1N8R1

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r100
1JJ2Z 3CC41 3OW2Z 1VQ9Z 3CCJ1 1K732 1W2BZ 3CCR1 1KQSZ 1N8R1 3I551 2OTL1 3G711 1K731 3I56Z 1KD12 3CC21 1VQP1 3CCL1 1NJI2 3CC71 1YIT1 3CCV1 1Q822 1VQ8Z 1JJ2Y 3OW2Y 1Q7Y2 2QEX1 1W2BY 1NJI1 1KQSY 1VQ51 3CD61 1Q861 3G4S1 3CME1 3CCQ1 3CCSZ 1Q821 3CCM1 1VQ4Z 1VQKZ 1YJWZ 2QA4Z 1YIJ1 3CCUZ 2OTJZ 1VQL1 3CPWZ 1YJ9Z 1VQ91 1VQ7Z 3G6EZ 1M902 3I561 1VQMZ 1KD11 3CXCZ 3CMAZ 1K8A2 3CPWY 1Q7Y1 1VQ81 1YI2Z 1Q812 1QVGZ 3CCEZ 1YHQZ 3CCS1 1VQ41 1M1K2 1KC82 1VQK1 1VQ6Z 1YJNZ 1YJW1 1S72Z 3CXCY 2QA41 3CCU1 1M1K1 1KC81 2OTJ1 1VQOZ 1VQNZ 3CC4Z 3CCJZ 1YJ91 3CCRZ 3I55Z 2OTLZ 1QVGY 1VQ71 3G71Z 3G6E1 1M901 1QVFZ 1VQM1 3CC2Z 1VQPZ 3CCLZ 3CMA1 3CC7Z 1K8A1 1YITZ 3CCVZ 1K9M2 2QEXZ 1Q811 3CD6Z 1VQ5Z 1YI21 3G4SZ 1Q862 3CMEZ 3CCQZ 1K9M1 3CCMZ 3CCE1 1YHQ1 1QVFY 1VQ61 1YJN1 1S721 1YIJZ 1VQLZ 1N8R2 1VQO1 1VQN1
chains in the Genus database with same CATH superfamily
3OW2Z 1VQ9Z 4MD9A 4RVDA 1K732 3PO3S 3CCR1 2OTL1 2RHBA 3D2LA 4MONA 4RVGA 3HOUI 1Q16A 1I6HI 3CC71 2JIQA 4NBAA 3PO3I 1YIT1 5A2Qf 1JJ2Y 3S1MI 1AA6A 1Q7Y2 4NBCA 3J81f 1NJI1 3CME1 1VQ4Z 4E30A 3GTMS 5IP9I 1S7MA 1TWHI 2JIMA 3GTGI 3FQQA 2R92I 3NH5A 1RNIA 1KRLA 3VMGA 1YJ9Z 4A3CI 2VUGA 3EERA 3VMIA 4CL1A 2W03A 3I561 1VQMZ 2GTHA 3J80b 1K8A2 3VB9A 4E2ZA 1Y1WI 3JAMf 1YI2Z 2QLVB 3GCFA 3NH8A 1QVGZ 2R7ZI 1NP6A 2JMOA 2PM9A 2E2HI 2JIPA 1YHQZ 3CCS1 3GTOI 1VQK1 1S72Z 2E7ZA 1WZNA 3CCU1 1FDIA 2OTJ1 3QWUA 4E2XA 3TDHB 4A3MI 2O53A 4E33A 3CCRZ 1X3ZA 2KI7B 3TE5B 4NB9A 2OTLZ 3NH4A 4NH1C 1RO4A 2JA6I 1M901 1SFOI 5FLMI 3NDIA 4NBGA 5D1OA 5IT9b 4BBSI 2P3YA 1FDOA 2NVXI 3HOVI 2JR6A 2M48A 3CC7Z 4A3LI 2DE7A 2AYDA 2H85A 1YITZ 1Q811 3H3VJ 5D1PA 2VPWA 5LL6f 3CMEZ 3RZDI 2Q4ZA 2JA7I 2WB1A 4XX2A 3NDJA 3IF8A 3KIHA 1VQO1 2O4HA 3CC41 3CCJ1 2YU9I 4MH4A 2K5RA 1W2BZ 1KQSZ 1WIIA 5FLXb 1P9NA 3I56Z 4A3GI 3CC21 2IV2X 3CCL1 3OW2Y 2QEX1 3GKQA 1VQ51 3G4S1 3FQMA 4RS4A 1Q821 3CCSZ 3CCM1 1VQKZ 2V45A 2JIOA 4E2YA 2QREB 3CCUZ 2OTJZ 4DK1A 3FKII 4AYBA 4QTTA 2V8KA 3BG0B 3M4OI 3MONA 5A2Qb 2VPYA 3J81b 1K83I 4MD8A 4X6AI 2J6AA 3RZOI 1M902 4HH4A 3IFUA 4S1TA 3LUSA 1Z03A 