1R9TI

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1r9tI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1r9tI02
4QTTA 4X6AI 3GTPI 2B63I 1ZB8A 1QYPA 1I3QI 1I50I 4Y7NI 3S15I 3U50C 1DL6A 4NBGA 2JA8I 3GKQA 2R92I 4NOZA 4A3MI 1L1OC 1RLYA 4BBSI 4Y52I 3LUSA 3PO3S 4A3LI 3GTLI 2DE7A 3S1MI 1TWCI 5IP7I 4NBEA 4A93I 3EERA 1PFTA 3I4NI 3VMIA 3S2DI 5C4XI 3GTMI 3GTQI 1ML8A 3S2HI 5C4JI 2E2JI 3K7AI 3VMHA 4BY1I 2JNYA 2J6AA 3GCFA 4A3DI 1WCMI 1Y1VS 3M3YI 4A3BI 3S1QI 1Y1WI 1TWFI 2E2HI 2JA7I 2BJOA 2F4OA 2RBLA 3FKII 5C44I 3HOXI 3HOVI 1I6HI 4A3JI 2F4MA 1ZB9A 2DE5A 3HOWI 2NVQI 1X3ZA 1NUIA 4NBFA 1TWAI 4NB9A 1R9TI 1SFOI 2NVTI 2VUMI 2HF1A 5IP9I 2KPIA 4BBRI 3I4MI 2R93I 1X3WA 3RZOI 5C3EI 1RO4A 3GTJI 4QTUA 1TFIA 4NBAA 3RZDI 2AKLA 2R7ZI 2DE6A 4XX2A 4A3GI 3M4OI 2PK7A 3H0GI 2JA5I 1YUAA 4A3KI 2JA6I 2NVYI 2NVXI 3VMGA 4BY7I 2JR6A 4NB8A 1USPB 4MH4A 3GTMS 4NBDA 2E2II 1VLAA 3D6WA 4A3CI 4BXXI 3H3VJ 3CQZI 4A3EI 1K83I 3HOYI 5CM2M 3S17I 3S1NI 3S14I 1USPA 1WW9A 3GTOI 1Y1VI 4NBHA 5FLMI 2P3YA 3GTKI 3S1RI 3PO2I 3GTGI 3ESWA 4A3II 3HOUI 3VB9A 4NBCA 1TWGI 1LQLA 3S16I 3PO3I 2YU9I 2K5RA 1TWHI 3HOZI 4A3FI 3I07A 1N2FA 4NBBA 3Q87A 2JS4A
chains in the Genus database with same CATH superfamily
3MZLB 3CD61 3GTPI 1JJ2Y 1VQ41 2RT9A 4NFRA 3CCRZ 1I50I 1RO2A 4Y7NI 3GKQA 2R92I 4A3MI 1L1OC 4NH1C 4Y52I 3IFUA 3S1MI 1TWCI 5IP7I 1VQP1 1VQMZ 3I4NI 3D2LA 1N8R1 3GTQI 3VMHA 2OTJZ 2V3VA 3IF8A 3GCFA 1WCMI 1YJW1 3CMA1 1YHQZ 5T64A 4RVHA 4E2ZA 2JA7I 3CPWY 3J81f 1VQKZ 1VQM1 1FDOA 3CCS1 1K732 1Y8CA 4A3JI 2GTIA 2QRCB 2QREB 1KC82 1KRLA 3G4SZ 2OTJ1 4NBFA 1TWAI 4NB9A 1VQ61 1QXFA 3J7A4 2QKDA 2Q51A 2R93I 4RS4A 5C3EI 3CC21 4NBAA 2AKLA 1X0TA 2DE6A 1JWHC 3QWUA 5D1OA 2Q4ZA 1VQ5Z 2JIMA 2VF1A 1YITZ 1NJI1 3VMGA 4NB8A 1USPB 1M1K2 1M902 5FLXf 3GTMS 3CXCY 2KI7B 4E30A 4DK1A 3OW2Y 1VQ51 1WW9A 2RIQA 1Q811 3GTOI 3CME1 1YIT1 1VQ9Z 1VQNZ 3CCE1 3FQQA 4E2YA 3GTGI 4NBCA 5T6BA 1TWGI 1Q16A 2ZAEB 3PO3I 2YU9I 1QVFY 3CCQ1 2LEXA 3I07A 1N2FA 1P9NA 4NBBA 2QEX1 3Q87A 2JS4A 2LFUA 1ZH1A 4QTTA 2V45A 1KD11 3U50C 2E9HA 1VQ71 3CD6Z 2RPRA 4RV9A 1SIWA 3CC7Z 4NBEA 3EERA 1PFTA 1S721 3K7AI 1VQPZ 2VUGA 1QVGZ 3M3YI 4A3BI 2VPXA 1W2BY 4E2XA 3CC71 2V8JA 3FKII 3HOXI 