2M6NA

3d solution structure of emi1 (early mitotic inhibitor 1)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
SLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 5
publication title Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2m6nA00
2JMOA 4MD7A 4MD8A 4NH1C 2M6NA 4DGLA 2R6MA 3EEDA 2M48A 1JWHC 2RT9A 1RQFA 4MD9A 1QF8A
chains in the Genus database with same CATH superfamily
3CCV1 2R6MA 3GTPI 3LUSA 3CCVZ 1W2BY 3T4NB 1KRLA 3FQQA 1Q7Y2 3CCL1 1VQNZ 3EEDA 3H3VJ 3I4NI 2OOYB 5FLXb 1X3ZA 2M48A 4HGZA 1KC81 4NBBA 3HOVI 2V3VA 3F3FC 3NH8A 3CME1 3S15I 4MONA 2IZ3A 1YUKA 3I551 1ZB8A 2VF1A 1AA6A 3HOWI 1VQP1 2BJOA 2QR1B 4HH4A 3I55Z 2JIPA 5A2Qb 4DGLA 2IZ4A 3IR7A 4NH1C 1VQMZ 1VQ81 1Z01A 2LFUA 1YIJ1 3JAMb 5T64A 1Q811 2E2JI 1Q16A 3CC4Z 2HU9A 1YIJZ 4A93I 3CCE1 2OTL1 3CCSZ 1S7MA 5LL6f 2OTJZ 4MD8A 3TE5B 2V45A 4NBEA 3GTLI 1QYPA 4A3FI 3M3YI 3CC7Z 2QLVB 4A3EI 2V8JA 1S721 3MZKB 1K83I 2V8IA 4EWCA 1NJI1 1VQ6Z 3CCR1 1YHQ1 1K732 1S72Z 1YJW1 3CD61 2YU9I 3H0GI 3CCRZ 3CC2Z 1VQ5Z 3HOZI 2E9HA 2K5RA 2JA8I 4NB8A 1VQ7Z 2P28A 4NBCA 5D1OB 4NBAA 4A3JI 2Q51A 3S1NI 1ML8A 1YI21 3GTKI 3HOUI 3GTOI 2JUBA 1VQO1 1YI2Z 1K9M2 1W2BZ 3K7AI 2NVXI 1Q7Y1 1VQ4Z 4S1TA 3IFUA 3S16I 1USPA 1QVGY 1PFTA 2WB1A 1K8A2 1YJ9Z 3HOXI 3NFZA 1VQKZ 3I56Z 3D2LA 1QXFA 4E2YA 3TDHB 2E2HI 1TWHI 1WW9A 1N2FA 4BY1I 3CPWZ 3S1QI 5FLXf 4X6AI 1RO0A 2J6AA 2M6NA 3S14I 4A3DI 2QKDA 1VQN1 1M1K1 2F4OA 1DL6A 4MD7A 3U50C 1WIIA 1WJ2A 2NAPA 3S1RI 3GTMI 5A2Qf 2NVTI 1YUAA 3S2DI 5C4XI 2W04A 3BG0B 4RS4A 2O4HA 2VPWA 3Q87A 2I3CA 1N8R1 3VMHA 3RZDI 1Q821 1VQM1 3CCMZ 3MONA 1KD11 1Y1VI 4DK1A 1M901 2RIQA 1RQFA 1Y8CA 3CC41 1Q862 4CL1A 3F3PC 3OW2Y 3IF8A 3GKQA 3CCS1 1JJ2Y 2GTHA 1X3WA 2OTJ1 4E32A 2PM9A 2K3RA 1L1OC 3CC71 2JIQA 3VMGA 3CCUZ 1TWFI 3G6EZ 1VQ61 3S17I 5C3EI 5IT9f 2ZAEB 3J81f 1KC82 4AYBA 2QEXZ 1YIT1 2VPYA 3KIHA 3HOYI 3CC21 1VQLZ 2DE6A 1VQ51 1TWGI 4HGYA 2NVQI 3D9XA 1FDOA 1YITZ 