1R9TI

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1r9tI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1r9tI02
5C4XI 4NBFA 3U50C 2NVTI 2JA6I 4NBDA 2P3YA 4QTUA 2HF1A 3VMIA 3PO3I 3GTMS 3HOVI 3GTLI 3S1NI 4NBEA 2F4MA 2DE7A 4Y52I 3HOWI 4A3II 2R92I 4A3BI 2R7ZI 1Y1VS 2KPIA 2JNYA 4BXXI 4NOZA 3GTOI 1Y1WI 4BBSI 3S1QI 4NBGA 1LQLA 4X6AI 5C3EI 4A3DI 1TFIA 2VUMI 3I4NI 4A3CI 4NBBA 3S1RI 3H3VJ 2E2HI 2F4OA 3VMGA 4MH4A 4A93I 5C4JI 3S2DI 4A3MI 3GTMI 3VB9A 1N2FA 2NVXI 3Q87A 3GTJI 5CM2M 5FLMI 1I3QI 2JR6A 1Y1VI 2K5RA 1QYPA 4XX2A 1X3ZA 2NVQI 2R93I 2JA8I 3HOXI 4NBAA 2DE5A 3ESWA 1PFTA 1I50I 3RZOI 1TWHI 1I6HI 4BBRI 3PO2I 4A3GI 2E2JI 1WCMI 5C44I 1TWFI 2PK7A 1USPA 3S14I 1ZB8A 3VMHA 4A3FI 2B63I 3S17I 5IP9I 3K7AI 3GTKI 1RLYA 1ZB9A 4NB9A 4NB8A 1WW9A 4BY1I 4A3JI 3S15I 4NBCA 1ML8A 1USPB 1VLAA 2JS4A 3GTQI 1R9TI 4QTTA 2JA7I 1K83I 2JA5I 4Y7NI 2DE6A 1TWCI 1RO4A 3HOZI 3S16I 3LUSA 3I4MI 1TWGI 2AKLA 3H0GI 3M4OI 3PO3S 1TWAI 3M3YI 3D6WA 3HOYI 1NUIA 2NVYI 3GKQA 4BY7I 2YU9I 3FKII 5IP7I 4A3EI 3S1MI 3I07A 2BJOA 1DL6A 4A3KI 3S2HI 3CQZI 4NBHA 1X3WA 2RBLA 1YUAA 3EERA 1L1OC 3GTPI 3RZDI 3HOUI 3GCFA 4A3LI 1SFOI 2E2II 2J6AA 3GTGI
chains in the Genus database with same CATH superfamily
5C4XI 4NBFA 2NVTI 2JA6I 5D1OB 4QTUA 2WAQA 1VQL1 4RS4A 3NFZA 4HH4A 1RNIA 2DE7A 2F4MA 3HOWI 2R92I 1VQMZ 3CCJ1 2JNYA 4RVHA 1VQO1 4BXXI 2QRCB 3T4NB 2JIMA 3NH8A 2G2KA 2QEX1 1M1K2 3S1QI 5C3EI 4A3DI 2VUMI 4A3CI 2OOXB 3S1RI 1W2BY 3J81b 4MONA 1WIIA 5C4JI 1N8R2 3GTMI 1NJI1 1N2FA 5T67A 3GTJI 2OTJ1 5CM2M 3IFUA 3KIFA 2JR6A 2OTL1 2V8KA 3CXCZ 3CC41 2K5RA 1QYPA 1QVGZ 1YIT1 1X3ZA 2JA8I 3CCS1 3HKZA 1K731 1Z01A 4DGLA 1Q811 4NBAA 3ESWA 1VQP1 1QVFZ 1JJ2Z 1VQ9Z 2PK7A 1USPA 3IR7A 3CCQ1 1YJW1 3VMHA 3G6EZ 2B63I 2V8JA 3S17I 2YADA 4AYBA 4DK1A 3CCU1 4RVFA 3K7AI 4NB9A 1WW9A 1VQ71 1YI2Z 3S15I 1YIJ1 4QTTA 3I561 2QA41 1K83I 4E2XA 4Y7NI 1Q812 3S16I 4NFRA 3M4OI 3PO3S 1TWAI 1YHQ1 3CCR1 1VQ4Z 3GKQA 5A2Qf 2IV2X 5IP7I 2QR1B 3BG0B 3CQZI 2RBLA 1KD11 1VQNZ 3HOUI 3CME1 2Q51A 3CD61 1AA6A 1VQ51 2E2II 4DQYB 2WB1A 2J6AA 1YJN1 1KC82 1VQ81 4NBDA 3F3PC 1YUKA 1KQSY 1Z02A 5D1PA 2RHBA 3BG1B 4A3II 1K9M2 2H85A 5IT9b 4NOZA 1LQLA 1TFIA 2V8IA 1RQFA 4E32A 4E30A 