3HOVI 1JJ2Z 1YJWZ 3CMAZ 3P5JB 2F4MA 1ZB9A 2DE5A 1Q7Y1 2NVQI 1X3ZA 5A2Qf 3CCSZ 1K8A2 5T67A 1R9TI 1KD12 2NVTI 2HF1A 5IP9I 1RQFA 1VQLZ 3I4MI 1Q861 2P28A 1YUKA 2O53A 4EWCA 4S1TA 4QTUA 1TFIA 4XX2A 1VQ6Z 2QR1B 4A3GI 1Q822 1YJ9Z 1YUAA 1WJ2A 3J81b 3CC2Z 4AYBA 2JA6I 4BY7I 1VQL1 3BG0B 4NBDA 2E2II 1VLAA 2IZ4A 1S7MA 2JIQA 2VPYA 2GTHA 4BXXI 3IX0A 2Y0SA 3F3PC 4A3EI 1YJ91 1QF8A 3G6E1 2PMZA 1Z01A 4MXUA 4NBHA 5FLMI 1Q7Y2 3CCVZ 2JUBA 1N8R2 2QA4Z 2RHBA 3ESWA 2OTL1 1Q862 3CMEZ 1LQLA 3S16I 4RVGA 3CCEZ 4A3FI 4HH4A 5FLXb 3TE5B 3CCV1 2JIRA 5LL6f 2QA41 4X6AI 3HKZA 3CCUZ 2B63I 3CCQZ 3CCJZ 2QEXZ 3OW2Z 3S15I 4MD8A 4NBGA 1DL6A 4NOZA 4BBSI 3LUSA 3PO3S 4A3LI 1NP6A 2DE7A 2K3RA 4CL1A 2G2KA 3S2DI 3VMIA 5C4XI 3GTMI 2IV2X 4DGLA 2E7ZA 3CCU1 1VQ7Z 3S2HI 2E2JI 1K9M1 3CCJ1 1KQSZ 4BY1I 2JNYA 1WIIA 2J6AA 4E32A 2OOYB 2HU9A 1QVFZ 1Y1VS 1NJI2 1S72Z 3KIFA 1Y1WI 1TWFI 2M48A 3I551 2F4OA 2RBLA 3NFZA 5IT9b 3KIHA 3J80f 1I6HI 2V8IA 3NDIA 3JAMb 1NUIA 1Q812 1SFOI 2VUMI 5D1OB 4BBRI 3MZKB 1X3WA 1VQO1 3MONA 3RZDI 2R7ZI 3M4OI 2PK7A 4A3KI 5AN9F 2IZ3A 1W2BZ 3CC41 4MD7A 1QVGY 2QLVB 1K731 4A3CI 3H3VJ 5A2Qb 3CQZI 3CCM1 1K83I 3HOYI 3S17I 3G711 3S14I 1USPA 2QRDB 1Z02A 3I56Z 2P3YA 2GU2A 3T4NB 2W04A 3TDHB 3G6EZ 1FDIA 1YI21 3HOUI 3VB9A 2O4HA 2NAPA 1YJNZ 3CPWZ 2K5RA 3EEDA 5D1PA 1YIJZ 1VQ8Z 2OZKA 3I561 2OTLZ 3CCR1 3BG1B 1WZNA 1M1K1 1M901 1ZB8A 1QYPA 1I3QI 1YJN1 2JA8I 1RLYA 1YIJ1 1VQ81 3GTLI 4A93I 2W03A 3NH4A 4RVDA 1YHQ1 2I3CA 1ML8A 2WB1A 2V8KA 3CCLZ 5C4JI 1VQK1 2M6NA 2VPWA 3CXCZ 4A3DI 4TNUA 3S1QI 2E2HI 3G4S1 2BJOA 2YADA 3NH8A 2AYDA 5C44I 3FQMA 3CCL1 3I55Z 2WAQA 3HOWI 4MD9A 2OOXB 2KPIA 3RZOI 1RO4A 3GTJI 2LIYA 2JMOA 2PM9A 3H0GI 2JIOA 2JA5I 4DQYB 3NH5A 1VQOZ 4E31A 2NVYI 2NVXI 1KQSY 2JR6A 1RNIA 4MH4A 3J80b 3D6WA 2JIPA 1VQ91 1VQN1 3CC4Z 2EGTA 4E2WA 5CM2M 3S1NI 3VTNA 1RO0A 1Y1VI 1K8A1 3D9XA 4HGYA 5IT9f 3GTKI 3CCMZ 4RVFA 3S1RI 3PO2I 3G71Z 3F3FC 2VPZA 4A3II 4HGZA 3JAMf 1VQ4Z 1K9M2 2H85A 4MONA 1AA6A 3IR7A 1Q821 1TWHI 2R6MA 3HOZI 3NDJA 1YI2Z 1Z03A 4MRIA 1KC81 4E33A
chains in the Genus database with same CATH topology