1VQ71 4MXUA 2YADA 4RVFA 5D1OA 1QVGZ 2QREB 4QTTA 1QF8A 2DE7A 4NFRA 1I6HI 3EERA 4BY7I 3G71Z 2VUGA 4NOZA 2Q4ZA 3NH4A 4TNUA 4NBFA 4XX2A 3CCJZ 3J80b 1Q812 2R92I 1VQ41 3S2HI 1TWCI 2DE5A 3GTMS 4NBGA 2H85A 1YJ91 1VQK1 2OZKA 3MZLB 1VQ9Z 3I561 4MRIA 5D1PA 2LEXA 3G4SZ 2JIMA 3I4MI 3M4OI 3VB9A 2IV2X 3GTGI 4RVDA 3GTJI 4A3KI 2GU2A 3IX0A 3GCFA 1NJI2 4MH4A 4MD9A 4NB9A 4E2ZA 1Y1VS 3NDIA 2JA7I 2E7ZA 3CXCY 4A3CI 2JIRA 1YJNZ 2RPRA 5CM2M 1SFOI 5T6BA 5IP9I 3ESWA 3CMAZ 2QA4Z 4E31A 4A3LI 3VMIA 3NDJA 2B63I 3OW2Z 2GTIA 1KQSY 1Z02A 2NVYI 2RT9A 2KI7B 1QVFY 1JJ2Z 2JMOA 1RO4A 1FDIA 5AN9F 2QRCB 2W03A 3JAMf 3CCM1 3VTNA 1NUIA 3BG1B 2JNYA 3RZOI 1X0TA 1P9NA 2AKLA 2RBLA 3CCLZ 1RNIA 3P5JB 3J7A4 4NBDA 3PO3S 2PMZA 4A3MI 1I50I 3S1MI 1K731 3CPWY 5FLMI 2WAQA 4E2XA 3CMEZ 5IP7I 3CCU1 1M1K2 1ZB9A 2RHBA 1LQLA 2G2KA 3G6E1 1VQPZ 2KPIA 2V8KA 4BXXI 5C4JI 2OOXB 2QEX1 1VQL1 3KIFA 1RO2A 2R7ZI 2PK7A 2JA5I 3QWUA 2JR6A 1VQ8Z 2P3YA 4BBRI 4DQYB 1K9M1 1I3QI 2Y0SA 2JA6I 4A3GI 3NH5A 3GTQI 3PO3I 1ZH1A 4A3BI 1Z03A 3FQMA 4RVGA 2E2II 2JIOA 2VPZA 3CCQ1 1N8R2 3CCEZ 2VUMI 3J80f 1K8A1 4Y52I 3FKII 1VLAA 1Q822 2OTLZ 4E33A 3G711 2R93I 3CCQZ 2LIYA 4E30A 5C44I 1KD12 1WZNA 4E2WA 4RVHA 3D6WA 4RV9A 3CCJ1 1M902 4A3II 1YHQZ 1YJWZ 3CD6Z 4QTUA 4Y7NI 1VQ91 1Y1WI 2EGTA 1TFIA 2QRDB 3CXCZ 2JS4A 1NP6A 1WCMI 2VPXA 3G4S1 4BBSI 5T67A 5IT9b 3J81b 2O53A 4NBHA 3CQZI 1R9TI 1TWAI 1JWHC 1KQSZ 2F4MA 2AYDA 1QVFZ 1SIWA 1YJN1 1VQOZ 3CMA1 2QA41 3PO2I 1RLYA 1USPB 3I07A 2HF1A 1Q861 3HKZA
chains in the Genus database with same CATH topology
3CCV1 2R6MA 3GTPI 3LUSA 3CCVZ 1W2BY 3T4NB 1KRLA 3FQQA 1Q7Y2 3CCL1 1VQNZ 3EEDA 3H3VJ 3I4NI 2OOYB 5FLXb 1X3ZA 2M48A 4HGZA 1KC81 4NBBA 3HOVI 3F3FC 3NH8A 3CME1 3S15I 4MONA 2IZ3A 1YUKA 3I551 1ZB8A 2VF1A 3HOWI 1VQP1 2BJOA 2QR1B 4HH4A 3I55Z 5A2Qb 4DGLA 2IZ4A 4NH1C 1VQMZ 1VQ81 1Z01A 2LFUA 1YIJ1 3JAMb 5T64A 1Q811 2E2JI 3CC4Z 2HU9A 1YIJZ 4A93I 3CCE1 2OTL1 3CCSZ 