXXI 1K9M1 3CPWY 1PFTA 5FLXb 4A3GI 3CCUZ 3CCE1 3NFZA 4NB8A 1TFIA 1QVFZ 3CC2Z 4CL1A 2GU2A 2R93I 4DQYB 2JA7I 3IFUA 2M6NA 5D1OA 3MZKB 3S1MI 3CD61 1RO0A 1YHQZ 1YJ9Z 2HF1A 3MONA 3S2HI 2WB1A 1X3WA 1NP6A 1KQSZ 1I6HI 4RVHA 1Y1WI 1S72Z 2R6MA 4E33A 3I4MI 5FLXf 2JS4A 1WIIA 1M902 3CCS1 1N8R1 1VQNZ 2OTJZ 2I3CA 3G4S1 3J80f 3PO2I 1YITZ 2K5RA 1M1K1 1VQ41 4A3LI 1TWCI 2PMZA 3U50C 2PK7A 1WCMI 2OTLZ 3RZOI 1TWHI 2OOYB 2E2II 1QVFY 1QVGZ 3NDJA 2ZAEB 4QTTA 4A3BI 3OW2Z 1W2BY 4X6AI 2Y0SA 1DL6A 1VQLZ 2E2HI 1JJ2Z 3J7A4 3CXCZ 2J6AA 3CCEZ 3CME1 3S16I 1RQFA 2F4MA 2VF1A 3VTNA 3QWUA 3HOUI 1KQSY 4A3MI 1VQ71 2V8IA 4RV9A 4AYBA 3GCFA 4E2YA 3CCJ1 2QEX1 3IF8A 4NBCA 3CD6Z 2DE7A 1USPA 5AN9F 1NUIA 2H85A 2RPRA 4XX2A 2JMOA 5IP7I 3S17I 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWH C;  2M48 A;  2RT9 A;  4MD9 A;  2JMO A;  1QF8 A;  1RQF A;  2R6M A;  3EED A;  4DGL A;  4MD7 A;  4NH1 C;  2M6N A;  4MD8 A; 
#chains in the Genus database with same CATH topology
 4A3I I;  2QKD A;  1VQO 1;  3PO3 S;  3CCS Z;  1L1O C;  4NFR A;  3GTM I;  1Z02 A;  4RVF A;  1JWH C;  1QVG Y;  3G4S Z;  3MZL B;  1YIJ 1;  4E2X A;  1VQ4 Z;  1KC8 2;  2Q51 A;  3CXC Y;  4NBE A;  1M90 1;  1KRL A;  1QF8 A;  1QYP A;  2JNY A;  1KD1 2;  3H0G I;  1K73 2;  3BG1 B;  3PO3 I;  2IZ3 A;  2VUM I;  1FDO A;  1I50 I;  2QRC B;  4BBS I;  3F3F C;  3TE5 B;  1VQ8 1;  4NOZ A;  1W2B Z;  3CME Z;  3J80 b;  1VQM 1;  3RZD I;  2JIR A;  4A3K I;  3GTO I;  1RO4 A;  3CCV 1;  5IP9 I;  3JAM f;  1NJI 1;  1VQ7 Z;  3M4O I;  2NVQ I;  3EED A;  5IT9 b;  3CCJ Z;  2R92 I;  2QEX Z;  5LL6 f;  3HOV I;  3NDI A;  3I4N I;  3TDH B;  1VQ9 1;  2WAQ A;  3HOW I;  3I07 A;  1S7M A;  2E2J I;  5A2Q b;  2IV2 X;  1VQO Z;  5T67 A;  3HKZ A;  3G71 1;  4MD8 A;  1K8A 2;  4E2W A;  3D6W A;  1TWF I;  5IT9 f;  3KIH A;  4DK1 A;  1YIJ Z;  2OOX B;  3I56 1;  5D1P A;  2V8J A;  3FQM A;  1WZN A;  4A3J I;  1Q7Y 1;  3GTQ I;  3S2D I;  2JIM A;  2O53 A;  2P3Y A;  3HOY I;  5A2Q f;  