3MZLB 3CD61 3GTPI 1JJ2Y 1VQ41 2RT9A 4NFRA 3CCRZ 1I50I 1RO2A 4Y7NI 3GKQA 2R92I 4A3MI 1L1OC 4NH1C 4Y52I 3IFUA 3S1MI 1TWCI 5IP7I 1VQP1 1VQMZ 3I4NI 1N8R1 3GTQI 3VMHA 2OTJZ 3IF8A 3GCFA 1WCMI 1YJW1 3CMA1 1YHQZ 5T64A 4RVHA 4E2ZA 2JA7I 3CPWY 3J81f 1VQKZ 1VQM1 3CCS1 1K732 4A3JI 2GTIA 2QRCB 2QREB 1KC82 1KRLA 3G4SZ 2OTJ1 4NBFA 1TWAI 4NB9A 1VQ61 3J7A4 2QKDA 2Q51A 2R93I 4RS4A 5C3EI 3CC21 4NBAA 2AKLA 1X0TA 2DE6A 1JWHC 3QWUA 5D1OA 2Q4ZA 1VQ5Z 2VF1A 1YITZ 1NJI1 3VMGA 4NB8A 1USPB 1M1K2 1M902 5FLXf 3GTMS 3CXCY 2KI7B 4E30A 4DK1A 3OW2Y 1VQ51 1WW9A 2RIQA 1Q811 3GTOI 3CME1 1YIT1 1VQ9Z 1VQNZ 3CCE1 3FQQA 4E2YA 3GTGI 4NBCA 5T6BA 1TWGI 2ZAEB 3PO3I 2YU9I 1QVFY 3CCQ1 3I07A 1N2FA 1P9NA 4NBBA 2QEX1 3Q87A 2JS4A 2LFUA 1ZH1A 4QTTA 1KD11 3U50C 2E9HA 1VQ71 3CD6Z 2RPRA 4RV9A 3CC7Z 4NBEA 3EERA 1PFTA 1S721 3K7AI 1VQPZ 2VUGA 1QVGZ 3M3YI 4A3BI 1W2BY 4E2XA 3CC71 2V8JA 3FKII 3HOXI 3HOVI 1JJ2Z 1YJWZ 3CMAZ 3P5JB 2F4MA 1ZB9A 2DE5A 1Q7Y1 2NVQI 1X3ZA 5A2Qf 3CCSZ 1K8A2 5T67A 1R9TI 1KD12 2NVTI 2HF1A 5IP9I 1RQFA 1VQLZ 3I4MI 1Q861 2P28A 1YUKA 2O53A 4EWCA 4S1TA 4QTUA 1TFIA 4XX2A 1VQ6Z 2QR1B 4A3GI 1Q822 1YJ9Z 1YUAA 3J81b 3CC2Z 4AYBA 2JA6I 4BY7I 1VQL1 3BG0B 4NBDA 2E2II 1VLAA 2IZ4A 1S7MA 2GTHA 4BXXI 3IX0A 2Y0SA 3F3PC 4A3EI 1YJ91 1QF8A 3G6E1 2PMZA 1Z01A 4MXUA 4NBHA 5FLMI 1Q7Y2 3CCVZ 2JUBA 1N8R2 2QA4Z 2RHBA 3ESWA 2OTL1 1Q862 3CMEZ 1LQLA 3S16I 4RVGA 3CCEZ 4A3FI 4HH4A 5FLXb 3TE5B 3CCV1 5LL6f 2QA41 4X6AI 3HKZA 3CCUZ 2B63I 3CCQZ 3CCJZ 2QEXZ 3OW2Z 3S15I 4MD8A 4NBGA 1DL6A 4NOZA 4BBSI 3LUSA 3PO3S 4A3LI 1NP6A 2DE7A 2K3RA 4CL1A 2G2KA 3S2DI 3VMIA 5C4XI 3GTMI 4DGLA 3CCU1 1VQ7Z 3S2HI 2E2JI 1K9M1 3CCJ1 1KQSZ 4BY1I 2JNYA 1WIIA 2J6AA 4E32A 2OOYB 2HU9A 1QVFZ 1Y1VS 1NJI2 1S72Z 3KIFA 1Y1WI 1TWFI 2M48A 3I551 2F4OA 2RBLA 3NFZA 5IT9b 3KIHA 3J80f 1I6HI 2V8IA 3NDIA 3JAMb 1NUIA 1Q812 1SFOI 2VUMI 5D1OB 4BBRI 3MZKB 1X3WA 1VQO1 3MONA 3RZDI 2R7ZI 3M4OI 2PK7A 4A3KI 5AN9F 2IZ3A 1W2BZ 3CC41 4MD7A 1QVGY 2QLVB 1K731 4A3CI 3H3VJ 5A2Qb 3CQZI 3CCM1 1K83I 3HOYI 3S17I 3G711 3S14I 1USPA 2QRDB 1Z02A 3I56Z 2P3YA 2GU2A 3T4NB 2W04A 3TDHB 3G6EZ 1YI21 3HOUI 3VB9A 2O4HA 1YJNZ 3CPWZ 2K5RA 3EEDA 5D1PA 1YIJZ 1VQ8Z 2OZKA 3I561 2OTLZ 3CCR1 3BG1B 1M1K1 1M901 1ZB8A 1QYPA 1I3QI 1YJN1 2JA8I 1RLYA 1YIJ1 1VQ81 3GTLI 4A93I 2W03A 3NH4A 4RVDA 1YHQ1 2I3CA 1ML8A 2WB1A 2V8KA 