1L1OC 2E2II 3CXCZ 3VTNA 3H0GI 2BJOA 4A3II 1YUKA 2QKDA 1VQ81 2QRCB 1Q812 1TWCI 1KC82 5T67A 4BXXI 4NFRA 5C4JI 1YJW1 5C4XI 4A3DI 3HOZI 5IP7I 3S2DI 2QA41 1M1K1 4DQYB 1VQOZ 2K3RA 3GTMI 3S1QI 3CC4Z 3CCJZ 3JAMb 1QVGY 1JWHC 3BG1B 4DGLA 1VQ71 2R6MA 2WAQA 4HGZA 3IR7A 3CC2Z 1VLAA 3CCLZ 1ZB9A 2RBLA 1ZB8A 2QEXZ 3I07A 1VQ5Z 3CQZI 2LIYA 3G4SZ 1K9M1 4Y7NI 3CCMZ 3CCE1 2EGTA 4RV9A 3HOWI 2E9HA 4TNUA 1QYPA 4A3EI 2DE6A 4BBRI 2RT9A 4BY7I 2NAPA 2JS4A 1N8R1 2IZ4A 2VUMI 3G711 1K731 1WW9A 3MZKB 2Y0SA 2VPXA 2R93I 3KIFA 1RO0A 1VQP1 1NJI2 1WJ2A 4E32A 4NBDA 3GTKI 3S14I 3CCV1 1VQ8Z 2YADA 1W2BY 1KQSY 1Q861 2PMZA 1N2FA 3CCQ1 1Y1VS 1SIWA 3S17I 5C3EI 1YJWZ 4A3KI 1I50I 2QA4Z 1YIJ1 5T64A 1VQL1 2RIQA 2OOXB 2KPIA 3CPWZ 3D9XA 4NBHA 1I3QI 4NBBA 1Y1VI 1USPB 1VQ7Z 4A93I 2HU9A 1X3WA 3VMHA 1KD11 4NBEA 2OOYB 4E2WA 2Q51A 3J7A4 1ML8A 4MXUA 3GTQI 2JA8I 1PFTA 5T6BA 3CCEZ 2V8JA 1RO2A 3S2HI 3CXCY 4EWCA 3K7AI 5CM2M 2NVTI 4Y52I 2G2KA 3G71Z 3G6E1 1QVFZ 1VQPZ 3CMA1 3T4NB 4RVFA 3CCVZ 3IX0A 3MZLB 4QTUA 1TWFI 1Q862 3CCQZ 3EEDA 1VQ61 2V8IA 2VPZA 1YJN1 3ESWA 3GTJI 1YIJZ 1VQLZ 2I3CA 2NVYI 2LFUA 1VQN1 1JJ2Z 4NOZA 4A3JI 3HOYI 2RPRA 2LEXA 3I551 1RLYA 2JA5I 1TFIA 2QR1B 3I4MI 5AN9F 3GTPI 1KD12 2GTIA 4BY1I 1X0TA 2M6NA 1Q822 2HF1A 3I4NI 3CD61 3S16I 2W04A 3F3FC 4MD7A 4NBFA 1USPA 2PK7A 5C44I 2P28A 2JUBA 3J80f 4A3FI 1NUIA 2V3VA 3HOXI 2F4OA 1VQ91 3S1NI 2IZ3A 2VF1A 3G6EZ 2GU2A 3F3PC 3D6WA 2DE5A 2QRDB 2JNYA 3CMAZ 1WCMI 2JIRA 2AKLA 1R9TI 3CPWY 1Q7Y1 2OZKA 5IT9f 1VQ41 1M1K2 1VQ6Z 1YJNZ 2B63I 1TWGI 4RVHA 1KC81 1VQNZ 3Q87A 1Z02A 4NB8A 1YJ91 1YUAA 3I55Z 1LQLA 2ZAEB 3PO2I 3M3YI 1Y8CA 1VQM1 2E2JI 1Z01A 4A3BI 1RQFA 4MRIA 1TWAI 2NVQI 1DL6A 3NFZA 1ZH1A 2F4MA 1K8A1 3S1RI 4HGYA 1K9M2 3U50C 3GTLI 3P5JB 3S15I 3CD6Z 1QF8A 1YI21 5D1OB 5FLXf 1YHQ1 1QVFY 4E31A 1S721 3HKZA 1N8R2 1QXFA
chains in the Genus database with same CATH topology