1S7MA 5LL6f 2OTJZ 4MD8A 3TE5B 4NBEA 3GTLI 1QYPA 4A3FI 3M3YI 3CC7Z 2QLVB 4A3EI 2V8JA 1S721 3MZKB 1K83I 2V8IA 4EWCA 1NJI1 1VQ6Z 3CCR1 1YHQ1 1K732 1S72Z 1YJW1 3CD61 2YU9I 3H0GI 3CCRZ 3CC2Z 1VQ5Z 3HOZI 2E9HA 2K5RA 2JA8I 4NB8A 1VQ7Z 2P28A 4NBCA 5D1OB 4NBAA 4A3JI 2Q51A 3S1NI 1ML8A 1YI21 3GTKI 3HOUI 3GTOI 2JUBA 1VQO1 1YI2Z 1K9M2 1W2BZ 3K7AI 2NVXI 1Q7Y1 1VQ4Z 4S1TA 3IFUA 3S16I 1USPA 1QVGY 1PFTA 2WB1A 1K8A2 1YJ9Z 3HOXI 3NFZA 1VQKZ 3I56Z 4E2YA 3TDHB 2E2HI 1TWHI 1WW9A 1N2FA 4BY1I 3CPWZ 3S1QI 5FLXf 4X6AI 1RO0A 2J6AA 2M6NA 3S14I 4A3DI 2QKDA 1VQN1 1M1K1 2F4OA 1DL6A 4MD7A 3U50C 1WIIA 3S1RI 3GTMI 5A2Qf 2NVTI 1YUAA 3S2DI 5C4XI 2W04A 3BG0B 4RS4A 2O4HA 3Q87A 2I3CA 1N8R1 3VMHA 3RZDI 1Q821 1VQM1 3CCMZ 3MONA 1KD11 1Y1VI 4DK1A 1M901 2RIQA 1RQFA 1Q862 3CC41 4CL1A 3OW2Y 3F3PC 3IF8A 3GKQA 3CCS1 1JJ2Y 2GTHA 1X3WA 2OTJ1 4E32A 2PM9A 2K3RA 1L1OC 3CC71 3VMGA 3CCUZ 1TWFI 3G6EZ 1VQ61 3S17I 5C3EI 5IT9f 2ZAEB 3J81f 1KC82 4AYBA 2QEXZ 1YIT1 3KIHA 3HOYI 3CC21 1VQLZ 2DE6A 1VQ51 1TWGI 4HGYA 2NVQI 3D9XA 1YITZ 1VQ71 4MXUA 2YADA 4RVFA 5D1OA 1QVGZ 2QREB 4QTTA 1QF8A 2DE7A 4NFRA 1I6HI 3EERA 4BY7I 3G71Z 2VUGA 4NOZA 2Q4ZA 3NH4A 4TNUA 4NBFA 4XX2A 3CCJZ 3J80b 1Q812 2R92I 1VQ41 3S2HI 1TWCI 2DE5A 3GTMS 4NBGA 2H85A 1YJ91 1VQK1 2OZKA 3MZLB 1VQ9Z 3I561 4MRIA 5D1PA 3G4SZ 3I4MI 3M4OI 3VB9A 3GTGI 4RVDA 3GTJI 4A3KI 2GU2A 3IX0A 3GCFA 1NJI2 4MH4A 4MD9A 4NB9A 4E2ZA 1Y1VS 3NDIA 2JA7I 3CXCY 4A3CI 1YJNZ 2RPRA 5CM2M 1SFOI 5T6BA 5IP9I 3ESWA 3CMAZ 2QA4Z 4E31A 4A3LI 3VMIA 3NDJA 2B63I 3OW2Z 2GTIA 1KQSY 1Z02A 2NVYI 2RT9A 2KI7B 1QVFY 1JJ2Z 2JMOA 1RO4A 5AN9F 2QRCB 2W03A 3JAMf 3CCM1 3VTNA 1NUIA 3BG1B 2JNYA 3RZOI 1X0TA 1P9NA 2AKLA 2RBLA 3CCLZ 1RNIA 3P5JB 3J7A4 4NBDA 3PO3S 2PMZA 4A3MI 1I50I 3S1MI 1K731 3CPWY 5FLMI 2WAQA 4E2XA 3CMEZ 5IP7I 3CCU1 1M1K2 1ZB9A 2RHBA 1LQLA 2G2KA 3G6E1 1VQPZ 2KPIA 2V8KA 4BXXI 5C4JI 2OOXB 2QEX1 1VQL1 3KIFA 1RO2A 2R7ZI 2PK7A 2JA5I 3QWUA 