3CCLZ 5C4JI 1VQK1 2M6NA 3CXCZ 4A3DI 4TNUA 3S1QI 2E2HI 3G4S1 2BJOA 2YADA 3NH8A 5C44I 3FQMA 3CCL1 3I55Z 2WAQA 3HOWI 4MD9A 2OOXB 2KPIA 3RZOI 1RO4A 3GTJI 2LIYA 2JMOA 2PM9A 3H0GI 2JA5I 4DQYB 3NH5A 1VQOZ 4E31A 2NVYI 2NVXI 1KQSY 2JR6A 1RNIA 4MH4A 3J80b 3D6WA 1VQ91 1VQN1 3CC4Z 2EGTA 4E2WA 5CM2M 3S1NI 3VTNA 1RO0A 1Y1VI 1K8A1 3D9XA 4HGYA 5IT9f 3GTKI 3CCMZ 4RVFA 3S1RI 3PO2I 3G71Z 3F3FC 4A3II 4HGZA 3JAMf 1VQ4Z 1K9M2 2H85A 4MONA 1Q821 1TWHI 2R6MA 3HOZI 3NDJA 1YI2Z 1Z03A 4MRIA 1KC81 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTT A;  4X6A I;  3GTP I;  2B63 I;  1ZB8 A;  1QYP A;  1I3Q I;  1I50 I;  4Y7N I;  3S15 I;  3U50 C;  1DL6 A;  4NBG A;  2JA8 I;  3GKQ A;  2R92 I;  4NOZ A;  4A3M I;  1L1O C;  1RLY A;  4BBS I;  4Y52 I;  3LUS A;  3PO3 S;  4A3L I;  3GTL I;  2DE7 A;  3S1M I;  1TWC I;  5IP7 I;  4NBE A;  4A93 I;  3EER A;  1PFT A;  3I4N I;  3VMI A;  3S2D I;  5C4X I;  3GTM I;  3GTQ I;  1ML8 A;  3S2H I;  5C4J I;  2E2J I;  3K7A I;  3VMH A;  4BY1 I;  2JNY A;  2J6A A;  3GCF A;  4A3D I;  1WCM I;  1Y1V S;  3M3Y I;  4A3B I;  3S1Q I;  1Y1W I;  1TWF I;  2E2H I;  2JA7 I;  2BJO A;  2F4O A;  2RBL A;  3FKI I;  5C44 I;  3HOX I;  3HOV I;  1I6H I;  4A3J I;  2F4M A;  1ZB9 A;  2DE5 A;  3HOW I;  2NVQ I;  1X3Z A;  1NUI A;  4NBF A;  1TWA I;  4NB9 A;  1R9T I;  1SFO I;  2NVT I;  2VUM I;  2HF1 A;  5IP9 I;  2KPI A;  4BBR I;  3I4M I;  2R93 I;  1X3W A;  3RZO I;  5C3E I;  1RO4 A;  3GTJ I;  4QTU A;  1TFI A;  4NBA A;  3RZD I;  2AKL A;  2R7Z I;  2DE6 A;  4XX2 A;  4A3G I;  3M4O I;  2PK7 A;  3H0G I;  2JA5 I;  1YUA A;  4A3K I;  2JA6 I;  2NVY I;  2NVX I;  3VMG A;  4BY7 I;  2JR6 A;  4NB8 A;  1USP B;  4MH4 A;  3GTM S;  4NBD A;  2E2I I;  1VLA A;  3D6W A;  4A3C I;  4BXX I;  3H3V J;  3CQZ I;  4A3E I;  1K83 I;  3HOY I;  5CM2 M;  3S17 I;  3S1N I;  3S14 I;  1USP A;  1WW9 A;  3GTO I;  1Y1V I;  4NBH A;  5FLM I;  2P3Y A;  3GTK I;  3S1R I;  3PO2 I;  3GTG I;  3ESW A;  4A3I I;  3HOU I;  3VB9 A;  4NBC A;  1TWG I;  1LQL A;  3S16 I;  3PO3 I;  2YU9 I;  2K5R A;  1TWH I;  3HOZ I;  4A3F I;  3I07 A;  1N2F A;  4NBB A;  3Q87 A;  2JS4 A; 
#chains in the Genus database with same CATH topology