4E31A 3VMGA 2QKDA 1K8A1 2JIRA 3CCMZ 3S2DI 2JIPA 3G4SZ 1YJ9Z 2ZAEB 3CMA1 1VQKZ 2I3CA 2W04A 2GTHA 3CPWY 3G71Z 1Y1VI 1Q861 2VPZA 2JIQA 4XX2A 1Q821 2NVQI 1WZNA 5AN9F 1I50I 3RZOI 1WCMI 1VQ6Z 1TWFI 1Q7Y2 1K8A2 1FDIA 1ZB8A 2GTIA 1KRLA 1VQM1 3CCL1 3CCV1 2QREB 4MXUA 1RLYA 1ZB9A 2V45A 4RVGA 1NP6A 4A3JI 4NBCA 2VPXA 1ML8A 2JS4A 2OZKA 2OTLZ 2M48A 2LEXA 2JIOA 2JA5I 1YITZ 1TWCI 1RO4A 3HOZI 4S1TA 1TWGI 2PM9A 4E2YA 1M901 3CC2Z 3HOYI 4MRIA 2YU9I 3I551 4E2ZA 3EEDA 1NJI2 3VTNA 2BJOA 1DL6A 5D1OA 3CC71 3JAMf 3CCUZ 1YUAA 3EERA 1L1OC 3MONA 3GTPI 2K3RA 2M6NA 3GCFA 2E7ZA 3IX0A 1YIJZ 1K732 2RIQA 3U50C 3G6E1 2QA4Z 2P3YA 1W2BZ 3GTMS 3HOVI 1Z03A 2NAPA 3CCRZ 5LL6f 1YI21 1ZH1A 2R7ZI 2KPIA 3CCEZ 3GTOI 2JMOA 4CL1A 4BBSI 2HU9A 4X6AI 3CMEZ 3D2LA 4NBBA 3H3VJ 4HGZA 1VQ5Z 2QRDB 4MH4A 1FDOA 4A3MI 3J80b 5FLXf 3Q87A 1P9NA 1VQN1 1I3QI 2VPWA 1S72Z 1KD12 2R93I 1RO0A 4TNUA 3HOXI 4A3GI 1I6HI 3PO2I 5C44I 3NH4A 2IZ3A 2RT9A 3S14I 5T64A 4E33A 1VQLZ 2E9HA 3J81f 3CXCY 1QVGY 3CMAZ 4NB8A 4BY1I 1M1K1 1USPB 1VLAA 1QVFY 3CCJZ 1JJ2Y 2EGTA 1VQOZ 3QWUA 3CCM1 1QXFA 3G4S1 1YJ91 2QEXZ 3I4MI 1N8R1 1VQK1 2AKLA 2OOYB 3M3YI 2W03A 3J7A4 2VF1A 3G711 5T6BA 1KQSZ 3S1MI 3S2HI 4NBHA 3OW2Z 2R6MA 4MD7A 3CCLZ 3CCVZ 2OTJZ 2Q4ZA 1Q862 3D9XA 4A3LI 1Q822 4NH1C 1VQ61 3CC4Z 3GTGI 3CCSZ 4HGYA 2HF1A 3VMIA 3PO3I 1VQPZ 3GTLI 3S1NI 4NBEA 1JWHC 1Y8CA 3CCQZ 2O4HA 1YJWZ 4Y52I 2GU2A 4A3BI 3I55Z 1Y1VS 1S7MA 3CC7Z 2O53A 3CPWZ 1Y1WI 4NBGA 4RV9A 1VQ7Z 1VQ91 3I4NI 2IZ4A 3CC21 2E2HI 1RO2A 2F4OA 3I56Z 4A93I 2LFUA 3MZKB 3VB9A 2NVXI 2PMZA 1M902 2KI7B 2Y0SA 5FLMI 1YHQZ 3NDIA 2V3VA 3NDJA 3J80f 1WJ2A 3FQQA 1Q16A 3FQMA 2RPRA 2DE5A 1PFTA 1KC81 1TWHI 5IT9f 3TE5B 4BBRI 2E2JI 3CD6Z 1VQ41 4MD9A 3JAMb 1SIWA 1YJNZ 4A3FI 1VQ8Z 4RVDA 1K9M1 3CCE1 5IP9I 3GTKI 2LIYA 2VUGA 2JUBA 3F3FC 3GTQI 1R9TI 2JA7I 3IF8A 2DE6A 3P5JB 5A2Qb 3LUSA 4E2WA 3H0GI 2P28A 4EWCA 2AYDA 3D6WA 3TDHB 3NH5A 3OW2Y 1NUIA 2NVYI 4BY7I 4MD8A 3FKII 4A3EI 3I07A 1S721 4A3KI 2QLVB 1X3WA 1QF8A 3RZDI 1SFOI 1X0TA 3MZLB 5FLXb 2VPYA 3KIHA 1Q7Y1
chains in the Genus database with same CATH topology
