1N8R1

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r100
1VQ6Z 3CMEZ 3G6EZ 1KC81 1N8R2 3CXCY 3G71Z 3CCU1 1KD12 3G6E1 1W2BY 2QEX1 1QVGZ 1JJ2Y 3CCQZ 3CCSZ 1YI2Z 2QA4Z 3CCQ1 1VQ51 1S721 1K8A2 1M1K2 1VQKZ 1YJN1 1Q811 2QA41 1KD11 3CCL1 1VQOZ 1NJI2 3CD61 3I56Z 3CCR1 1VQO1 1K732 1K9M1 1K8A1 3CCVZ 1YJW1 1VQ61 1VQLZ 1Q812 3CME1 1NJI1 3CCV1 1KQSZ 1Q822 1VQL1 1K731 1YJ9Z 3I55Z 1QVGY 3G711 3CC7Z 2OTLZ 1K9M2 1YJ91 3CCS1 3CC71 2OTL1 1YI21 3OW2Z 1VQ8Z 1VQK1 1Q821 1Q862 3CPWZ 2OTJZ 1M902 3I561 1VQMZ 3G4SZ 1YIJZ 1VQPZ 3CCEZ 1M1K1 1VQ4Z 3G4S1 3CCMZ 1Q861 1VQ9Z 3CCE1 1Q7Y2 3CC4Z 1KQSY 1VQ41 3CCM1 1QVFZ 1VQ91 1YHQZ 1M901 3I551 3CMAZ 3CC2Z 1VQNZ 3OW2Y 1YITZ 1Q7Y1 3CC21 1VQN1 1YIT1 1VQ81 3CPWY 3CCUZ 2QEXZ 2OTJ1 3CXCZ 1W2BZ 1JJ2Z 1VQM1 1VQ5Z 1S72Z 1YIJ1 1VQP1 1YJNZ 1VQ7Z 1QVFY 3CCLZ 3CC41 1N8R1 3CD6Z 1VQ71 1YHQ1 3CCRZ 1KC82 3CCJZ 3CMA1 3CCJ1 1YJWZ
chains in the Genus database with same CATH superfamily
1VQ6Z 2V8KA 2JS4A 1TWHI 2PK7A 4MD9A 2NVYI 2G2KA 3VMHA 3CXCY 3G71Z 3CCU1 1I3QI 1NUIA 3TDHB 2O53A 2VUGA 1RQFA 3J81b 4TNUA 1VQ51 3GTPI 2JNYA 1TWGI 2VPXA 4MRIA 1VQOZ 3JAMb 1NJI2 5CM2M 3I56Z 2ZAEB 3CCR1 1VQO1 2LEXA 1K9M1 3KIHA 3S16I 2P28A 2O4HA 1YUAA 2OOXB 4NBDA 3CCVZ 4A3BI 3IX0A 1NJI1 3CCV1 1Q822 3BG0B 1YJ9Z 5AN9F 3CC7Z 2QKDA 2E9HA 2R6MA 1YJ91 3PO3I 3CC71 2LFUA 2IZ4A 1YI21 5C3EI 1Z03A 2E7ZA 1ZH1A 1USPA 3NH8A 1VQK1 1Q821 4E2ZA 1PFTA 2DE7A 3IF8A 3F3PC 3G4SZ 1FDIA 3KIFA 1VQPZ 3VB9A 3CCEZ 3S1NI 1VQ4Z 3G4S1 3CCMZ 3CCE1 2JA8I 4BXXI 4MXUA 1Q7Y2 3CC4Z 1VQ41 3CCM1 1QVFZ 1WIIA 2HF1A 4RVDA 4RV9A 2VUMI 1Q7Y1 4NBFA 3S1MI 4MONA 5FLXb 2V8IA 2W04A 2JA7I 3RZDI 2OTJ1 3I07A 2OZKA 4BY1I 3VMIA 2JIOA 1W2BZ 4EWCA 1VQM1 1FDOA 3NH5A 1TWFI 1QVFY 2B63I 4RVFA 1KC82 2BJOA 1WJ2A 3TE5B 2YU9I 2V3VA 1YJWZ 2P3YA 4A3MI 3M4OI 3G6EZ 1KC81 2R93I 3GTJI 3G6E1 1W2BY 1X0TA 3CCSZ 3J80f 2QA4Z 1K83I 2WB1A 3U50C 1YJN1 2WAQA 1Q811 2QA41 1R9TI 2RHBA 3CCL1 3CD61 1Z02A 3MONA 2IZ3A 2Y0SA 3LUSA 2H85A 4QTTA 