2JR6A 1VQ8Z 2P3YA 4BBRI 4DQYB 1K9M1 1I3QI 2Y0SA 2JA6I 4A3GI 3NH5A 3GTQI 3PO3I 1ZH1A 4A3BI 1Z03A 3FQMA 4RVGA 2E2II 3CCQ1 1N8R2 4Y52I 3CCEZ 2VUMI 3J80f 1K8A1 3FKII 1VLAA 1Q822 2OTLZ 4E33A 3G711 2R93I 3CCQZ 2LIYA 4E30A 5C44I 1KD12 4E2WA 4RVHA 3D6WA 4RV9A 3CCJ1 1M902 4A3II 1YHQZ 1YJWZ 3CD6Z 4QTUA 4Y7NI 1VQ91 1Y1WI 2EGTA 1TFIA 2QRDB 3CXCZ 2JS4A 1NP6A 1WCMI 3G4S1 4BBSI 5T67A 5IT9b 3J81b 2O53A 4NBHA 3CQZI 1R9TI 1TWAI 1JWHC 1KQSZ 2F4MA 1QVFZ 1YJN1 1VQOZ 3CMA1 2QA41 3PO2I 1RLYA 1USPB 3I07A 2HF1A 1Q861 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMO A;  4MD7 A;  4MD8 A;  4NH1 C;  2M6N A;  4DGL A;  2R6M A;  3EED A;  2M48 A;  1JWH C;  2RT9 A;  1RQF A;  4MD9 A;  1QF8 A; 
#chains in the Genus database with same CATH topology
 3CCV 1;  2R6M A;  3GTP I;  3LUS A;  3CCV Z;  1W2B Y;  3T4N B;  1KRL A;  3FQQ A;  1Q7Y 2;  3CCL 1;  1VQN Z;  3EED A;  3H3V J;  3I4N I;  2OOY B;  5FLX b;  1X3Z A;  2M48 A;  4HGZ A;  1KC8 1;  4NBB A;  3HOV I;  2V3V A;  3F3F C;  3NH8 A;  3CME 1;  3S15 I;  4MON A;  2IZ3 A;  1YUK A;  3I55 1;  1ZB8 A;  2VF1 A;  1AA6 A;  3HOW I;  1VQP 1;  2BJO A;  2QR1 B;  4HH4 A;  3I55 Z;  2JIP A;  5A2Q b;  4DGL A;  2IZ4 A;  3IR7 A;  4NH1 C;  1VQM Z;  1VQ8 1;  1Z01 A;  2LFU A;  1YIJ 1;  3JAM b;  5T64 A;  1Q81 1;  2E2J I;  1Q16 A;  3CC4 Z;  2HU9 A;  1YIJ Z;  4A93 I;  3CCE 1;  2OTL 1;  3CCS Z;  1S7M A;  5LL6 f;  2OTJ Z;  4MD8 A;  3TE5 B;  2V45 A;  4NBE A;  3GTL I;  1QYP A;  4A3F I;  3M3Y I;  3CC7 Z;  2QLV B;  4A3E I;  2V8J A;  1S72 1;  3MZK B;  1K83 I;  2V8I A;  4EWC A;  1NJI 1;  1VQ6 Z;  3CCR 1;  1YHQ 1;  1K73 2;  1S72 Z;  1YJW 1;  3CD6 1;  2YU9 I;  3H0G I;  3CCR Z;  3CC2 Z;  1VQ5 Z;  3HOZ I;  2E9H A;  2K5R A;  2JA8 I;  4NB8 A;  1VQ7 Z;  2P28 A;  4NBC A;  5D1O B;  4NBA A;  4A3J I;  2Q51 A;  3S1N I;  1ML8 A;  1YI2 1;  3GTK I;  3HOU I;  3GTO I;  2JUB A;  1VQO 1;  1YI2 Z;  1K9M 2;  1W2B Z;  3K7A I;  2NVX