4MRI A;  2HU9 A;  3NH8 A;  3I55 1;  1YUK A;  1VQ8 Z;  1X3Z A;  2JUB A;  5T6B A;  2R7Z I;  4A3C I;  3GTM S;  1VQP 1;  1VQM Z;  2QRE B;  5C4J I;  3CCV Z;  2Q4Z A;  1KD1 1;  1TWG I;  1Y8C A;  4A3D I;  1AA6 A;  4MH4 A;  1K73 1;  3GTK I;  2BJO A;  3D9X A;  4NBB A;  3IR7 A;  1VQ5 1;  4RVD A;  2KI7 B;  2VPW A;  1YUA A;  3CCQ 1;  1YJ9 1;  1VQK 1;  3CCR 1;  4A93 I;  4QTU A;  1VQ9 Z;  4EWC A;  3HOZ I;  2W04 A;  2GTI A;  2E9H A;  1M1K 2;  2LFU A;  3M3Y I;  3JAM b;  4MD9 A;  1YJN 1;  2QA4 1;  2VUG A;  4RS4 A;  3CQZ I;  4NBH A;  3G71 Z;  1YJW 1;  4BY7 I;  1Y1V S;  2OZK A;  2V3V A;  2EGT A;  2JA8 I;  1P9N A;  3I56 Z;  2YU9 I;  3ESW A;  2LIY A;  3VMH A;  3P5J B;  4DGL A;  4A3F I;  3S15 I;  1YI2 1;  2DE6 A;  3S1N I;  1K8A 1;  2F4O A;  3H3V J;  3CCM 1;  5D1O B;  1ZB8 A;  3I55 Z;  3J81 b;  3LUS A;  2G2K A;  1Y1V I;  1RLY A;  1VQP Z;  1Q86 2;  1VQ6 1;  3CCL 1;  3CC7 1;  1WW9 A;  1SFO I;  1VQ5 Z;  4MON A;  2IZ4 A;  3IX0 A;  2NVX I;  1TWA I;  3NH4 A;  2M48 A;  2W03 A;  1ZH1 A;  4RVG A;  3CCQ Z;  1RO2 A;  1VQK Z;  3CCR Z;  2QRD B;  5C4X I;  1Q81 2;  2NVT I;  3CMA 1;  2K3R A;  3BG0 B;  5C3E I;  1Z03 A;  3J81 f;  3S1R I;  1X0T A;  1Q82 2;  2LEX A;  4BBR I;  4E2Z A;  4E30 A;  4HGZ A;  2PM9 A;  2P28 A;  2NVY I;  1YJN Z;  2QA4 Z;  1SIW A;  1K9M 2;  1YJW Z;  2KPI A;  1Z01 A;  2GTH A;  3CC4 1;  4E32 A;  1N2F A;  3S1Q I;  3VMG A;  1I3Q I;  3T4N B;  4Y7N I;  3F3P C;  3G6E 1;  1VLA A;  3S14 I;  1ZB9 A;  2AKL A;  3FQQ A;  2VPZ A;  3KIF A;  1YI2 Z;  1KC8 1;  3GTG I;  4NH1 C;  2AYD A;  1NJI 2;  2DE5 A;  3GTL I;  2YAD A;  3CCM Z;  3CCU 1;  2JR6 A;  1QXF A;  4MD7 A;  2JIP A;  3CC2 1;  4S1T A;  1USP B;  3HOX I;  1VQ6 Z;  2RBL A;  4NB9 A;  4Y52 I;  3CCL Z;  4HH4 A;  3CPW Z;  1ML8 A;  2QR1 B;  3VB9 A;  3CC7 Z;  1YHQ 1;  1N8R 2;  4NBF A;  3NH5 A;  4NBA A;  1LQL A;  1S72 1;  1Q86 1;  3GTP I;  3GKQ A;  3CMA Z;  3GTJ I;  4A3E I;  2RIQ A;  3FKI I;  1VQN 1;  2OTJ 1;  2O4H A;  