3OW2Z 1VQ9Z 4MD9A 4RVDA 1K732 3PO3S 3CCR1 2OTL1 2RHBA 4MONA 4RVGA 3HOUI 1I6HI 3CC71 4NBAA 3PO3I 1YIT1 5A2Qf 1JJ2Y 3S1MI 1Q7Y2 4NBCA 3J81f 1NJI1 3CME1 1VQ4Z 4E30A 3GTMS 5IP9I 1S7MA 1TWHI 3GTGI 3FQQA 2R92I 3NH5A 1RNIA 1KRLA 3VMGA 1YJ9Z 4A3CI 2VUGA 3EERA 3VMIA 4CL1A 2W03A 1VQMZ 3I561 2GTHA 3J80b 1K8A2 3VB9A 4E2ZA 1Y1WI 3JAMf 1YI2Z 2QLVB 3GCFA 3NH8A 1QVGZ 2R7ZI 1NP6A 2JMOA 2PM9A 2E2HI 1YHQZ 3CCS1 3GTOI 1VQK1 1S72Z 3CCU1 2OTJ1 3QWUA 4E2XA 3TDHB 4A3MI 2O53A 4E33A 3CCRZ 1X3ZA 2KI7B 3TE5B 4NB9A 2OTLZ 3NH4A 4NH1C 1RO4A 2JA6I 1M901 1SFOI 5FLMI 3NDIA 4NBGA 5D1OA 5IT9b 4BBSI 2P3YA 2NVXI 3HOVI 2JR6A 2M48A 3CC7Z 4A3LI 2DE7A 2H85A 1YITZ 1Q811 3H3VJ 5D1PA 5LL6f 3CMEZ 3RZDI 2Q4ZA 2JA7I 2WB1A 4XX2A 3NDJA 3IF8A 1VQO1 3KIHA 2O4HA 3CC41 3CCJ1 2YU9I 4MH4A 2K5RA 1W2BZ 1KQSZ 1WIIA 5FLXb 1P9NA 3I56Z 4A3GI 3CC21 3CCL1 3OW2Y 2QEX1 3GKQA 1VQ51 3G4S1 3FQMA 4RS4A 1Q821 3CCSZ 3CCM1 1VQKZ 4E2YA 2QREB 3CCUZ 2OTJZ 4DK1A 3FKII 4AYBA 4QTTA 2V8KA 3BG0B 3M4OI 3MONA 5A2Qb 3J81b 1K83I 4MD8A 4X6AI 2J6AA 3RZOI 1M902 4HH4A 3IFUA 4S1TA 3LUSA 1Z03A 1L1OC 2E2II 3CXCZ 3VTNA 3H0GI 2BJOA 4A3II 1YUKA 2QKDA 1VQ81 2QRCB 1Q812 1TWCI 1KC82 5T67A 4BXXI 4NFRA 5C4JI 1YJW1 5C4XI 4A3DI 3HOZI 5IP7I 3S2DI 2QA41 1M1K1 4DQYB 1VQOZ 2K3RA 3GTMI 3S1QI 3CC4Z 3CCJZ 3JAMb 1QVGY 1JWHC 3BG1B 4DGLA 1VQ71 2R6MA 2WAQA 4HGZA 3CC2Z 1VLAA 3CCLZ 1ZB9A 2RBLA 1ZB8A 2QEXZ 3I07A 1VQ5Z 3CQZI 2LIYA 3G4SZ 1K9M1 4Y7NI 3CCMZ 3CCE1 2EGTA 4RV9A 3HOWI 2E9HA 4TNUA 1QYPA 4A3EI 2DE6A 4BBRI 2RT9A 4BY7I 2JS4A 1N8R1 2IZ4A 2VUMI 3G711 1K731 1WW9A 3MZKB 2Y0SA 2R93I 3KIFA 1RO0A 1VQP1 1NJI2 4E32A 4NBDA 3GTKI 3S14I 3CCV1 1VQ8Z 2YADA 1W2BY 1KQSY 1Q861 2PMZA 1N2FA 3CCQ1 1Y1VS 3S17I 5C3EI 1YJWZ 4A3KI 1I50I 2QA4Z 1YIJ1 5T64A 1VQL1 2RIQA 2OOXB 2KPIA 3CPWZ 3D9XA 4NBHA 1I3QI 4NBBA 1VQ7Z 1Y1VI 1USPB 4A93I 2HU9A 1X3WA 3VMHA 1KD11 4NBEA 2OOYB 4E2WA 2Q51A 3J7A4 1ML8A 4MXUA 3GTQI 2JA8I 1PFTA 5T6BA 3CCEZ 2V8JA 1RO2A 3S2HI 3CXCY 4EWCA 3K7AI 5CM2M 2NVTI 4Y52I 2G2KA 3G71Z 3G6E1 1QVFZ 1VQPZ 3CMA1 3T4NB 4RVFA 3CCVZ 3IX0A 3MZLB 4QTUA 1TWFI 1Q862 3CCQZ 3EEDA 1VQ61 2V8IA 1YJN1 3ESWA 3GTJI 1YIJZ 1VQLZ 2I3CA 2NVYI 2LFUA 1VQN1 1JJ2Z 4NOZA 4A3JI 3HOYI 2RPRA 3I551 1RLYA 2JA5I 1TFIA 2QR1B 3I4MI 5AN9F 3GTPI 1KD12 2GTIA 4BY1I 1X0TA 2M6NA 1Q822 2HF1A 3I4NI 3CD61 3S16I 2W04A 3F3FC 4MD7A 4NBFA 1USPA 2PK7A 5C44I 2P28A 2JUBA 3J80f 4A3FI 1NUIA 