I;  1Q7Y 1;  1VQ4 Z;  4S1T A;  3IFU A;  3S16 I;  1USP A;  1QVG Y;  1PFT A;  2WB1 A;  1K8A 2;  1YJ9 Z;  3HOX I;  3NFZ A;  1VQK Z;  3I56 Z;  3D2L A;  1QXF A;  4E2Y A;  3TDH B;  2E2H I;  1TWH I;  1WW9 A;  1N2F A;  4BY1 I;  3CPW Z;  3S1Q I;  5FLX f;  4X6A I;  1RO0 A;  2J6A A;  2M6N A;  3S14 I;  4A3D I;  2QKD A;  1VQN 1;  1M1K 1;  2F4O A;  1DL6 A;  4MD7 A;  3U50 C;  1WII A;  1WJ2 A;  2NAP A;  3S1R I;  3GTM I;  5A2Q f;  2NVT I;  1YUA A;  3S2D I;  5C4X I;  2W04 A;  3BG0 B;  4RS4 A;  2O4H A;  2VPW A;  3Q87 A;  2I3C A;  1N8R 1;  3VMH A;  3RZD I;  1Q82 1;  1VQM 1;  3CCM Z;  3MON A;  1KD1 1;  1Y1V I;  4DK1 A;  1M90 1;  2RIQ A;  1RQF A;  1Y8C A;  3CC4 1;  1Q86 2;  4CL1 A;  3F3P C;  3OW2 Y;  3IF8 A;  3GKQ A;  3CCS 1;  1JJ2 Y;  2GTH A;  1X3W A;  2OTJ 1;  4E32 A;  2PM9 A;  2K3R A;  1L1O C;  3CC7 1;  2JIQ A;  3VMG A;  3CCU Z;  1TWF I;  3G6E Z;  1VQ6 1;  3S17 I;  5C3E I;  5IT9 f;  2ZAE B;  3J81 f;  1KC8 2;  4AYB A;  2QEX Z;  1YIT 1;  2VPY A;  3KIH A;  3HOY I;  3CC2 1;  1VQL Z;  2DE6 A;  1VQ5 1;  1TWG I;  4HGY A;  2NVQ I;  3D9X A;  1FDO A;  1YIT Z;  1VQ7 1;  4MXU A;  2YAD A;  4RVF A;  5D1O A;  1QVG Z;  2QRE B;  4QTT A;  1QF8 A;  2DE7 A;  4NFR A;  1I6H I;  3EER A;  4BY7 I;  3G71 Z;  2VUG A;  4NOZ A;  2Q4Z A;  3NH4 A;  4TNU A;  4NBF A;  4XX2 A;  3CCJ Z;  3J80 b;  1Q81 2;  2R92 I;  1VQ4 1;  3S2H I;  1TWC I;  2DE5 A;  3GTM S;  4NBG A;  2H85 A;  1YJ9 1;  1VQK 1;  2OZK A;  3MZL B;  1VQ9 Z;  3I56 1;  4MRI A;  5D1P A;  2LEX A;  3G4S Z;  2JIM A;  3I4M I;  3M4O I;  3VB9 A;  2IV2 X;  3GTG I;  4RVD A;  3GTJ I;  4A3K I;  2GU2 A;  3IX0 A;  3GCF A;  1NJI 2;  4MH4 A;  4MD9 A;  4NB9 A;  4E2Z A;  1Y1V S;  3NDI A;  2JA7 I;  2E7Z A;  3CXC Y;  4A3C I;  2JIR A;  1YJN Z;  2RPR A;  5CM2 M;  1SFO I;  5T6B A;  5IP9 I;  3ESW A;  3CMA Z;  2QA4 Z;  4E31 A;  4A3L I;  3VMI A;  3NDJ A;  2B63 I;  3OW2 Z;  2GTI A;  1KQS Y;  1Z02 A;  2NVY