1VQ61 2W03A 3T4NB 2QRCB 4NBBA 4MH4A 2JR6A 3G711 5C4XI 1Q16A 1K9M2 2R92I 4Y52I 2QREB 4MD7A 3D2LA 3PO3S 4NB8A 3CPWZ 2KI7B 5A2Qb 2E2HI 1TWCI 1M902 4BY7I 3I561 3QWUA 1YIJZ 3Q87A 3GTMI 3K7AI 1ZB9A 4BBSI 4HGYA 1SIWA 2NAPA 4RS4A 1YHQZ 3VTNA 1M901 4DGLA 3D9XA 2HU9A 3VMGA 4HGZA 1QXFA 2V45A 3J81f 4DQYB 1N2FA 3CPWY 1RLYA 5FLMI 3NDIA 2QEXZ 3JAMf 3H0GI 1TFIA 1JJ2Z 2JA5I 3S15I 1NP6A 1S72Z 1VQP1 4NBAA 5A2Qf 4A3LI 1L1OC 2DE5A 4A3JI 4NBHA 3PO2I 3CC41 1N8R1 4A3KI 2PMZA 5T6BA 4S1TA 4Y7NI 3CCJZ 2I3CA 3S1RI 3S17I 3CCJ1 1M1K1 1WW9A 2M6NA 3CMEZ 3J7A4 2F4OA 5D1OB 5IT9b 2IV2X 3GKQA 3NH4A 1JJ2Y 3CCQZ 1QF8A 3CCQ1 1K8A2 4BBRI 2E2II 2EGTA 4E2YA 1RNIA 4E2WA 5C4JI 4E31A 1YUKA 5T64A 1Y8CA 4A3II 1K8A1 1JWHC 3ESWA 4NH1C 3BG1B 1YJW1 1VQLZ 1Q812 1I50I 4NBEA 2GU2A 1KQSZ 1VQL1 2JIRA 2QRDB 3I55Z 5FLXf 2NVXI 3CCS1 3F3FC 1RO0A 2VPYA 4HH4A 1Y1WI 3OW2Z 1VQ8Z 3HOZI 3FKII 1AA6A 2NVQI 4MD8A 1X3WA 3EERA 3IR7A 4E30A 2JIPA 4NBCA 2QLVB 1VQ9Z 3NDJA 2DE6A 1SFOI 1KQSY 1VQ91 3GTMS 4DK1A 3CQZI 3GTQI 3CMAZ 3CC2Z 3OW2Y 5T67A 2K3RA 1USPB 4NOZA 1Y1VI 3CC21 5IP7I 3GCFA 2JIQA 4A3FI 2Q51A 4E32A 3CCUZ 3S2DI 2KPIA 1I6HI 2RIQA 3HOVI 1VQ5Z 4RVHA 1YIJ1 1X3ZA 4NFRA 1WCMI 3H3VJ 1VQ7Z 3FQMA 4AYBA 2VF1A 1VQ71 1YHQ1 3CCRZ 3GTOI 2K5RA 5IP9I 3HOWI 1QYPA 3FQQA 4A3DI 2Q4ZA 1WZNA 1N8R2 3I4MI 1KD12 4RVGA 3HOXI 4E33A 2QEX1 1QVGZ 2V8JA 1YI2Z 3HOYI 2GTIA 4E2XA 2RBLA 1S721 1M1K2 4XX2A 3S1QI 1VQKZ 2F4MA 1KD11 1K732 3MZKB 2J6AA 1VLAA 2LIYA 3EEDA 2YADA 4NBGA 3CME1 2R7ZI 1K731 2RT9A 1P9NA 4A3EI 1QVGY 3I4NI 2OTLZ 3RZOI 2OTL1 3NFZA 1KRLA 1Q862 3P5JB 2OTJZ 2PM9A 2GTHA 4CL1A 3J80b 5C44I 1VQMZ 1S7MA 1DL6A 3GTKI 1Q861 2RPRA 2OOYB 1ZB8A 3IFUA 3I551 5IT9f 3HKZA 3MZLB 1VQNZ 1LQLA 1TWAI 5LL6f 1YITZ 2QR1B 1RO4A 1ML8A 1VQN1 1YIT1 1Z01A 1VQ81 2VPZA 5D1PA 1Y1VS 5D1OA 4QTUA 2E2JI 4A3CI 3CXCZ 4A3GI 2VPWA 1RO2A 2M48A 4A93I 3S14I 3GTGI 1YJNZ 2JA6I 3M3YI 3CCLZ 3CD6Z 3D6WA 2JMOA 2JIMA 3GTLI 2AYDA 3S2HI 2NVTI 3HOUI 2AKLA 4NB9A 3CMA1 4X6AI 2JUBA