5C4XI 4NBFA 2NVTI 2JA6I 5D1OB 4QTUA 2WAQA 1VQL1 4RS4A 3NFZA 4HH4A 1RNIA 2DE7A 2F4MA 3HOWI 2R92I 1VQMZ 3CCJ1 2JNYA 4RVHA 1VQO1 4BXXI 2QRCB 3T4NB 3NH8A 2G2KA 2QEX1 1M1K2 3S1QI 5C3EI 4A3DI 2VUMI 4A3CI 2OOXB 3S1RI 1W2BY 3J81b 4MONA 1WIIA 5C4JI 1N8R2 3GTMI 1NJI1 1N2FA 5T67A 3GTJI 2OTJ1 5CM2M 3IFUA 3KIFA 2JR6A 2OTL1 2V8KA 3CXCZ 3CC41 2K5RA 1QYPA 1QVGZ 1YIT1 1X3ZA 2JA8I 3CCS1 3HKZA 1K731 1Z01A 4DGLA 1Q811 4NBAA 3ESWA 1VQP1 1QVFZ 1JJ2Z 1VQ9Z 2PK7A 1USPA 3CCQ1 1YJW1 3VMHA 3G6EZ 2B63I 2V8JA 3S17I 2YADA 4AYBA 4DK1A 3CCU1 4RVFA 3K7AI 4NB9A 1WW9A 1VQ71 1YI2Z 3S15I 1YIJ1 4QTTA 3I561 1K83I 2QA41 4E2XA 4Y7NI 1Q812 3S16I 4NFRA 3M4OI 3PO3S 1TWAI 1YHQ1 3CCR1 1VQ4Z 3GKQA 5A2Qf 5IP7I 2QR1B 3BG0B 3CQZI 2RBLA 1KD11 1VQNZ 3HOUI 3CME1 2Q51A 3CD61 1VQ51 2E2II 4DQYB 2WB1A 2J6AA 1YJN1 1KC82 1VQ81 4NBDA 3F3PC 1YUKA 1KQSY 1Z02A 5D1PA 2RHBA 3BG1B 4A3II 1K9M2 2H85A 5IT9b 4NOZA 1LQLA 1TFIA 2V8IA 1RQFA 4E32A 4E30A 4E31A 3VMGA 2QKDA 1K8A1 3CCMZ 3S2DI 3G4SZ 1YJ9Z 2ZAEB 3CMA1 1VQKZ 2I3CA 2W04A 2GTHA 3CPWY 3G71Z 1Y1VI 1Q861 4XX2A 1Q821 2NVQI 5AN9F 1I50I 3RZOI 1WCMI 1VQ6Z 1TWFI 1Q7Y2 1K8A2 1ZB8A 2GTIA 1KRLA 1VQM1 3CCL1 3CCV1 2QREB 4MXUA 1RLYA 1ZB9A 4RVGA 1NP6A 4A3JI 4NBCA 1ML8A 2JS4A 2OZKA 2OTLZ 2M48A 2JA5I 1YITZ 1TWCI 1RO4A 3HOZI 4S1TA 1TWGI 2PM9A 4E2YA 1M901 3CC2Z 3HOYI 4MRIA 2YU9I 3I551 4E2ZA 3EEDA 1NJI2 3VTNA 2BJOA 1DL6A 5D1OA 3CC71 3JAMf 3CCUZ 1YUAA 3EERA 1L1OC 3MONA 3GTPI 2K3RA 2M6NA 3GCFA 3IX0A 1YIJZ 1K732 2RIQA 3U50C 3G6E1 2QA4Z 2P3YA 1W2BZ 3GTMS 3HOVI 1Z03A 3CCRZ 5LL6f 1YI21 1ZH1A 2R7ZI 2KPIA 3CCEZ 3GTOI 2JMOA 4CL1A 4BBSI 2HU9A 4X6AI 4NBBA 3CMEZ 3H3VJ 4HGZA 1VQ5Z 2QRDB 4MH4A 4A3MI 3J80b 5FLXf 3Q87A 1P9NA 1VQN1 1I3QI 1S72Z 1KD12 2R93I 1RO0A 4TNUA 3HOXI 4A3GI 1I6HI 3PO2I 5C44I 3NH4A 2IZ3A 2RT9A 3S14I 5T64A 4E33A 1VQLZ 2E9HA 3J81f 3CXCY 1QVGY 3CMAZ 4NB8A 4BY1I 1M1K1 1USPB 1VLAA 1QVFY 3CCJZ 1JJ2Y 2EGTA 1VQOZ 3QWUA 3CCM1 3G4S1 1YJ91 2QEXZ 3I4MI 1N8R1 1VQK1 2AKLA 2OOYB 3M3YI 2W03A 3J7A4 2VF1A 3G711 5T6BA 1KQSZ 3S1MI 3S2HI 4NBHA 3OW2Z 2R6MA 4MD7A 3CCLZ 3CCVZ 2OTJZ 2Q4ZA 1Q862 3D9XA 4A3LI 1Q822 4NH1C 1VQ61 3CC4Z 3GTGI 3CCSZ 4HGYA 2HF1A 3VMIA 3PO3I 1VQPZ 3GTLI 3S1NI 4NBEA 1JWHC 3CCQZ 2O4HA 1YJWZ 4Y52I 2GU2A 4A3BI 3I55Z 1Y1VS 1S7MA 3CC7Z 2O53A 3CPWZ 1Y1WI 4NBGA 4RV9A 1VQ7Z 1VQ91 3I4NI 2IZ4A 3CC21 2E2HI 