 3MZL B;  3CD6 1;  3GTP I;  1JJ2 Y;  1VQ4 1;  2RT9 A;  4NFR A;  3CCR Z;  1I50 I;  1RO2 A;  4Y7N I;  3GKQ A;  2R92 I;  4A3M I;  1L1O C;  4NH1 C;  4Y52 I;  3IFU A;  3S1M I;  1TWC I;  5IP7 I;  1VQP 1;  1VQM Z;  3I4N I;  3D2L A;  1N8R 1;  3GTQ I;  3VMH A;  2OTJ Z;  2V3V A;  3IF8 A;  3GCF A;  1WCM I;  1YJW 1;  3CMA 1;  1YHQ Z;  5T64 A;  4RVH A;  4E2Z A;  2JA7 I;  3CPW Y;  3J81 f;  1VQK Z;  1VQM 1;  1FDO A;  3CCS 1;  1K73 2;  1Y8C A;  4A3J I;  2GTI A;  2QRC B;  2QRE B;  1KC8 2;  1KRL A;  3G4S Z;  2OTJ 1;  4NBF A;  1TWA I;  4NB9 A;  1VQ6 1;  1QXF A;  3J7A 4;  2QKD A;  2Q51 A;  2R93 I;  4RS4 A;  5C3E I;  3CC2 1;  4NBA A;  2AKL A;  1X0T A;  2DE6 A;  1JWH C;  3QWU A;  5D1O A;  2Q4Z A;  1VQ5 Z;  2JIM A;  2VF1 A;  1YIT Z;  1NJI 1;  3VMG A;  4NB8 A;  1USP B;  1M1K 2;  1M90 2;  5FLX f;  3GTM S;  3CXC Y;  2KI7 B;  4E30 A;  4DK1 A;  3OW2 Y;  1VQ5 1;  1WW9 A;  2RIQ A;  1Q81 1;  3GTO I;  3CME 1;  1YIT 1;  1VQ9 Z;  1VQN Z;  3CCE 1;  3FQQ A;  4E2Y A;  3GTG I;  4NBC A;  5T6B A;  1TWG I;  1Q16 A;  2ZAE B;  3PO3 I;  2YU9 I;  1QVF Y;  3CCQ 1;  2LEX A;  3I07 A;  1N2F A;  1P9N A;  4NBB A;  2QEX 1;  3Q87 A;  2JS4 A;  2LFU A;  1ZH1 A;  4QTT A;  2V45 A;  1KD1 1;  3U50 C;  2E9H A;  1VQ7 1;  3CD6 Z;  2RPR A;  4RV9 A;  1SIW A;  3CC7 Z;  4NBE A;  3EER A;  1PFT A;  1S72 1;  3K7A I;  1VQP Z;  2VUG A;  1QVG Z;  3M3Y I;  4A3B I;  2VPX A;  1W2B Y;  4E2X A;  3CC7 1;  2V8J A;  3FKI I;  3HOX I;  3HOV I;  1JJ2 Z;  1YJW Z;  3CMA Z;  3P5J B;  2F4M A;  1ZB9 A;  2DE5 A;  1Q7Y 1;  2NVQ I;  1X3Z A;  5A2Q f;  3CCS Z;  1K8A 2;  5T67 A;  1R9T I;  1KD1 2;  2NVT I;  2HF1 A;  5IP9 I;  1RQF A;  1VQL Z;  3I4M I;  1Q86 1;  2P28 A;  1YUK A;  2O53 A;  4EWC A;  4S1T A;  4QTU A;  1TFI A;  4XX2 A;  1VQ6 Z;  2QR1 B;  4A3G I;  1Q82 2;  1YJ9 Z;  1YUA A;  1WJ2 A;  3J81 b;  3CC2 Z;  4AYB A;  2JA6 I;  4BY7 I;  1VQL 1;  3BG0 B;  4NBD A;  2E2I I;  1VLA A;  2IZ4 A;  1S7M A;  2JIQ A;  2VPY A;  2GTH A;  4BXX I;  3IX0 A;  2Y0S A;  3F3P C;  4A3E I;  1YJ9 1;  1QF8 A;  3G6E 1;  2PMZ A;  1Z01 A;  4MXU A;  4NBH A;  5FLM I;  1Q7Y 2;  3CCV Z;  2JUB A;  1N8R 2;  2QA4 Z;  2RHB A;  3ESW A;  2OTL 1;  1Q86 2;  3CME Z;  1LQL A;  3S16 I;  4RVG A;  3CCE Z;  4A3F I;  