3HOXI 2F4OA 1VQ91 3S1NI 2IZ3A 2VF1A 3G6EZ 2GU2A 3F3PC 3D6WA 2DE5A 2QRDB 2JNYA 3CMAZ 1WCMI 2AKLA 1R9TI 3CPWY 1Q7Y1 2OZKA 5IT9f 1VQ41 1M1K2 1VQ6Z 1YJNZ 2B63I 1TWGI 4RVHA 1KC81 1VQNZ 3Q87A 1Z02A 4NB8A 1YJ91 1YUAA 3I55Z 1LQLA 2ZAEB 3PO2I 3M3YI 1VQM1 2E2JI 1Z01A 4A3BI 1RQFA 4MRIA 1TWAI 2NVQI 1DL6A 3NFZA 1ZH1A 2F4MA 1K8A1 3S1RI 4HGYA 1K9M2 3U50C 3GTLI 3P5JB 3S15I 3CD6Z 1QF8A 1YI21 5D1OB 5FLXf 1YHQ1 1QVFY 4E31A 1S721 3HKZA 1N8R2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Z;  3CC4 1;  3OW2 Z;  1VQ9 Z;  3CCJ 1;  1K73 2;  1W2B Z;  3CCR 1;  1KQS Z;  1N8R 1;  3I55 1;  2OTL 1;  3G71 1;  1K73 1;  3I56 Z;  1KD1 2;  3CC2 1;  1VQP 1;  3CCL 1;  1NJI 2;  3CC7 1;  1YIT 1;  3CCV 1;  1Q82 2;  1VQ8 Z;  1JJ2 Y;  3OW2 Y;  1Q7Y 2;  2QEX 1;  1W2B Y;  1NJI 1;  1KQS Y;  1VQ5 1;  3CD6 1;  1Q86 1;  3G4S 1;  3CME 1;  3CCQ 1;  3CCS Z;  1Q82 1;  3CCM 1;  1VQ4 Z;  1VQK Z;  1YJW Z;  2QA4 Z;  1YIJ 1;  3CCU Z;  2OTJ Z;  1VQL 1;  3CPW Z;  1YJ9 Z;  1VQ9 1;  1VQ7 Z;  3G6E Z;  1M90 2;  3I56 1;  1VQM Z;  1KD1 1;  3CXC Z;  3CMA Z;  1K8A 2;  3CPW Y;  1Q7Y 1;  1VQ8 1;  1YI2 Z;  1Q81 2;  1QVG Z;  3CCE Z;  1YHQ Z;  3CCS 1;  1VQ4 1;  1M1K 2;  1KC8 2;  1VQK 1;  1VQ6 Z;  1YJN Z;  1YJW 1;  1S72 Z;  3CXC Y;  2QA4 1;  3CCU 1;  1M1K 1;  1KC8 1;  2OTJ 1;  1VQO Z;  1VQN Z;  3CC4 Z;  3CCJ Z;  1YJ9 1;  3CCR Z;  3I55 Z;  2OTL Z;  1QVG Y;  1VQ7 1;  3G71 Z;  3G6E 1;  1M90 1;  1QVF Z;  1VQM 1;  3CC2 Z;  1VQP Z;  3CCL Z;  3CMA 1;  3CC7 Z;  1K8A 1;  1YIT Z;  3CCV Z;  1K9M 2;  2QEX Z;  1Q81 1;  3CD6 Z;  1VQ5 Z;  1YI2 1;  3G4S Z;  1Q86 2;  3CME Z;  3CCQ Z;  1K9M 1;  3CCM Z;  3CCE 1;  1YHQ 1;  1QVF Y;  1VQ6 1;  1YJN 1;  1S72 1;  1YIJ Z;  1VQL Z;  1N8R 2;  1VQO 1;  1VQN 1; 
#chains in the Genus database with same CATH topology
 3OW2 Z;  1VQ9 Z;  4MD9 A;  4RVD A;  1K73 2;  3PO3 S;  3CCR 1;  2OTL 1;  2RHB A;  3D2L A;  4MON A;  4RVG A;  3HOU I;  1Q16 A;  1I6H I;  3CC7 1;  2JIQ A;  4NBA A;  3PO3 I;  1YIT 1;  5A2Q f;  1JJ2 Y;  3S1M I;  1AA6 A;  1Q7Y 2;  4NBC A;  3J81 f;  1NJI 1;  3CME 1;  1VQ4 Z;  4E30 A;  3GTM S;  5IP9 I;  1S7M A;  1TWH I;  2JIM