chains in the Genus database with same CATH topology
1VQ6Z 2V8KA 2JS4A 1TWHI 2PK7A 4MD9A 2NVYI 2G2KA 3VMHA 3CXCY 3G71Z 3CCU1 1I3QI 1NUIA 3TDHB 2O53A 2VUGA 1RQFA 3J81b 4TNUA 1VQ51 3GTPI 2JNYA 1TWGI 4MRIA 1VQOZ 3JAMb 1NJI2 5CM2M 3I56Z 2ZAEB 3CCR1 1VQO1 1K9M1 3KIHA 3S16I 2P28A 2O4HA 1YUAA 2OOXB 4NBDA 3CCVZ 4A3BI 3IX0A 1NJI1 3CCV1 1Q822 3BG0B 1YJ9Z 5AN9F 3CC7Z 2QKDA 2E9HA 2R6MA 1YJ91 3PO3I 3CC71 2LFUA 2IZ4A 1YI21 5C3EI 1Z03A 1ZH1A 1USPA 3NH8A 1VQK1 1Q821 4E2ZA 1PFTA 2DE7A 3IF8A 3F3PC 3G4SZ 3KIFA 1VQPZ 3VB9A 3CCEZ 3S1NI 1VQ4Z 3G4S1 3CCMZ 3CCE1 2JA8I 4BXXI 4MXUA 1Q7Y2 3CC4Z 1VQ41 3CCM1 1QVFZ 1WIIA 2HF1A 4RVDA 4RV9A 2VUMI 1Q7Y1 4NBFA 3S1MI 4MONA 5FLXb 2V8IA 2W04A 2JA7I 3RZDI 2OTJ1 3I07A 2OZKA 4BY1I 3VMIA 1W2BZ 4EWCA 1VQM1 3NH5A 1TWFI 1QVFY 2B63I 4RVFA 1KC82 2BJOA 3TE5B 2YU9I 1YJWZ 2P3YA 4A3MI 3M4OI 3G6EZ 1KC81 2R93I 3GTJI 3G6E1 1W2BY 1X0TA 3CCSZ 3J80f 2QA4Z 1K83I 2WB1A 3U50C 1YJN1 2WAQA 1Q811 2QA41 1R9TI 2RHBA 3CCL1 3CD61 1Z02A 3MONA 2IZ3A 2Y0SA 3LUSA 2H85A 4QTTA 1VQ61 2W03A 3T4NB 2QRCB 4NBBA 4MH4A 2JR6A 3G711 5C4XI 1K9M2 2R92I 4Y52I 2QREB 4MD7A 3PO3S 4NB8A 3CPWZ 2KI7B 5A2Qb 2E2HI 1TWCI 1M902 4BY7I 3I561 3QWUA 1YIJZ 3Q87A 3GTMI 3K7AI 1ZB9A 4BBSI 4HGYA 4RS4A 1YHQZ 3VTNA 1M901 4DGLA 3D9XA 2HU9A 3VMGA 4HGZA 3J81f 4DQYB 1N2FA 3CPWY 1RLYA 5FLMI 3NDIA 2QEXZ 3JAMf 3H0GI 1TFIA 1JJ2Z 2JA5I 3S15I 1NP6A 1S72Z 1VQP1 4NBAA 5A2Qf 4A3LI 1L1OC 2DE5A 4A3JI 4NBHA 3PO2I 3CC41 1N8R1 4A3KI 2PMZA 5T6BA 4S1TA 4Y7NI 3CCJZ 2I3CA 3S1RI 3S17I 3CCJ1 1M1K1 1WW9A 2M6NA 3CMEZ 3J7A4 2F4OA 5D1OB 5IT9b 3GKQA 3NH4A 1JJ2Y 3CCQZ 1QF8A 3CCQ1 1K8A2 4BBRI 2E2II 2EGTA 4E2YA 1RNIA 4E2WA 5C4JI 4E31A 1YUKA 5T64A 4A3II 1K8A1 1JWHC 3ESWA 4NH1C 3BG1B 1YJW1 1VQLZ 1Q812 1I50I 4NBEA 2GU2A 1KQSZ 1VQL1 2QRDB 3I55Z 5FLXf 2NVXI 3CCS1 3F3FC 1RO0A 4HH4A 1Y1WI 3OW2Z 1VQ8Z 3HOZI 3FKII 2NVQI 4MD8A 1X3WA 3EERA 4E30A 4NBCA 2QLVB 1VQ9Z 3NDJA 2DE6A 1SFOI 1KQSY 1VQ91 3GTMS 4DK1A 3CQZI 3GTQI 3CMAZ 3CC2Z 3OW2Y 