4HH4 A;  5FLX b;  3TE5 B;  3CCV 1;  2JIR A;  5LL6 f;  2QA4 1;  4X6A I;  3HKZ A;  3CCU Z;  2B63 I;  3CCQ Z;  3CCJ Z;  2QEX Z;  3OW2 Z;  3S15 I;  4MD8 A;  4NBG A;  1DL6 A;  4NOZ A;  4BBS I;  3LUS A;  3PO3 S;  4A3L I;  1NP6 A;  2DE7 A;  2K3R A;  4CL1 A;  2G2K A;  3S2D I;  3VMI A;  5C4X I;  3GTM I;  2IV2 X;  4DGL A;  2E7Z A;  3CCU 1;  1VQ7 Z;  3S2H I;  2E2J I;  1K9M 1;  3CCJ 1;  1KQS Z;  4BY1 I;  2JNY A;  1WII A;  2J6A A;  4E32 A;  2OOY B;  2HU9 A;  1QVF Z;  1Y1V S;  1NJI 2;  1S72 Z;  3KIF A;  1Y1W I;  1TWF I;  2M48 A;  3I55 1;  2F4O A;  2RBL A;  3NFZ A;  5IT9 b;  3KIH A;  3J80 f;  1I6H I;  2V8I A;  3NDI A;  3JAM b;  1NUI A;  1Q81 2;  1SFO I;  2VUM I;  5D1O B;  4BBR I;  3MZK B;  1X3W A;  1VQO 1;  3MON A;  3RZD I;  2R7Z I;  3M4O I;  2PK7 A;  4A3K I;  5AN9 F;  2IZ3 A;  1W2B Z;  3CC4 1;  4MD7 A;  1QVG Y;  2QLV B;  1K73 1;  4A3C I;  3H3V J;  5A2Q b;  3CQZ I;  3CCM 1;  1K83 I;  3HOY I;  3S17 I;  3G71 1;  3S14 I;  1USP A;  2QRD B;  1Z02 A;  3I56 Z;  2P3Y A;  2GU2 A;  3T4N B;  2W04 A;  3TDH B;  3G6E Z;  1FDI A;  1YI2 1;  3HOU I;  3VB9 A;  2O4H A;  2NAP A;  1YJN Z;  3CPW Z;  2K5R A;  3EED A;  5D1P A;  1YIJ Z;  1VQ8 Z;  2OZK A;  3I56 1;  2OTL Z;  3CCR 1;  3BG1 B;  1WZN A;  1M1K 1;  1M90 1;  1ZB8 A;  1QYP A;  1I3Q I;  1YJN 1;  2JA8 I;  1RLY A;  1YIJ 1;  1VQ8 1;  3GTL I;  4A93 I;  2W03 A;  3NH4 A;  4RVD A;  1YHQ 1;  2I3C A;  1ML8 A;  2WB1 A;  2V8K A;  3CCL Z;  5C4J I;  1VQK 1;  2M6N A;  2VPW A;  3CXC Z;  4A3D I;  4TNU A;  3S1Q I;  2E2H I;  3G4S 1;  2BJO A;  2YAD A;  3NH8 A;  2AYD A;  5C44 I;  3FQM A;  3CCL 1;  3I55 Z;  2WAQ A;  3HOW I;  4MD9 A;  2OOX B;  2KPI A;  3RZO I;  1RO4 A;  3GTJ I;  2LIY A;  2JMO A;  2PM9 A;  3H0G I;  2JIO A;  2JA5 I;  4DQY B;  3NH5 A;  1VQO Z;  4E31 A;  2NVY I;  2NVX I;  1KQS Y;  2JR6 A;  1RNI A;  4MH4 A;  3J80 b;  3D6W A;  2JIP A;  1VQ9 1;  1VQN 1;  3CC4 Z;  2EGT A;  4E2W A;  5CM2 M;  3S1N I;  3VTN A;  1RO0 A;  1Y1V I;  1K8A 1;  3D9X A;  4HGY A;  5IT9 f;  3GTK I;  3CCM Z;  4RVF A;  3S1R I;  3PO2 I;  3G71 Z;  3F3F C;  2VPZ A;  4A3I I;  4HGZ A;  3JAM f;  1VQ4 Z;  1K9M 2;  2H85 A;  4MON A;  1AA6 A;  3IR7 A;  1Q82 1;  1TWH I;  2R6M A;  3HOZ I;  3NDJ A;  1YI2 Z;  1Z03 A;  4MRI A;  1KC8 1;  4E33 A; 