3K7A I;  1Q7Y 2;  2QLV B;  4TNU A;  1RNI A;  1YIT 1;  5FLM I;  4NBG A;  4MXU A;  2JA5 I;  1Q81 1;  1R9T I;  4HGY A;  3CC4 Z;  3EER A;  2OTL 1;  3OW2 Y;  2B63 I;  5T64 A;  1Q82 1;  4E31 A;  1JJ2 Y;  3G6E Z;  1K83 I;  4BY1 I;  2JA6 I;  3VMI A;  3Q87 A;  5CM2 M;  2RHB A;  5C44 I;  2NAP A;  2V8K A;  2RT9 A;  1VQL 1;  4BXX I;  1K9M 1;  3CPW Y;  1PFT A;  5FLX b;  4A3G I;  3CCU Z;  3CCE 1;  3NFZ A;  4NB8 A;  1TFI A;  2JIO A;  1QVF Z;  3CC2 Z;  1FDI A;  4CL1 A;  2GU2 A;  2R93 I;  4DQY B;  2JA7 I;  3IFU A;  2M6N A;  5D1O A;  3MZK B;  1WJ2 A;  3S1M I;  3CD6 1;  1RO0 A;  1YHQ Z;  1YJ9 Z;  2HF1 A;  3MON A;  3S2H I;  2VPX A;  2WB1 A;  1X3W A;  1NP6 A;  1KQS Z;  1I6H I;  4RVH A;  2V45 A;  1Y1W I;  2E7Z A;  1S72 Z;  2R6M A;  4E33 A;  3I4M I;  5FLX f;  2JS4 A;  1WII A;  1M90 2;  3CCS 1;  1N8R 1;  1VQN Z;  2OTJ Z;  2I3C A;  3G4S 1;  2JIQ A;  3J80 f;  3PO2 I;  1YIT Z;  2K5R A;  1M1K 1;  1VQ4 1;  4A3L I;  1TWC I;  2PMZ A;  3U50 C;  2PK7 A;  1WCM I;  2OTL Z;  3RZO I;  1TWH I;  2OOY B;  2E2I I;  1QVF Y;  1QVG Z;  3NDJ A;  2ZAE B;  4QTT A;  4A3B I;  3OW2 Z;  1W2B Y;  4X6A I;  2Y0S A;  1DL6 A;  1VQL Z;  2E2H I;  1Q16 A;  1JJ2 Z;  3J7A 4;  3CXC Z;  2J6A A;  3CCE Z;  3CME 1;  3S16 I;  1RQF A;  2F4M A;  2VF1 A;  3VTN A;  3QWU A;  3HOU I;  1KQS Y;  4A3M I;  1VQ7 1;  2V8I A;  4RV9 A;  4AYB A;  3GCF A;  4E2Y A;  3CCJ 1;  3D2L A;  2QEX 1;  3IF8 A;  4NBC A;  3CD6 Z;  2DE7 A;  1USP A;  5AN9 F;  1NUI A;  2H85 A;  2RPR A;  4XX2 A;  2JMO A;  2VPY A;  5IP7 I;  3S17 I;  4NBD A; 
#chains in the Genus database with same CATH homology
 4A3I I;  2QKD A;  1VQO 1;  3PO3 S;  3CCS Z;  1L1O C;  4NFR A;  3GTM I;  1Z02 A;  4RVF A;  1JWH C;  1QVG Y;  3G4S Z;  3MZL B;  1YIJ 1;  4E2X A;  1VQ4 Z;  1KC8 2;  2Q51 A;  3CXC Y;  4NBE A;  1M90 1;  1KRL A;  1QF8 A;  1QYP A;  2JNY A;  1KD1 2;  3H0G I;  1K73 2;  3BG1 B;  3PO3 I;  2IZ3 A;  2VUM I;  1I50 I;  2QRC B;  4BBS I;  3F3F C;  3TE5 