5T67A 2K3RA 1USPB 4NOZA 1Y1VI 3CC21 5IP7I 3GCFA 4A3FI 2Q51A 4E32A 3CCUZ 3S2DI 2KPIA 1I6HI 2RIQA 3HOVI 1VQ5Z 4RVHA 1YIJ1 1X3ZA 4NFRA 1WCMI 3H3VJ 1VQ7Z 3FQMA 4AYBA 2VF1A 1VQ71 1YHQ1 3CCRZ 3GTOI 2K5RA 5IP9I 3HOWI 1QYPA 3FQQA 4A3DI 2Q4ZA 1N8R2 3I4MI 1KD12 4RVGA 3HOXI 4E33A 2QEX1 1QVGZ 2V8JA 1YI2Z 3HOYI 2GTIA 4E2XA 2RBLA 1S721 1M1K2 4XX2A 3S1QI 1VQKZ 2F4MA 1KD11 1K732 3MZKB 2J6AA 1VLAA 2LIYA 3EEDA 2YADA 4NBGA 3CME1 2R7ZI 1K731 2RT9A 1P9NA 4A3EI 1QVGY 3I4NI 2OTLZ 3RZOI 2OTL1 3NFZA 1KRLA 1Q862 3P5JB 2OTJZ 2PM9A 2GTHA 4CL1A 3J80b 5C44I 1VQMZ 1S7MA 1DL6A 3GTKI 1Q861 2RPRA 2OOYB 1ZB8A 3IFUA 3I551 5IT9f 3HKZA 3MZLB 1VQNZ 1LQLA 1TWAI 5LL6f 1YITZ 2QR1B 1RO4A 1ML8A 1VQN1 1YIT1 1Z01A 1VQ81 5D1PA 1Y1VS 5D1OA 4QTUA 2E2JI 4A3CI 3CXCZ 4A3GI 1RO2A 2M48A 4A93I 3S14I 3GTGI 1YJNZ 2JA6I 3M3YI 3CCLZ 3CD6Z 3D6WA 2JMOA 3GTLI 3S2HI 2NVTI 3HOUI 2AKLA 4NB9A 3CMA1 4X6AI 2JUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Z;  3CME Z;  3G6E Z;  1KC8 1;  1N8R 2;  3CXC Y;  3G71 Z;  3CCU 1;  1KD1 2;  3G6E 1;  1W2B Y;  2QEX 1;  1QVG Z;  1JJ2 Y;  3CCQ Z;  3CCS Z;  1YI2 Z;  2QA4 Z;  3CCQ 1;  1VQ5 1;  1S72 1;  1K8A 2;  1M1K 2;  1VQK Z;  1YJN 1;  1Q81 1;  2QA4 1;  1KD1 1;  3CCL 1;  1VQO Z;  1NJI 2;  3CD6 1;  3I56 Z;  3CCR 1;  1VQO 1;  1K73 2;  1K9M 1;  1K8A 1;  3CCV Z;  1YJW 1;  1VQ6 1;  1VQL Z;  1Q81 2;  3CME 1;  1NJI 1;  3CCV 1;  1KQS Z;  1Q82 2;  1VQL 1;  1K73 1;  1YJ9 Z;  3I55 Z;  1QVG Y;  3G71 1;  3CC7 Z;  2OTL Z;  1K9M 2;  1YJ9 1;  3CCS 1;  3CC7 1;  2OTL 1;  1YI2 1;  3OW2 Z;  1VQ8 Z;  1VQK 1;  1Q82 1;  1Q86 2;  3CPW Z;  2OTJ Z;  1M90 2;  3I56 1;  1VQM Z;  3G4S Z;  1YIJ Z;  1VQP Z;  3CCE Z;  1M1K 1;  1VQ4 Z;  3G4S 1;  3CCM Z;  1Q86 1;  1VQ9 Z;  3CCE 1;  1Q7Y 2;  3CC4 Z;  1KQS Y;  1VQ4 1;  3CCM 1;  1QVF Z;  1VQ9 1;  1YHQ Z;  1M90 1;  3I55 1;  3CMA Z;  3CC2 Z;  1VQN Z;  3OW2 Y;  1YIT Z;  1Q7Y 1;  3CC2 1;  1VQN 1;  1YIT 1;  1VQ8 1;  3CPW Y;  3CCU Z;  2QEX Z;  2OTJ 1;  3CXC Z;  1W2B Z;  1JJ2 Z;  1VQM 1;  1VQ5 Z;  1S72 Z;  1YIJ 1;  1VQP 1;  1YJN Z;  1VQ7 Z;  1QVF Y;  3CCL Z;  3CC4 1;  1N8R 1;  3CD6 Z;  1VQ7 1;  1YHQ 1;  3CCR Z;  1KC8 2;  3CCJ Z;  3CMA 1;  3CCJ 1;  1YJW Z; 