A;  3GTG I;  3FQQ A;  2R92 I;  3NH5 A;  1RNI A;  1KRL A;  3VMG A;  1YJ9 Z;  4A3C I;  2VUG A;  3EER A;  3VMI A;  4CL1 A;  2W03 A;  3I56 1;  1VQM Z;  2GTH A;  3J80 b;  1K8A 2;  3VB9 A;  4E2Z A;  1Y1W I;  3JAM f;  1YI2 Z;  2QLV B;  3GCF A;  3NH8 A;  1QVG Z;  2R7Z I;  1NP6 A;  2JMO A;  2PM9 A;  2E2H I;  2JIP A;  1YHQ Z;  3CCS 1;  3GTO I;  1VQK 1;  1S72 Z;  2E7Z A;  1WZN A;  3CCU 1;  1FDI A;  2OTJ 1;  3QWU A;  4E2X A;  3TDH B;  4A3M I;  2O53 A;  4E33 A;  3CCR Z;  1X3Z A;  2KI7 B;  3TE5 B;  4NB9 A;  2OTL Z;  3NH4 A;  4NH1 C;  1RO4 A;  2JA6 I;  1M90 1;  1SFO I;  5FLM I;  3NDI A;  4NBG A;  5D1O A;  5IT9 b;  4BBS I;  2P3Y A;  1FDO A;  2NVX I;  3HOV I;  2JR6 A;  2M48 A;  3CC7 Z;  4A3L I;  2DE7 A;  2AYD A;  2H85 A;  1YIT Z;  1Q81 1;  3H3V J;  5D1P A;  2VPW A;  5LL6 f;  3CME Z;  3RZD I;  2Q4Z A;  2JA7 I;  2WB1 A;  4XX2 A;  3NDJ A;  3IF8 A;  3KIH A;  1VQO 1;  2O4H A;  3CC4 1;  3CCJ 1;  2YU9 I;  4MH4 A;  2K5R A;  1W2B Z;  1KQS Z;  1WII A;  5FLX b;  1P9N A;  3I56 Z;  4A3G I;  3CC2 1;  2IV2 X;  3CCL 1;  3OW2 Y;  2QEX 1;  3GKQ A;  1VQ5 1;  3G4S 1;  3FQM A;  4RS4 A;  1Q82 1;  3CCS Z;  3CCM 1;  1VQK Z;  2V45 A;  2JIO A;  4E2Y A;  2QRE B;  3CCU Z;  2OTJ Z;  4DK1 A;  3FKI I;  4AYB A;  4QTT A;  2V8K A;  3BG0 B;  3M4O I;  3MON A;  5A2Q b;  2VPY A;  3J81 b;  1K83 I;  4MD8 A;  4X6A I;  2J6A A;  3RZO I;  1M90 2;  4HH4 A;  3IFU A;  4S1T A;  3LUS A;  1Z03 A;  1L1O C;  2E2I I;  3CXC Z;  3VTN A;  3H0G I;  2BJO A;  4A3I I;  1YUK A;  2QKD A;  1VQ8 1;  2QRC B;  1Q81 2;  1TWC I;  1KC8 2;  5T67 A;  4BXX I;  4NFR A;  5C4J I;  1YJW 1;  5C4X I;  4A3D I;  3HOZ I;  5IP7 I;  3S2D I;  2QA4 1;  1M1K 1;  4DQY B;  1VQO Z;  2K3R A;  3GTM I;  3S1Q I;  3CC4 Z;  3CCJ Z;  3JAM b;  1QVG Y;  1JWH C;  3BG1 B;  4DGL A;  1VQ7 1;  2R6M A;  2WAQ A;  4HGZ A;  3IR7 A;  3CC2 Z;  1VLA A;  3CCL Z;  1ZB9 A;  2RBL A;  1ZB8 A;  2QEX Z;  3I07 A;  1VQ5 Z;  3CQZ I;  2LIY A;  3G4S Z;  1K9M 1;  4Y7N I;  3CCM Z;  3CCE 1;  2EGT A;  4RV9 A;  3HOW I;  2E9H A;  4TNU A;  1QYP A;  4A3E I;  2DE6 A;  4BBR I;  2RT9 A;  4BY7 I;  2NAP A;  2JS4 A;  1N8R 1;  2IZ4 