B;  1VQ8 1;  4NOZ A;  1W2B Z;  3CME Z;  3J80 b;  1VQM 1;  3RZD I;  4A3K I;  3GTO I;  1RO4 A;  3CCV 1;  5IP9 I;  3JAM f;  1NJI 1;  1VQ7 Z;  3M4O I;  2NVQ I;  3EED A;  5IT9 b;  3CCJ Z;  2R92 I;  2QEX Z;  5LL6 f;  3HOV I;  3NDI A;  3I4N I;  3TDH B;  1VQ9 1;  2WAQ A;  3HOW I;  3I07 A;  1S7M A;  2E2J I;  5A2Q b;  1VQO Z;  5T67 A;  3HKZ A;  3G71 1;  4MD8 A;  1K8A 2;  4E2W A;  3D6W A;  1TWF I;  5IT9 f;  3KIH A;  4DK1 A;  1YIJ Z;  2OOX B;  3I56 1;  5D1P A;  2V8J A;  3FQM A;  4A3J I;  1Q7Y 1;  3GTQ I;  3S2D I;  2O53 A;  2P3Y A;  3HOY I;  5A2Q f;  4MRI A;  2HU9 A;  3NH8 A;  3I55 1;  1YUK A;  1VQ8 Z;  1X3Z A;  2JUB A;  5T6B A;  2R7Z I;  4A3C I;  3GTM S;  1VQP 1;  1VQM Z;  2QRE B;  5C4J I;  3CCV Z;  2Q4Z A;  1KD1 1;  1TWG I;  4A3D I;  4MH4 A;  1K73 1;  3GTK I;  2BJO A;  3D9X A;  4NBB A;  1VQ5 1;  4RVD A;  2KI7 B;  1YUA A;  3CCQ 1;  1YJ9 1;  1VQK 1;  3CCR 1;  4A93 I;  4QTU A;  1VQ9 Z;  4EWC A;  3HOZ I;  2W04 A;  2GTI A;  2E9H A;  1M1K 2;  2LFU A;  3M3Y I;  3JAM b;  4MD9 A;  1YJN 1;  2QA4 1;  2VUG A;  4RS4 A;  3CQZ I;  4NBH A;  3G71 Z;  1YJW 1;  4BY7 I;  1Y1V S;  2OZK A;  2EGT A;  2JA8 I;  1P9N A;  3I56 Z;  2YU9 I;  3ESW A;  2LIY A;  3VMH A;  3P5J B;  4DGL A;  4A3F I;  3S15 I;  1YI2 1;  2DE6 A;  3S1N I;  1K8A 1;  2F4O A;  3H3V J;  3CCM 1;  5D1O B;  1ZB8 A;  3I55 Z;  3J81 b;  3LUS A;  2G2K A;  1Y1V I;  1RLY A;  1VQP Z;  1Q86 2;  1VQ6 1;  3CCL 1;  3CC7 1;  1WW9 A;  1SFO I;  1VQ5 Z;  4MON A;  2IZ4 A;  3IX0 A;  2NVX I;  1TWA I;  3NH4 A;  2M48 A;  2W03 A;  1ZH1 A;  4RVG A;  3CCQ Z;  1RO2 A;  1VQK Z;  2QRD B;  3CCR Z;  5C4X I;  1Q81 2;  2NVT I;  3CMA 1;  2K3R A;  3BG0 B;  5C3E I;  1Z03 A;  3J81 f;  3S1R I;  1X0T A;  1Q82 2;  4BBR I;  4E2Z A;  4E30 A;  4HGZ A;  2PM9 A;  2P28 A;  2NVY I;  1YJN Z;  2QA4 Z;  1K9M 2;  1YJW Z;  2KPI A;  1Z01 A;  2GTH A;  3CC4 1;  4E32 A;  1N2F A;  3S1Q I;  3VMG A;  1I3Q I;  3T4N B;  4Y7N I;  3F3P C;  3G6E 1;  1VLA A;  