#chains in the Genus database with same CATH topology
 1VQ6 Z;  2V8K A;  2JS4 A;  1TWH I;  2PK7 A;  4MD9 A;  2NVY I;  2G2K A;  3VMH A;  3CXC Y;  3G71 Z;  3CCU 1;  1I3Q I;  1NUI A;  3TDH B;  2O53 A;  2VUG A;  1RQF A;  3J81 b;  4TNU A;  1VQ5 1;  3GTP I;  2JNY A;  1TWG I;  2VPX A;  4MRI A;  1VQO Z;  3JAM b;  1NJI 2;  5CM2 M;  3I56 Z;  2ZAE B;  3CCR 1;  1VQO 1;  2LEX A;  1K9M 1;  3KIH A;  3S16 I;  2P28 A;  2O4H A;  1YUA A;  2OOX B;  4NBD A;  3CCV Z;  4A3B I;  3IX0 A;  1NJI 1;  3CCV 1;  1Q82 2;  3BG0 B;  1YJ9 Z;  5AN9 F;  3CC7 Z;  2QKD A;  2E9H A;  2R6M A;  1YJ9 1;  3PO3 I;  3CC7 1;  2LFU A;  2IZ4 A;  1YI2 1;  5C3E I;  1Z03 A;  2E7Z A;  1ZH1 A;  1USP A;  3NH8 A;  1VQK 1;  1Q82 1;  4E2Z A;  1PFT A;  2DE7 A;  3IF8 A;  3F3P C;  3G4S Z;  1FDI A;  3KIF A;  1VQP Z;  3VB9 A;  3CCE Z;  3S1N I;  1VQ4 Z;  3G4S 1;  3CCM Z;  3CCE 1;  2JA8 I;  4BXX I;  4MXU A;  1Q7Y 2;  3CC4 Z;  1VQ4 1;  3CCM 1;  1QVF Z;  1WII A;  2HF1 A;  4RVD A;  4RV9 A;  2VUM I;  1Q7Y 1;  4NBF A;  3S1M I;  4MON A;  5FLX b;  2V8I A;  2W04 A;  2JA7 I;  3RZD I;  2OTJ 1;  3I07 A;  2OZK A;  4BY1 I;  3VMI A;  2JIO A;  1W2B Z;  4EWC A;  1VQM 1;  1FDO A;  3NH5 A;  1TWF I;  1QVF Y;  2B63 I;  4RVF A;  1KC8 2;  2BJO A;  1WJ2 A;  3TE5 B;  2YU9 I;  2V3V A;  1YJW Z;  2P3Y A;  4A3M I;  3M4O I;  3G6E Z;  1KC8 1;  2R93 I;  3GTJ I;  3G6E 1;  1W2B Y;  1X0T A;  3CCS Z;  3J80 f;  2QA4 Z;  1K83 I;  2WB1 A;  3U50 C;  1YJN 1;  2WAQ A;  1Q81 1;  2QA4 1;  1R9T I;  2RHB A;  3CCL 1;  3CD6 1;  1Z02 A;  3MON A;  2IZ3 A;  2Y0S A;  3LUS A;  2H85 A;  4QTT A;  1VQ6 1;  2W03 A;  3T4N B;  2QRC B;  4NBB A;  4MH4 A;  2JR6 A;  3G71 1;  5C4X I;  1Q16 A;  1K9M 2;  2R92 I;  4Y52 I;  2QRE B;  4MD7 A;  3D2L A;  3PO3 S;  4NB8 A;  