I;  2RT9 A;  2KI7 B;  1QVF Y;  1JJ2 Z;  2JMO A;  1RO4 A;  1FDI A;  5AN9 F;  2QRC B;  2W03 A;  3JAM f;  3CCM 1;  3VTN A;  1NUI A;  3BG1 B;  2JNY A;  3RZO I;  1X0T A;  1P9N A;  2AKL A;  2RBL A;  3CCL Z;  1RNI A;  3P5J B;  3J7A 4;  4NBD A;  3PO3 S;  2PMZ A;  4A3M I;  1I50 I;  3S1M I;  1K73 1;  3CPW Y;  5FLM I;  2WAQ A;  4E2X A;  3CME Z;  5IP7 I;  3CCU 1;  1M1K 2;  1ZB9 A;  2RHB A;  1LQL A;  2G2K A;  3G6E 1;  1VQP Z;  2KPI A;  2V8K A;  4BXX I;  5C4J I;  2OOX B;  2QEX 1;  1VQL 1;  3KIF A;  1RO2 A;  2R7Z I;  2PK7 A;  2JA5 I;  3QWU A;  2JR6 A;  1VQ8 Z;  2P3Y A;  4BBR I;  4DQY B;  1K9M 1;  1I3Q I;  2Y0S A;  2JA6 I;  4A3G I;  3NH5 A;  3GTQ I;  3PO3 I;  1ZH1 A;  4A3B I;  1Z03 A;  3FQM A;  4RVG A;  2E2I I;  2JIO A;  2VPZ A;  3CCQ 1;  1N8R 2;  3CCE Z;  2VUM I;  3J80 f;  1K8A 1;  4Y52 I;  3FKI I;  1VLA A;  1Q82 2;  2OTL Z;  4E33 A;  3G71 1;  2R93 I;  3CCQ Z;  2LIY A;  4E30 A;  5C44 I;  1KD1 2;  1WZN A;  4E2W A;  4RVH A;  3D6W A;  4RV9 A;  3CCJ 1;  1M90 2;  4A3I I;  1YHQ Z;  1YJW Z;  3CD6 Z;  4QTU A;  4Y7N I;  1VQ9 1;  1Y1W I;  2EGT A;  1TFI A;  2QRD B;  3CXC Z;  2JS4 A;  1NP6 A;  1WCM I;  2VPX A;  3G4S 1;  4BBS I;  5T67 A;  5IT9 b;  3J81 b;  2O53 A;  4NBH A;  3CQZ I;  1R9T I;  1TWA I;  1JWH C;  1KQS Z;  2F4M A;  2AYD A;  1QVF Z;  1SIW A;  1YJN 1;  1VQO Z;  3CMA 1;  2QA4 1;  3PO2 I;  1RLY A;  1USP B;  3I07 A;  2HF1 A;  1Q86 1;  3HKZ A; 
#chains in the Genus database with same CATH homology
 3CCV 1;  2R6M A;  3GTP I;  3LUS A;  3CCV Z;  1W2B Y;  3T4N B;  1KRL A;  3FQQ A;  1Q7Y 2;  3CCL 1;  1VQN Z;  3EED A;  3H3V J;  3I4N I;  2OOY B;  5FLX b;  1X3Z A;  2M48 A;  4HGZ A;  1KC8 1;  4NBB A;  3HOV I;  3F3F C;  3NH8 A;  3CME 1;  3S15 I;  4MON A;  2IZ3 A;  1YUK A;  3I55 1;  1ZB8 A;  2VF1 A;  3HOW I;  1VQP 1;  2BJO A;  2QR1 B;  4HH4 A;  3I55 Z;  5A2Q b;  4DGL A;  2IZ4 A;  4NH1 C;  1VQM Z;  1VQ8 1;  1Z01 A;  2LFU