1RO2A 2F4OA 3I56Z 4A93I 2LFUA 3MZKB 3VB9A 2NVXI 2PMZA 1M902 2KI7B 2Y0SA 5FLMI 1YHQZ 3NDIA 3NDJA 3J80f 3FQQA 3FQMA 2RPRA 2DE5A 1PFTA 1KC81 1TWHI 5IT9f 3TE5B 4BBRI 2E2JI 3CD6Z 1VQ41 4MD9A 3JAMb 1YJNZ 4A3FI 1VQ8Z 4RVDA 1K9M1 3CCE1 5IP9I 3GTKI 2LIYA 2VUGA 2JUBA 3F3FC 3GTQI 1R9TI 2JA7I 3IF8A 2DE6A 3P5JB 5A2Qb 3LUSA 4E2WA 3H0GI 2P28A 4EWCA 3D6WA 3TDHB 3NH5A 3OW2Y 1NUIA 2NVYI 4BY7I 4MD8A 3FKII 4A3EI 3I07A 1S721 4A3KI 2QLVB 1X3WA 1QF8A 3RZDI 1SFOI 1X0TA 3MZLB 5FLXb 3KIHA 1Q7Y1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X I;  4NBF A;  3U50 C;  2NVT I;  2JA6 I;  4NBD A;  2P3Y A;  4QTU A;  2HF1 A;  3VMI A;  3PO3 I;  3GTM S;  3HOV I;  3GTL I;  3S1N I;  4NBE A;  2F4M A;  2DE7 A;  4Y52 I;  3HOW I;  4A3I I;  2R92 I;  4A3B I;  2R7Z I;  1Y1V S;  2KPI A;  2JNY A;  4BXX I;  4NOZ A;  3GTO I;  1Y1W I;  4BBS I;  3S1Q I;  4NBG A;  1LQL A;  4X6A I;  5C3E I;  4A3D I;  1TFI A;  2VUM I;  3I4N I;  4A3C I;  4NBB A;  3S1R I;  3H3V J;  2E2H I;  2F4O A;  3VMG A;  4MH4 A;  4A93 I;  5C4J I;  3S2D I;  4A3M I;  3GTM I;  3VB9 A;  1N2F A;  2NVX I;  3Q87 A;  3GTJ I;  5CM2 M;  5FLM I;  1I3Q I;  2JR6 A;  1Y1V I;  2K5R A;  1QYP A;  4XX2 A;  1X3Z A;  2NVQ I;  2R93 I;  2JA8 I;  3HOX I;  4NBA A;  2DE5 A;  3ESW A;  1PFT A;  1I50 I;  3RZO I;  1TWH I;  1I6H I;  4BBR I;  3PO2 I;  4A3G I;  2E2J I;  1WCM I;  5C44 I;  1TWF I;  2PK7 A;  1USP A;  3S14 I;  1ZB8 A;  3VMH A;  4A3F I;  2B63 I;  3S17 I;  5IP9 I;  3K7A I;  3GTK I;  1RLY A;  1ZB9 A;  4NB9 A;  4NB8 A;  1WW9 A;  4BY1 I;  4A3J I;  3S15 I;  4NBC A;  1ML8 A;  1USP B;  1VLA A;  2JS4 A;  3GTQ I;  1R9T I;  4QTT A;  2JA7 I;  1K83 I;  2JA5 I;  4Y7N I;  2DE6 A;  1TWC I;  1RO4 A;  3HOZ I;  3S16 I;  3LUS A;  3I4M I;  1TWG I;  2AKL A;  3H0G I;  3M4O I;  3PO3 S;  1TWA I;  3M3Y I;  3D6W A;  3HOY I;  1NUI A;  2NVY I;  3GKQ A;  4BY7 I;  2YU9 I;  3FKI I;  5IP7 I;  4A3E I;  3S1M I;  3I07 A;  2BJO A;  1DL6 A;  4A3K I;  3S2H I;  3CQZ I;  4NBH A;  1X3W A;  2RBL A;  1YUA A;  3EER A;  1L1O C;  3GTP I;  3RZD I;  3HOU I;  3GCF A;  4A3L I;  1SFO I;  2E2I I;  2J6A A;  3GTG I; 
#chains in the Genus database with same CATH topology