3CPW Z;  2KI7 B;  5A2Q b;  2E2H I;  1TWC I;  1M90 2;  4BY7 I;  3I56 1;  3QWU A;  1YIJ Z;  3Q87 A;  3GTM I;  3K7A I;  1ZB9 A;  4BBS I;  4HGY A;  1SIW A;  2NAP A;  4RS4 A;  1YHQ Z;  3VTN A;  1M90 1;  4DGL A;  3D9X A;  2HU9 A;  3VMG A;  4HGZ A;  1QXF A;  2V45 A;  3J81 f;  4DQY B;  1N2F A;  3CPW Y;  1RLY A;  5FLM I;  3NDI A;  2QEX Z;  3JAM f;  3H0G I;  1TFI A;  1JJ2 Z;  2JA5 I;  3S15 I;  1NP6 A;  1S72 Z;  1VQP 1;  4NBA A;  5A2Q f;  4A3L I;  1L1O C;  2DE5 A;  4A3J I;  4NBH A;  3PO2 I;  3CC4 1;  1N8R 1;  4A3K I;  2PMZ A;  5T6B A;  4S1T A;  4Y7N I;  3CCJ Z;  2I3C A;  3S1R I;  3S17 I;  3CCJ 1;  1M1K 1;  1WW9 A;  2M6N A;  3CME Z;  3J7A 4;  2F4O A;  5D1O B;  5IT9 b;  2IV2 X;  3GKQ A;  3NH4 A;  1JJ2 Y;  3CCQ Z;  1QF8 A;  3CCQ 1;  1K8A 2;  4BBR I;  2E2I I;  2EGT A;  4E2Y A;  1RNI A;  4E2W A;  5C4J I;  4E31 A;  1YUK A;  5T64 A;  1Y8C A;  4A3I I;  1K8A 1;  1JWH C;  3ESW A;  4NH1 C;  3BG1 B;  1YJW 1;  1VQL Z;  1Q81 2;  1I50 I;  4NBE A;  2GU2 A;  1KQS Z;  1VQL 1;  2JIR A;  2QRD B;  3I55 Z;  5FLX f;  2NVX I;  3CCS 1;  3F3F C;  1RO0 A;  2VPY A;  4HH4 A;  1Y1W I;  3OW2 Z;  1VQ8 Z;  3HOZ I;  3FKI I;  1AA6 A;  2NVQ I;  4MD8 A;  1X3W A;  3EER A;  3IR7 A;  4E30 A;  2JIP A;  4NBC A;  2QLV B;  1VQ9 Z;  3NDJ A;  2DE6 A;  1SFO I;  1KQS Y;  1VQ9 1;  3GTM S;  4DK1 A;  3CQZ I;  3GTQ I;  3CMA Z;  3CC2 Z;  3OW2 Y;  5T67 A;  2K3R A;  1USP B;  4NOZ A;  1Y1V I;  3CC2 1;  5IP7 I;  3GCF A;  2JIQ A;  4A3F I;  2Q51 A;  4E32 A;  3CCU Z;  3S2D I;  2KPI A;  1I6H I;  2RIQ A;  3HOV I;  1VQ5 Z;  4RVH A;  1YIJ 1;  1X3Z A;  4NFR A;  1WCM I;  3H3V J;  1VQ7 Z;  3FQM A;  4AYB A;  2VF1 A;  1VQ7 1;  1YHQ 1;  3CCR Z;  3GTO I;  2K5R A;  5IP9 I;  3HOW I;  1QYP A;  3FQQ A;  4A3D I;  2Q4Z A;  1WZN A;  1N8R 2;  3I4M I;  1KD1 2;  4RVG A;  3HOX I;  4E33 A;  2QEX 1;  1QVG Z;  2V8J A;  1YI2 Z;  3HOY I;  2GTI A;  4E2X A;  2RBL A;  1S72 1;  1M1K 2;  4XX2 A;  3S1Q I;  1VQK Z;  2F4M A;  1KD1 1;  1K73 2;  