A;  1YIJ 1;  3JAM b;  5T64 A;  1Q81 1;  2E2J I;  3CC4 Z;  2HU9 A;  1YIJ Z;  4A93 I;  3CCE 1;  2OTL 1;  3CCS Z;  1S7M A;  5LL6 f;  2OTJ Z;  4MD8 A;  3TE5 B;  4NBE A;  3GTL I;  1QYP A;  4A3F I;  3M3Y I;  3CC7 Z;  2QLV B;  4A3E I;  2V8J A;  1S72 1;  3MZK B;  1K83 I;  2V8I A;  4EWC A;  1NJI 1;  1VQ6 Z;  3CCR 1;  1YHQ 1;  1K73 2;  1S72 Z;  1YJW 1;  3CD6 1;  2YU9 I;  3H0G I;  3CCR Z;  3CC2 Z;  1VQ5 Z;  3HOZ I;  2E9H A;  2K5R A;  2JA8 I;  4NB8 A;  1VQ7 Z;  2P28 A;  4NBC A;  5D1O B;  4NBA A;  4A3J I;  2Q51 A;  3S1N I;  1ML8 A;  1YI2 1;  3GTK I;  3HOU I;  3GTO I;  2JUB A;  1VQO 1;  1YI2 Z;  1K9M 2;  1W2B Z;  3K7A I;  2NVX I;  1Q7Y 1;  1VQ4 Z;  4S1T A;  3IFU A;  3S16 I;  1USP A;  1QVG Y;  1PFT A;  2WB1 A;  1K8A 2;  1YJ9 Z;  3HOX I;  3NFZ A;  1VQK Z;  3I56 Z;  4E2Y A;  3TDH B;  2E2H I;  1TWH I;  1WW9 A;  1N2F A;  4BY1 I;  3CPW Z;  3S1Q I;  5FLX f;  4X6A I;  1RO0 A;  2J6A A;  2M6N A;  3S14 I;  4A3D I;  2QKD A;  1VQN 1;  1M1K 1;  2F4O A;  1DL6 A;  4MD7 A;  3U50 C;  1WII A;  3S1R I;  3GTM I;  5A2Q f;  2NVT I;  1YUA A;  3S2D I;  5C4X I;  2W04 A;  3BG0 B;  4RS4 A;  2O4H A;  3Q87 A;  2I3C A;  1N8R 1;  3VMH A;  3RZD I;  1Q82 1;  1VQM 1;  3CCM Z;  3MON A;  1KD1 1;  1Y1V I;  4DK1 A;  1M90 1;  2RIQ A;  1RQF A;  1Q86 2;  3CC4 1;  4CL1 A;  3OW2 Y;  3F3P C;  3IF8 A;  3GKQ A;  3CCS 1;  1JJ2 Y;  2GTH A;  1X3W A;  2OTJ 1;  4E32 A;  2PM9 A;  2K3R A;  1L1O C;  3CC7 1;  3VMG A;  3CCU Z;  1TWF I;  3G6E Z;  1VQ6 1;  3S17 I;  5C3E I;  5IT9 f;  2ZAE B;  3J81 f;  1KC8 2;  4AYB A;  2QEX Z;  1YIT 1;  3KIH A;  3HOY I;  3CC2 1;  1VQL Z;  2DE6 A;  1VQ5 1;  1TWG I;  4HGY A;  2NVQ I;  3D9X A;  1YIT Z;  1VQ7 1;  4MXU A;  2YAD A;  4RVF A;  5D1O A;  1QVG Z;  2QRE B;  4QTT A;  1QF8 A;  2DE7 A;  4NFR A;  1I6H I;  3EER A;  4BY7 I;  3G71 Z;  2VUG A;  4NOZ A;  2Q4Z A;  3NH4 A;  4TNU A;  4NBF A;  4XX2 A;  3CCJ Z;  3J80 b;  1Q81 2;  2R92 I;  