#chains in the Genus database with same CATH homology
 3MZL B;  3CD6 1;  3GTP I;  1JJ2 Y;  1VQ4 1;  2RT9 A;  4NFR A;  3CCR Z;  1I50 I;  1RO2 A;  4Y7N I;  3GKQ A;  2R92 I;  4A3M I;  1L1O C;  4NH1 C;  4Y52 I;  3IFU A;  3S1M I;  1TWC I;  5IP7 I;  1VQP 1;  1VQM Z;  3I4N I;  1N8R 1;  3GTQ I;  3VMH A;  2OTJ Z;  3IF8 A;  3GCF A;  1WCM I;  1YJW 1;  3CMA 1;  1YHQ Z;  5T64 A;  4RVH A;  4E2Z A;  2JA7 I;  3CPW Y;  3J81 f;  1VQK Z;  1VQM 1;  3CCS 1;  1K73 2;  4A3J I;  2GTI A;  2QRC B;  2QRE B;  1KC8 2;  1KRL A;  3G4S Z;  2OTJ 1;  4NBF A;  1TWA I;  4NB9 A;  1VQ6 1;  3J7A 4;  2QKD A;  2Q51 A;  2R93 I;  4RS4 A;  5C3E I;  3CC2 1;  4NBA A;  2AKL A;  1X0T A;  2DE6 A;  1JWH C;  3QWU A;  5D1O A;  2Q4Z A;  1VQ5 Z;  2VF1 A;  1YIT Z;  1NJI 1;  3VMG A;  4NB8 A;  1USP B;  1M1K 2;  1M90 2;  5FLX f;  3GTM S;  3CXC Y;  2KI7 B;  4E30 A;  4DK1 A;  3OW2 Y;  1VQ5 1;  1WW9 A;  2RIQ A;  1Q81 1;  3GTO I;  3CME 1;  1YIT 1;  1VQ9 Z;  1VQN Z;  3CCE 1;  3FQQ A;  4E2Y A;  3GTG I;  4NBC A;  5T6B A;  1TWG I;  2ZAE B;  3PO3 I;  2YU9 I;  1QVF Y;  3CCQ 1;  3I07 A;  1N2F A;  1P9N A;  4NBB A;  2QEX 1;  3Q87 A;  2JS4 A;  2LFU A;  1ZH1 A;  4QTT A;  1KD1 1;  3U50 C;  2E9H A;  1VQ7 1;  3CD6 Z;  2RPR A;  4RV9 A;  3CC7 Z;  4NBE A;  3EER A;  1PFT A;  1S72 1;  3K7A I;  1VQP Z;  2VUG A;  1QVG Z;  3M3Y I;  4A3B I;  1W2B Y;  4E2X A;  3CC7 1;  2V8J A;  3FKI I;  3HOX I;  3HOV I;  1JJ2 Z;  1YJW Z;  3CMA Z;  3P5J B;  2F4M A;  1ZB9 A;  2DE5 A;  1Q7Y 1;  2NVQ I;  1X3Z A;  5A2Q f;  3CCS Z;  1K8A 2;  5T67 A;  1R9T I;  1KD1 2;  2NVT I;  2HF1 A;  5IP9 I;  1RQF A;  1VQL Z;  3I4M I;  1Q86 1;  2P28 A;  1YUK A;  2O53 A;  4EWC A;  4S1T A;  4QTU A;  1TFI A;  4XX2 A;  1VQ6 Z;  2QR1 B;  4A3G I;  1Q82 2;  1YJ9 Z;  1YUA A;  3J81 b;  3CC2 Z;  4AYB A;  2JA6 I;  4BY7 I;  1VQL 1;  3BG0 B;  4NBD A;  2E2I I;  1VLA A;  2IZ4 A;  1S7M A;  2GTH A;  4BXX I;  3IX0 A;  2Y0S A;  3F3P C;  4A3E I;  1YJ9 1;  1QF8 A;  3G6E 1;  2PMZ A;  1Z01 A;  4MXU A;  4NBH A;  5FLM I;  1Q7Y 2;  3CCV Z;  2JUB A;  1N8R 2;  2QA4 Z;  2RHB A;  3ESW A;  2OTL 1;  1Q86 2;  3CME Z;  1LQL A;  3S16 I;  4RVG A;  3CCE