 5C4X I;  4NBF A;  2NVT I;  2JA6 I;  5D1O B;  4QTU A;  2WAQ A;  1VQL 1;  4RS4 A;  3NFZ A;  4HH4 A;  1RNI A;  2DE7 A;  2F4M A;  3HOW I;  2R92 I;  1VQM Z;  3CCJ 1;  2JNY A;  4RVH A;  1VQO 1;  4BXX I;  2QRC B;  3T4N B;  2JIM A;  3NH8 A;  2G2K A;  2QEX 1;  1M1K 2;  3S1Q I;  5C3E I;  4A3D I;  2VUM I;  4A3C I;  2OOX B;  3S1R I;  1W2B Y;  3J81 b;  4MON A;  1WII A;  5C4J I;  1N8R 2;  3GTM I;  1NJI 1;  1N2F A;  5T67 A;  3GTJ I;  2OTJ 1;  5CM2 M;  3IFU A;  3KIF A;  2JR6 A;  2OTL 1;  2V8K A;  3CXC Z;  3CC4 1;  2K5R A;  1QYP A;  1QVG Z;  1YIT 1;  1X3Z A;  2JA8 I;  3CCS 1;  3HKZ A;  1K73 1;  1Z01 A;  4DGL A;  1Q81 1;  4NBA A;  3ESW A;  1VQP 1;  1QVF Z;  1JJ2 Z;  1VQ9 Z;  2PK7 A;  1USP A;  3IR7 A;  3CCQ 1;  1YJW 1;  3VMH A;  3G6E Z;  2B63 I;  2V8J A;  3S17 I;  2YAD A;  4AYB A;  4DK1 A;  3CCU 1;  4RVF A;  3K7A I;  4NB9 A;  1WW9 A;  1VQ7 1;  1YI2 Z;  3S15 I;  1YIJ 1;  4QTT A;  3I56 1;  2QA4 1;  1K83 I;  4E2X A;  4Y7N I;  1Q81 2;  3S16 I;  4NFR A;  3M4O I;  3PO3 S;  1TWA I;  1YHQ 1;  3CCR 1;  1VQ4 Z;  3GKQ A;  5A2Q f;  2IV2 X;  5IP7 I;  2QR1 B;  3BG0 B;  3CQZ I;  2RBL A;  1KD1 1;  1VQN Z;  3HOU I;  3CME 1;  2Q51 A;  3CD6 1;  1AA6 A;  1VQ5 1;  2E2I I;  4DQY B;  2WB1 A;  2J6A A;  1YJN 1;  1KC8 2;  1VQ8 1;  4NBD A;  3F3P C;  1YUK A;  1KQS Y;  1Z02 A;  5D1P A;  2RHB A;  3BG1 B;  4A3I I;  1K9M 2;  2H85 A;  5IT9 b;  4NOZ A;  1LQL A;  1TFI A;  2V8I A;  1RQF A;  4E32 A;  4E30 A;  4E31 A;  3VMG A;  2QKD A;  1K8A 1;  2JIR A;  3CCM Z;  3S2D I;  2JIP A;  3G4S Z;  1YJ9 Z;  2ZAE B;  3CMA 1;  1VQK Z;  2I3C A;  2W04 A;  2GTH A;  3CPW Y;  3G71 Z;  1Y1V I;  1Q86 1;  2VPZ A;  2JIQ A;  4XX2 A;  1Q82 1;  2NVQ I;  1WZN A;  5AN9 F;  1I50 I;  3RZO I;  1WCM I;  1VQ6 Z;  1TWF I;  1Q7Y 2;  1K8A 2;  1FDI A;  1ZB8 A;  2GTI A;  1KRL A;  1VQM 1;  3CCL 1;  3CCV 1;  2QRE B;  4MXU A;  1RLY A;  1ZB9 A;  2V45 A;  4RVG A;  1NP6 A;  4A3J I;  4NBC A;  2VPX A;  1ML8 A;  2JS4 A;  2OZK A;  2OTL Z;  2M48 A;  2LEX A;  2JIO A;  2JA5 I;  1YIT Z;  1TWC I;  1RO4 A;  3HOZ I;  4S1T A;  1TWG I;  2PM9 A;  4E2Y A;  1M90 1;  3CC2 Z;  3HOY I;  4MRI A;  2YU9 I;  3I55 1;  4E2Z A;  3EED A;  1NJI 2;  3VTN A;  2BJO A;  1DL6 A;  5D1O A;  3CC7 1;  3JAM f;  3CCU