1VQ4 1;  3S2H I;  1TWC I;  2DE5 A;  3GTM S;  4NBG A;  2H85 A;  1YJ9 1;  1VQK 1;  2OZK A;  3MZL B;  1VQ9 Z;  3I56 1;  4MRI A;  5D1P A;  3G4S Z;  3I4M I;  3M4O I;  3VB9 A;  3GTG I;  4RVD A;  3GTJ I;  4A3K I;  2GU2 A;  3IX0 A;  3GCF A;  1NJI 2;  4MH4 A;  4MD9 A;  4NB9 A;  4E2Z A;  1Y1V S;  3NDI A;  2JA7 I;  3CXC Y;  4A3C I;  1YJN Z;  2RPR A;  5CM2 M;  1SFO I;  5T6B A;  5IP9 I;  3ESW A;  3CMA Z;  2QA4 Z;  4E31 A;  4A3L I;  3VMI A;  3NDJ A;  2B63 I;  3OW2 Z;  2GTI A;  1KQS Y;  1Z02 A;  2NVY I;  2RT9 A;  2KI7 B;  1QVF Y;  1JJ2 Z;  2JMO A;  1RO4 A;  5AN9 F;  2QRC B;  2W03 A;  3JAM f;  3CCM 1;  3VTN A;  1NUI A;  3BG1 B;  2JNY A;  3RZO I;  1X0T A;  1P9N A;  2AKL A;  2RBL A;  3CCL Z;  1RNI A;  3P5J B;  3J7A 4;  4NBD A;  3PO3 S;  2PMZ A;  4A3M I;  1I50 I;  3S1M I;  1K73 1;  3CPW Y;  5FLM I;  2WAQ A;  4E2X A;  3CME Z;  5IP7 I;  3CCU 1;  1M1K 2;  1ZB9 A;  2RHB A;  1LQL A;  2G2K A;  3G6E 1;  1VQP Z;  2KPI A;  2V8K A;  4BXX I;  5C4J I;  2OOX B;  2QEX 1;  1VQL 1;  3KIF A;  1RO2 A;  2R7Z I;  2PK7 A;  2JA5 I;  3QWU A;  2JR6 A;  1VQ8 Z;  2P3Y A;  4BBR I;  4DQY B;  1K9M 1;  1I3Q I;  2Y0S A;  2JA6 I;  4A3G I;  3NH5 A;  3GTQ I;  3PO3 I;  1ZH1 A;  4A3B I;  1Z03 A;  3FQM A;  4RVG A;  2E2I I;  3CCQ 1;  1N8R 2;  4Y52 I;  3CCE Z;  2VUM I;  3J80 f;  1K8A 1;  3FKI I;  1VLA A;  1Q82 2;  2OTL Z;  4E33 A;  3G71 1;  2R93 I;  3CCQ Z;  2LIY A;  4E30 A;  5C44 I;  1KD1 2;  4E2W A;  4RVH A;  3D6W A;  4RV9 A;  3CCJ 1;  1M90 2;  4A3I I;  1YHQ Z;  1YJW Z;  3CD6 Z;  4QTU A;  4Y7N I;  1VQ9 1;  1Y1W I;  2EGT A;  1TFI A;  2QRD B;  3CXC Z;  2JS4 A;  1NP6 A;  1WCM I;  3G4S 1;  4BBS I;  5T67 A;  5IT9 b;  3J81 b;  2O53 A;  4NBH A;  3CQZ I;  1R9T I;  1TWA I;  1JWH C;  1KQS Z;  2F4M A;  1QVF Z;  1YJN 1;  1VQO Z;  3CMA 1;  2QA4 1;  3PO2 I;  1RLY A;  1USP B;  3I07 A;  2HF1 A;  1Q86 1;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...