A;  2VUM I;  3G71 1;  1K73 1;  1WW9 A;  3MZK B;  2Y0S A;  2VPX A;  2R93 I;  3KIF A;  1RO0 A;  1VQP 1;  1NJI 2;  1WJ2 A;  4E32 A;  4NBD A;  3GTK I;  3S14 I;  3CCV 1;  1VQ8 Z;  2YAD A;  1W2B Y;  1KQS Y;  1Q86 1;  2PMZ A;  1N2F A;  3CCQ 1;  1Y1V S;  1SIW A;  3S17 I;  5C3E I;  1YJW Z;  4A3K I;  1I50 I;  2QA4 Z;  1YIJ 1;  5T64 A;  1VQL 1;  2RIQ A;  2OOX B;  2KPI A;  3CPW Z;  3D9X A;  4NBH A;  1I3Q I;  4NBB A;  1Y1V I;  1USP B;  1VQ7 Z;  4A93 I;  2HU9 A;  1X3W A;  3VMH A;  1KD1 1;  4NBE A;  2OOY B;  4E2W A;  2Q51 A;  3J7A 4;  1ML8 A;  4MXU A;  3GTQ I;  2JA8 I;  1PFT A;  5T6B A;  3CCE Z;  2V8J A;  1RO2 A;  3S2H I;  3CXC Y;  4EWC A;  3K7A I;  5CM2 M;  2NVT I;  4Y52 I;  2G2K A;  3G71 Z;  3G6E 1;  1QVF Z;  1VQP Z;  3CMA 1;  3T4N B;  4RVF A;  3CCV Z;  3IX0 A;  3MZL B;  4QTU A;  1TWF I;  1Q86 2;  3CCQ Z;  3EED A;  1VQ6 1;  2V8I A;  2VPZ A;  1YJN 1;  3ESW A;  3GTJ I;  1YIJ Z;  1VQL Z;  2I3C A;  2NVY I;  2LFU A;  1VQN 1;  1JJ2 Z;  4NOZ A;  4A3J I;  3HOY I;  2RPR A;  2LEX A;  3I55 1;  1RLY A;  2JA5 I;  1TFI A;  2QR1 B;  3I4M I;  5AN9 F;  3GTP I;  1KD1 2;  2GTI A;  4BY1 I;  1X0T A;  2M6N A;  1Q82 2;  2HF1 A;  3I4N I;  3CD6 1;  3S16 I;  2W04 A;  3F3F C;  4MD7 A;  4NBF A;  1USP A;  2PK7 A;  5C44 I;  2P28 A;  2JUB A;  3J80 f;  4A3F I;  1NUI A;  2V3V A;  3HOX I;  2F4O A;  1VQ9 1;  3S1N I;  2IZ3 A;  2VF1 A;  3G6E Z;  2GU2 A;  3F3P C;  3D6W A;  2DE5 A;  2QRD B;  2JNY A;  3CMA Z;  1WCM I;  2JIR A;  2AKL A;  1R9T I;  3CPW Y;  1Q7Y 1;  2OZK A;  5IT9 f;  1VQ4 1;  1M1K 2;  1VQ6 Z;  1YJN Z;  2B63 I;  1TWG I;  4RVH A;  1KC8 1;  1VQN Z;  3Q87 A;  1Z02 A;  4NB8 A;  1YJ9 1;  1YUA A;  3I55 Z;  1LQL A;  2ZAE B;  3PO2 I;  3M3Y I;  1Y8C A;  1VQM 1;  2E2J I;  1Z01 A;  4A3B I;  1RQF A;  4MRI A;  1TWA I;  2NVQ I;  1DL6 A;  3NFZ A;  1ZH1 A;  2F4M A;  1K8A 1;  3S1R I;  4HGY A;  1K9M 2;  3U50 C;  3GTL I;  3P5J B;  3S15 I;  3CD6 Z;  1QF8 A;  1YI2 1;  5D1O B;  5FLX f;  1YHQ 1;  1QVF Y;  4E31 A;  1S72 1;  3HKZ A;  1N8R 2;  1QXF A; 
#chains in the Genus database with same CATH homology