Z;  4A3F I;  4HH4 A;  5FLX b;  3TE5 B;  3CCV 1;  5LL6 f;  2QA4 1;  4X6A I;  3HKZ A;  3CCU Z;  2B63 I;  3CCQ Z;  3CCJ Z;  2QEX Z;  3OW2 Z;  3S15 I;  4MD8 A;  4NBG A;  1DL6 A;  4NOZ A;  4BBS I;  3LUS A;  3PO3 S;  4A3L I;  1NP6 A;  2DE7 A;  2K3R A;  4CL1 A;  2G2K A;  3S2D I;  3VMI A;  5C4X I;  3GTM I;  4DGL A;  3CCU 1;  1VQ7 Z;  3S2H I;  2E2J I;  1K9M 1;  3CCJ 1;  1KQS Z;  4BY1 I;  2JNY A;  1WII A;  2J6A A;  4E32 A;  2OOY B;  2HU9 A;  1QVF Z;  1Y1V S;  1NJI 2;  1S72 Z;  3KIF A;  1Y1W I;  1TWF I;  2M48 A;  3I55 1;  2F4O A;  2RBL A;  3NFZ A;  5IT9 b;  3KIH A;  3J80 f;  1I6H I;  2V8I A;  3NDI A;  3JAM b;  1NUI A;  1Q81 2;  1SFO I;  2VUM I;  5D1O B;  4BBR I;  3MZK B;  1X3W A;  1VQO 1;  3MON A;  3RZD I;  2R7Z I;  3M4O I;  2PK7 A;  4A3K I;  5AN9 F;  2IZ3 A;  1W2B Z;  3CC4 1;  4MD7 A;  1QVG Y;  2QLV B;  1K73 1;  4A3C I;  3H3V J;  5A2Q b;  3CQZ I;  3CCM 1;  1K83 I;  3HOY I;  3S17 I;  3G71 1;  3S14 I;  1USP A;  2QRD B;  1Z02 A;  3I56 Z;  2P3Y A;  2GU2 A;  3T4N B;  2W04 A;  3TDH B;  3G6E Z;  1YI2 1;  3HOU I;  3VB9 A;  2O4H A;  1YJN Z;  3CPW Z;  2K5R A;  3EED A;  5D1P A;  1YIJ Z;  1VQ8 Z;  2OZK A;  3I56 1;  2OTL Z;  3CCR 1;  3BG1 B;  1M1K 1;  1M90 1;  1ZB8 A;  1QYP A;  1I3Q I;  1YJN 1;  2JA8 I;  1RLY A;  1YIJ 1;  1VQ8 1;  3GTL I;  4A93 I;  2W03 A;  3NH4 A;  4RVD A;  1YHQ 1;  2I3C A;  1ML8 A;  2WB1 A;  2V8K A;  3CCL Z;  5C4J I;  1VQK 1;  2M6N A;  3CXC Z;  4A3D I;  4TNU A;  3S1Q I;  2E2H I;  3G4S 1;  2BJO A;  2YAD A;  3NH8 A;  5C44 I;  3FQM A;  3CCL 1;  3I55 Z;  2WAQ A;  3HOW I;  4MD9 A;  2OOX B;  2KPI A;  3RZO I;  1RO4 A;  3GTJ I;  2LIY A;  2JMO A;  2PM9 A;  3H0G I;  2JA5 I;  4DQY B;  3NH5 A;  1VQO Z;  4E31 A;  2NVY I;  2NVX I;  1KQS Y;  2JR6 A;  1RNI A;  4MH4 A;  3J80 b;  3D6W A;  1VQ9 1;  1VQN 1;  3CC4 Z;  2EGT A;  4E2W A;  5CM2 M;  3S1N I;  3VTN A;  1RO0 A;  1Y1V I;  1K8A 1;  3D9X A;  4HGY A;  5IT9 f;  3GTK I;  3CCM Z;  4RVF A;  3S1R I;  3PO2 I;  3G71 Z;  3F3F C;  4A3I I;  4HGZ A;  3JAM f;  1VQ4 Z;  1K9M 2;  2H85 A;  4MON A;  1Q82 1;  1TWH I;  2R6M A;  3HOZ I;  3NDJ A;  1YI2 Z;  1Z03 A;  4MRI A;  1KC8 1;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...