Z;  1YUA A;  3EER A;  1L1O C;  3MON A;  3GTP I;  2K3R A;  2M6N A;  3GCF A;  2E7Z A;  3IX0 A;  1YIJ Z;  1K73 2;  2RIQ A;  3U50 C;  3G6E 1;  2QA4 Z;  2P3Y A;  1W2B Z;  3GTM S;  3HOV I;  1Z03 A;  2NAP A;  3CCR Z;  5LL6 f;  1YI2 1;  1ZH1 A;  2R7Z I;  2KPI A;  3CCE Z;  3GTO I;  2JMO A;  4CL1 A;  4BBS I;  2HU9 A;  4X6A I;  3CME Z;  3D2L A;  4NBB A;  3H3V J;  4HGZ A;  1VQ5 Z;  2QRD B;  4MH4 A;  1FDO A;  4A3M I;  3J80 b;  5FLX f;  3Q87 A;  1P9N A;  1VQN 1;  1I3Q I;  2VPW A;  1S72 Z;  1KD1 2;  2R93 I;  1RO0 A;  4TNU A;  3HOX I;  4A3G I;  1I6H I;  3PO2 I;  5C44 I;  3NH4 A;  2IZ3 A;  2RT9 A;  3S14 I;  5T64 A;  4E33 A;  1VQL Z;  2E9H A;  3J81 f;  3CXC Y;  1QVG Y;  3CMA Z;  4NB8 A;  4BY1 I;  1M1K 1;  1USP B;  1VLA A;  1QVF Y;  3CCJ Z;  1JJ2 Y;  2EGT A;  1VQO Z;  3QWU A;  3CCM 1;  1QXF A;  3G4S 1;  1YJ9 1;  2QEX Z;  3I4M I;  1N8R 1;  1VQK 1;  2AKL A;  2OOY B;  3M3Y I;  2W03 A;  3J7A 4;  2VF1 A;  3G71 1;  5T6B A;  1KQS Z;  3S1M I;  3S2H I;  4NBH A;  3OW2 Z;  2R6M A;  4MD7 A;  3CCL Z;  3CCV Z;  2OTJ Z;  2Q4Z A;  1Q86 2;  3D9X A;  4A3L I;  1Q82 2;  4NH1 C;  1VQ6 1;  3CC4 Z;  3GTG I;  3CCS Z;  4HGY A;  2HF1 A;  3VMI A;  3PO3 I;  1VQP Z;  3GTL I;  3S1N I;  4NBE A;  1JWH C;  1Y8C A;  3CCQ Z;  2O4H A;  1YJW Z;  4Y52 I;  2GU2 A;  4A3B I;  3I55 Z;  1Y1V S;  1S7M A;  3CC7 Z;  2O53 A;  3CPW Z;  1Y1W I;  4NBG A;  4RV9 A;  1VQ7 Z;  1VQ9 1;  3I4N I;  2IZ4 A;  3CC2 1;  2E2H I;  1RO2 A;  2F4O A;  3I56 Z;  4A93 I;  2LFU A;  3MZK B;  3VB9 A;  2NVX I;  2PMZ A;  1M90 2;  2KI7 B;  2Y0S A;  5FLM I;  1YHQ Z;  3NDI A;  2V3V A;  3NDJ A;  3J80 f;  1WJ2 A;  3FQQ A;  1Q16 A;  3FQM A;  2RPR A;  2DE5 A;  1PFT A;  1KC8 1;  1TWH I;  5IT9 f;  3TE5 B;  4BBR I;  2E2J I;  3CD6 Z;  1VQ4 1;  4MD9 A;  3JAM b;  1SIW A;  1YJN Z;  4A3F I;  1VQ8 Z;  4RVD A;  1K9M 1;  3CCE 1;  5IP9 I;  3GTK I;  2LIY A;  2VUG A;  2JUB A;  3F3F C;  3GTQ I;  1R9T I;  2JA7 I;  3IF8 A;  2DE6 A;  3P5J B;  5A2Q b;  3LUS A;  4E2W A;  3H0G I;  2P28 A;  4EWC A;  2AYD A;  3D6W A;  3TDH B;  3NH5 A;  3OW2 Y;  1NUI A;  2NVY I;  4BY7 I;  4MD8 A;  3FKI I;  4A3E I;  3I07 A;  1S72 1;  4A3K I;  2QLV B;  1X3W A;  1QF8 A;  3RZD I;  1SFO I;  1X0T A;  3MZL B;  5FLX b;  2VPY A;  3KIH A;  1Q7Y 1; 