 3OW2 Z;  1VQ9 Z;  4MD9 A;  4RVD A;  1K73 2;  3PO3 S;  3CCR 1;  2OTL 1;  2RHB A;  4MON A;  4RVG A;  3HOU I;  1I6H I;  3CC7 1;  4NBA A;  3PO3 I;  1YIT 1;  5A2Q f;  1JJ2 Y;  3S1M I;  1Q7Y 2;  4NBC A;  3J81 f;  1NJI 1;  3CME 1;  1VQ4 Z;  4E30 A;  3GTM S;  5IP9 I;  1S7M A;  1TWH I;  3GTG I;  3FQQ A;  2R92 I;  3NH5 A;  1RNI A;  1KRL A;  3VMG A;  1YJ9 Z;  4A3C I;  2VUG A;  3EER A;  3VMI A;  4CL1 A;  2W03 A;  1VQM Z;  3I56 1;  2GTH A;  3J80 b;  1K8A 2;  3VB9 A;  4E2Z A;  1Y1W I;  3JAM f;  1YI2 Z;  2QLV B;  3GCF A;  3NH8 A;  1QVG Z;  2R7Z I;  1NP6 A;  2JMO A;  2PM9 A;  2E2H I;  1YHQ Z;  3CCS 1;  3GTO I;  1VQK 1;  1S72 Z;  3CCU 1;  2OTJ 1;  3QWU A;  4E2X A;  3TDH B;  4A3M I;  2O53 A;  4E33 A;  3CCR Z;  1X3Z A;  2KI7 B;  3TE5 B;  4NB9 A;  2OTL Z;  3NH4 A;  4NH1 C;  1RO4 A;  2JA6 I;  1M90 1;  1SFO I;  5FLM I;  3NDI A;  4NBG A;  5D1O A;  5IT9 b;  4BBS I;  2P3Y A;  2NVX I;  3HOV I;  2JR6 A;  2M48 A;  3CC7 Z;  4A3L I;  2DE7 A;  2H85 A;  1YIT Z;  1Q81 1;  3H3V J;  5D1P A;  5LL6 f;  3CME Z;  3RZD I;  2Q4Z A;  2JA7 I;  2WB1 A;  4XX2 A;  3NDJ A;  3IF8 A;  1VQO 1;  3KIH A;  2O4H A;  3CC4 1;  3CCJ 1;  2YU9 I;  4MH4 A;  2K5R A;  1W2B Z;  1KQS Z;  1WII A;  5FLX b;  1P9N A;  3I56 Z;  4A3G I;  3CC2 1;  3CCL 1;  3OW2 Y;  2QEX 1;  3GKQ A;  1VQ5 1;  3G4S 1;  3FQM A;  4RS4 A;  1Q82 1;  3CCS Z;  3CCM 1;  1VQK Z;  4E2Y A;  2QRE B;  3CCU Z;  2OTJ Z;  4DK1 A;  3FKI I;  4AYB A;  4QTT A;  2V8K A;  3BG0 B;  3M4O I;  3MON A;  5A2Q b;  3J81 b;  1K83 I;  4MD8 A;  4X6A I;  2J6A A;  3RZO I;  1M90 2;  4HH4 A;  3IFU A;  4S1T A;  3LUS A;  1Z03 A;  1L1O C;  2E2I I;  3CXC Z;  3VTN A;  3H0G I;  2BJO A;  4A3I I;  1YUK A;  2QKD A;  1VQ8 1;  2QRC B;  1Q81 2;  1TWC I;  1KC8 2;  5T67 A;  4BXX I;  4NFR A;  5C4J I;  1YJW 1;  5C4X I;  4A3D I;  3HOZ I;  5IP7 I;  3S2D I;  2QA4 1;  1M1K 1;  4DQY B;  1VQO Z;  2K3R A;  3GTM I;  3S1Q I;  3CC4 Z;  3CCJ Z;  3JAM b;  1QVG Y;  1JWH C;  3BG1 B;  4DGL A;  1VQ7 1;  2R6M A;  2WAQ A;  4HGZ A;  3CC2 Z;  1VLA A;  3CCL Z;  1ZB9 A;  2RBL A;  1ZB8 A;  2QEX Z;  3I07 A;  1VQ5 Z;  3CQZ I;  2LIY A;  3G4S Z;  1K9M 1;  4Y7N I;  3CCM Z;  3CCE 1;  