3S14 I;  1ZB9 A;  2AKL A;  3FQQ A;  3KIF A;  1YI2 Z;  1KC8 1;  3GTG I;  4NH1 C;  1NJI 2;  2DE5 A;  3GTL I;  2YAD A;  3CCM Z;  3CCU 1;  2JR6 A;  4MD7 A;  3CC2 1;  4S1T A;  1USP B;  3HOX I;  1VQ6 Z;  2RBL A;  4NB9 A;  4Y52 I;  3CCL Z;  4HH4 A;  3CPW Z;  1ML8 A;  2QR1 B;  3VB9 A;  3CC7 Z;  1YHQ 1;  1N8R 2;  4NBF A;  3NH5 A;  4NBA A;  1LQL A;  1S72 1;  1Q86 1;  3GTP I;  3GKQ A;  3CMA Z;  3GTJ I;  4A3E I;  2RIQ A;  3FKI I;  1VQN 1;  2OTJ 1;  2O4H A;  3K7A I;  1Q7Y 2;  2QLV B;  4TNU A;  1RNI A;  1YIT 1;  5FLM I;  4NBG A;  4MXU A;  2JA5 I;  1Q81 1;  1R9T I;  4HGY A;  3CC4 Z;  3EER A;  2OTL 1;  3OW2 Y;  2B63 I;  5T64 A;  1Q82 1;  4E31 A;  1JJ2 Y;  3G6E Z;  1K83 I;  4BY1 I;  2JA6 I;  3VMI A;  3Q87 A;  5CM2 M;  2RHB A;  5C44 I;  2V8K A;  2RT9 A;  1VQL 1;  4BXX I;  1K9M 1;  3CPW Y;  1PFT A;  5FLX b;  4A3G I;  3CCU Z;  3CCE 1;  3NFZ A;  4NB8 A;  1TFI A;  1QVF Z;  3CC2 Z;  4CL1 A;  2GU2 A;  2R93 I;  4DQY B;  2JA7 I;  3IFU A;  2M6N A;  5D1O A;  3MZK B;  3S1M I;  3CD6 1;  1RO0 A;  1YHQ Z;  1YJ9 Z;  2HF1 A;  3MON A;  3S2H I;  2WB1 A;  1X3W A;  1NP6 A;  1KQS Z;  1I6H I;  4RVH A;  1Y1W I;  1S72 Z;  2R6M A;  4E33 A;  3I4M I;  5FLX f;  2JS4 A;  1WII A;  1M90 2;  3CCS 1;  1N8R 1;  1VQN Z;  2OTJ Z;  2I3C A;  3G4S 1;  3J80 f;  3PO2 I;  1YIT Z;  2K5R A;  1M1K 1;  1VQ4 1;  4A3L I;  1TWC I;  2PMZ A;  3U50 C;  2PK7 A;  1WCM I;  2OTL Z;  3RZO I;  1TWH I;  2OOY B;  2E2I I;  1QVF Y;  1QVG Z;  3NDJ A;  2ZAE B;  4QTT A;  4A3B I;  3OW2 Z;  1W2B Y;  4X6A I;  2Y0S A;  1DL6 A;  1VQL Z;  2E2H I;  1JJ2 Z;  3J7A 4;  3CXC Z;  2J6A A;  3CCE Z;  3CME 1;  3S16 I;  1RQF A;  2F4M A;  2VF1 A;  3VTN A;  3QWU A;  3HOU I;  1KQS Y;  4A3M I;  1VQ7 1;  2V8I A;  4RV9 A;  4AYB A;  3GCF A;  4E2Y A;  3CCJ 1;  2QEX 1;  3IF8 A;  4NBC A;  3CD6 Z;  2DE7 A;  1USP A;  5AN9 F;  1NUI A;  2H85 A;  2RPR A;  4XX2 A;  2JMO A;  5IP7 I;  3S17 I;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...