#chains in the Genus database with same CATH homology
 5C4X I;  4NBF A;  2NVT I;  2JA6 I;  5D1O B;  4QTU A;  2WAQ A;  1VQL 1;  4RS4 A;  3NFZ A;  4HH4 A;  1RNI A;  2DE7 A;  2F4M A;  3HOW I;  2R92 I;  1VQM Z;  3CCJ 1;  2JNY A;  4RVH A;  1VQO 1;  4BXX I;  2QRC B;  3T4N B;  3NH8 A;  2G2K A;  2QEX 1;  1M1K 2;  3S1Q I;  5C3E I;  4A3D I;  2VUM I;  4A3C I;  2OOX B;  3S1R I;  1W2B Y;  3J81 b;  4MON A;  1WII A;  5C4J I;  1N8R 2;  3GTM I;  1NJI 1;  1N2F A;  5T67 A;  3GTJ I;  2OTJ 1;  5CM2 M;  3IFU A;  3KIF A;  2JR6 A;  2OTL 1;  2V8K A;  3CXC Z;  3CC4 1;  2K5R A;  1QYP A;  1QVG Z;  1YIT 1;  1X3Z A;  2JA8 I;  3CCS 1;  3HKZ A;  1K73 1;  1Z01 A;  4DGL A;  1Q81 1;  4NBA A;  3ESW A;  1VQP 1;  1QVF Z;  1JJ2 Z;  1VQ9 Z;  2PK7 A;  1USP A;  3CCQ 1;  1YJW 1;  3VMH A;  3G6E Z;  2B63 I;  2V8J A;  3S17 I;  2YAD A;  4AYB A;  4DK1 A;  3CCU 1;  4RVF A;  3K7A I;  4NB9 A;  1WW9 A;  1VQ7 1;  1YI2 Z;  3S15 I;  1YIJ 1;  4QTT A;  3I56 1;  1K83 I;  2QA4 1;  4E2X A;  4Y7N I;  1Q81 2;  3S16 I;  4NFR A;  3M4O I;  3PO3 S;  1TWA I;  1YHQ 1;  3CCR 1;  1VQ4 Z;  3GKQ A;  5A2Q f;  5IP7 I;  2QR1 B;  3BG0 B;  3CQZ I;  2RBL A;  1KD1 1;  1VQN Z;  3HOU I;  3CME 1;  2Q51 A;  3CD6 1;  1VQ5 1;  2E2I I;  4DQY B;  2WB1 A;  2J6A A;  1YJN 1;  1KC8 2;  1VQ8 1;  4NBD A;  3F3P C;  1YUK A;  1KQS Y;  1Z02 A;  5D1P A;  2RHB A;  3BG1 B;  4A3I I;  1K9M 2;  2H85 A;  5IT9 b;  4NOZ A;  1LQL A;  1TFI A;  2V8I A;  1RQF A;  4E32 A;  4E30 A;  4E31 A;  3VMG A;  2QKD A;  1K8A 1;  3CCM Z;  3S2D I;  3G4S Z;  1YJ9 Z;  2ZAE B;  3CMA 1;  1VQK Z;  2I3C A;  2W04 A;  2GTH A;  3CPW Y;  3G71 Z;  1Y1V I;  1Q86 1;  4XX2 A;  1Q82 1;  2NVQ I;  5AN9 F;  1I50 I;  3RZO I;  1WCM I;  1VQ6 Z;  1TWF I;  1Q7Y 2;  1K8A 2;  1ZB8 A;  2GTI A;  1KRL A;  1VQM 1;  3CCL 1;  3CCV 1;  2QRE B;  4MXU A;  1RLY A;  1ZB9 A;  4RVG A;  1NP6 A;  4A3J I;  4NBC A;  1ML8 A;  2JS4 A;  2OZK A;  2OTL Z;  2M48 A;  2JA5 I;  1YIT Z;  1TWC I;  1RO4 A;  3HOZ I;  4S1T A;  1TWG I;  2PM9 A;  4E2Y A;  1M90 1;  3CC2 Z;  3HOY I;  4MRI A;  2YU9 I;  3I55 1;  4E2Z A;  3EED A;  1NJI 2;  3VTN A;  2BJO A;  1DL6 A;  5D1O A;  3CC7 1;  