2EGT A;  4RV9 A;  3HOW I;  2E9H A;  4TNU A;  1QYP A;  4A3E I;  2DE6 A;  4BBR I;  2RT9 A;  4BY7 I;  2JS4 A;  1N8R 1;  2IZ4 A;  2VUM I;  3G71 1;  1K73 1;  1WW9 A;  3MZK B;  2Y0S A;  2R93 I;  3KIF A;  1RO0 A;  1VQP 1;  1NJI 2;  4E32 A;  4NBD A;  3GTK I;  3S14 I;  3CCV 1;  1VQ8 Z;  2YAD A;  1W2B Y;  1KQS Y;  1Q86 1;  2PMZ A;  1N2F A;  3CCQ 1;  1Y1V S;  3S17 I;  5C3E I;  1YJW Z;  4A3K I;  1I50 I;  2QA4 Z;  1YIJ 1;  5T64 A;  1VQL 1;  2RIQ A;  2OOX B;  2KPI A;  3CPW Z;  3D9X A;  4NBH A;  1I3Q I;  4NBB A;  1VQ7 Z;  1Y1V I;  1USP B;  4A93 I;  2HU9 A;  1X3W A;  3VMH A;  1KD1 1;  4NBE A;  2OOY B;  4E2W A;  2Q51 A;  3J7A 4;  1ML8 A;  4MXU A;  3GTQ I;  2JA8 I;  1PFT A;  5T6B A;  3CCE Z;  2V8J A;  1RO2 A;  3S2H I;  3CXC Y;  4EWC A;  3K7A I;  5CM2 M;  2NVT I;  4Y52 I;  2G2K A;  3G71 Z;  3G6E 1;  1QVF Z;  1VQP Z;  3CMA 1;  3T4N B;  4RVF A;  3CCV Z;  3IX0 A;  3MZL B;  4QTU A;  1TWF I;  1Q86 2;  3CCQ Z;  3EED A;  1VQ6 1;  2V8I A;  1YJN 1;  3ESW A;  3GTJ I;  1YIJ Z;  1VQL Z;  2I3C A;  2NVY I;  2LFU A;  1VQN 1;  1JJ2 Z;  4NOZ A;  4A3J I;  3HOY I;  2RPR A;  3I55 1;  1RLY A;  2JA5 I;  1TFI A;  2QR1 B;  3I4M I;  5AN9 F;  3GTP I;  1KD1 2;  2GTI A;  4BY1 I;  1X0T A;  2M6N A;  1Q82 2;  2HF1 A;  3I4N I;  3CD6 1;  3S16 I;  2W04 A;  3F3F C;  4MD7 A;  4NBF A;  1USP A;  2PK7 A;  5C44 I;  2P28 A;  2JUB A;  3J80 f;  4A3F I;  1NUI A;  3HOX I;  2F4O A;  1VQ9 1;  3S1N I;  2IZ3 A;  2VF1 A;  3G6E Z;  2GU2 A;  3F3P C;  3D6W A;  2DE5 A;  2QRD B;  2JNY A;  3CMA Z;  1WCM I;  2AKL A;  1R9T I;  3CPW Y;  1Q7Y 1;  2OZK A;  5IT9 f;  1VQ4 1;  1M1K 2;  1VQ6 Z;  1YJN Z;  2B63 I;  1TWG I;  4RVH A;  1KC8 1;  1VQN Z;  3Q87 A;  1Z02 A;  4NB8 A;  1YJ9 1;  1YUA A;  3I55 Z;  1LQL A;  2ZAE B;  3PO2 I;  3M3Y I;  1VQM 1;  2E2J I;  1Z01 A;  4A3B I;  1RQF A;  4MRI A;  1TWA I;  2NVQ I;  1DL6 A;  3NFZ A;  1ZH1 A;  2F4M A;  1K8A 1;  3S1R I;  4HGY A;  1K9M 2;  3U50 C;  3GTL I;  3P5J B;  3S15 I;  3CD6 Z;  1QF8 A;  1YI2 1;  5D1O B;  5FLX f;  1YHQ 1;  1QVF Y;  4E31 A;  1S72 1;  3HKZ A;  1N8R 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...