3JAM f;  3CCU Z;  1YUA A;  3EER A;  1L1O C;  3MON A;  3GTP I;  2K3R A;  2M6N A;  3GCF A;  3IX0 A;  1YIJ Z;  1K73 2;  2RIQ A;  3U50 C;  3G6E 1;  2QA4 Z;  2P3Y A;  1W2B Z;  3GTM S;  3HOV I;  1Z03 A;  3CCR Z;  5LL6 f;  1YI2 1;  1ZH1 A;  2R7Z I;  2KPI A;  3CCE Z;  3GTO I;  2JMO A;  4CL1 A;  4BBS I;  2HU9 A;  4X6A I;  4NBB A;  3CME Z;  3H3V J;  4HGZ A;  1VQ5 Z;  2QRD B;  4MH4 A;  4A3M I;  3J80 b;  5FLX f;  3Q87 A;  1P9N A;  1VQN 1;  1I3Q I;  1S72 Z;  1KD1 2;  2R93 I;  1RO0 A;  4TNU A;  3HOX I;  4A3G I;  1I6H I;  3PO2 I;  5C44 I;  3NH4 A;  2IZ3 A;  2RT9 A;  3S14 I;  5T64 A;  4E33 A;  1VQL Z;  2E9H A;  3J81 f;  3CXC Y;  1QVG Y;  3CMA Z;  4NB8 A;  4BY1 I;  1M1K 1;  1USP B;  1VLA A;  1QVF Y;  3CCJ Z;  1JJ2 Y;  2EGT A;  1VQO Z;  3QWU A;  3CCM 1;  3G4S 1;  1YJ9 1;  2QEX Z;  3I4M I;  1N8R 1;  1VQK 1;  2AKL A;  2OOY B;  3M3Y I;  2W03 A;  3J7A 4;  2VF1 A;  3G71 1;  5T6B A;  1KQS Z;  3S1M I;  3S2H I;  4NBH A;  3OW2 Z;  2R6M A;  4MD7 A;  3CCL Z;  3CCV Z;  2OTJ Z;  2Q4Z A;  1Q86 2;  3D9X A;  4A3L I;  1Q82 2;  4NH1 C;  1VQ6 1;  3CC4 Z;  3GTG I;  3CCS Z;  4HGY A;  2HF1 A;  3VMI A;  3PO3 I;  1VQP Z;  3GTL I;  3S1N I;  4NBE A;  1JWH C;  3CCQ Z;  2O4H A;  1YJW Z;  4Y52 I;  2GU2 A;  4A3B I;  3I55 Z;  1Y1V S;  1S7M A;  3CC7 Z;  2O53 A;  3CPW Z;  1Y1W I;  4NBG A;  4RV9 A;  1VQ7 Z;  1VQ9 1;  3I4N I;  2IZ4 A;  3CC2 1;  2E2H I;  1RO2 A;  2F4O A;  3I56 Z;  4A93 I;  2LFU A;  3MZK B;  3VB9 A;  2NVX I;  2PMZ A;  1M90 2;  2KI7 B;  2Y0S A;  5FLM I;  1YHQ Z;  3NDI A;  3NDJ A;  3J80 f;  3FQQ A;  3FQM A;  2RPR A;  2DE5 A;  1PFT A;  1KC8 1;  1TWH I;  5IT9 f;  3TE5 B;  4BBR I;  2E2J I;  3CD6 Z;  1VQ4 1;  4MD9 A;  3JAM b;  1YJN Z;  4A3F I;  1VQ8 Z;  4RVD A;  1K9M 1;  3CCE 1;  5IP9 I;  3GTK I;  2LIY A;  2VUG A;  2JUB A;  3F3F C;  3GTQ I;  1R9T I;  2JA7 I;  3IF8 A;  2DE6 A;  3P5J B;  5A2Q b;  3LUS A;  4E2W A;  3H0G I;  2P28 A;  4EWC A;  3D6W A;  3TDH B;  3NH5 A;  3OW2 Y;  1NUI A;  2NVY I;  4BY7 I;  4MD8 A;  3FKI I;  4A3E I;  3I07 A;  1S72 1;  4A3K I;  2QLV B;  1X3W A;  1QF8 A;  3RZD I;  1SFO I;  1X0T A;  3MZL B;  5FLX b;  3KIH A;  1Q7Y 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...