3MZK B;  2J6A A;  1VLA A;  2LIY A;  3EED A;  2YAD A;  4NBG A;  3CME 1;  2R7Z I;  1K73 1;  2RT9 A;  1P9N A;  4A3E I;  1QVG Y;  3I4N I;  2OTL Z;  3RZO I;  2OTL 1;  3NFZ A;  1KRL A;  1Q86 2;  3P5J B;  2OTJ Z;  2PM9 A;  2GTH A;  4CL1 A;  3J80 b;  5C44 I;  1VQM Z;  1S7M A;  1DL6 A;  3GTK I;  1Q86 1;  2RPR A;  2OOY B;  1ZB8 A;  3IFU A;  3I55 1;  5IT9 f;  3HKZ A;  3MZL B;  1VQN Z;  1LQL A;  1TWA I;  5LL6 f;  1YIT Z;  2QR1 B;  1RO4 A;  1ML8 A;  1VQN 1;  1YIT 1;  1Z01 A;  1VQ8 1;  2VPZ A;  5D1P A;  1Y1V S;  5D1O A;  4QTU A;  2E2J I;  4A3C I;  3CXC Z;  4A3G I;  2VPW A;  1RO2 A;  2M48 A;  4A93 I;  3S14 I;  3GTG I;  1YJN Z;  2JA6 I;  3M3Y I;  3CCL Z;  3CD6 Z;  3D6W A;  2JMO A;  2JIM A;  3GTL I;  2AYD A;  3S2H I;  2NVT I;  3HOU I;  2AKL A;  4NB9 A;  3CMA 1;  4X6A I;  2JUB A; 
#chains in the Genus database with same CATH homology
 1VQ6 Z;  2V8K A;  2JS4 A;  1TWH I;  2PK7 A;  4MD9 A;  2NVY I;  2G2K A;  3VMH A;  3CXC Y;  3G71 Z;  3CCU 1;  1I3Q I;  1NUI A;  3TDH B;  2O53 A;  2VUG A;  1RQF A;  3J81 b;  4TNU A;  1VQ5 1;  3GTP I;  2JNY A;  1TWG I;  4MRI A;  1VQO Z;  3JAM b;  1NJI 2;  5CM2 M;  3I56 Z;  2ZAE B;  3CCR 1;  1VQO 1;  1K9M 1;  3KIH A;  3S16 I;  2P28 A;  2O4H A;  1YUA A;  2OOX B;  4NBD A;  3CCV Z;  4A3B I;  3IX0 A;  1NJI 1;  3CCV 1;  1Q82 2;  3BG0 B;  1YJ9 Z;  5AN9 F;  3CC7 Z;  2QKD A;  2E9H A;  2R6M A;  1YJ9 1;  3PO3 I;  3CC7 1;  2LFU A;  2IZ4 A;  1YI2 1;  5C3E I;  1Z03 A;  1ZH1 A;  1USP A;  3NH8 A;  1VQK 1;  1Q82 1;  4E2Z A;  1PFT A;  2DE7 A;  3IF8 A;  3F3P C;  3G4S Z;  3KIF A;  1VQP Z;  3VB9 A;  3CCE Z;  3S1N I;  1VQ4 Z;  3G4S 1;  3CCM Z;  3CCE 1;  2JA8 I;  4BXX I;  4MXU A;  1Q7Y 2;  3CC4 Z;  1VQ4 1;  3CCM 1;  1QVF Z;  1WII A;  2HF1 A;  4RVD A;  4RV9 A;  2VUM I;  1Q7Y 1;  4NBF A;  3S1M I;  4MON A;  5FLX b;  2V8I A;  2W04 A;  2JA7 I;  3RZD I;  2OTJ 1;  3I07 A;  2OZK A;  4BY1 I;  3VMI A;  1W2B Z;  4EWC A;  1VQM 1;  3NH5 A;  1TWF I;  1QVF Y;  2B63 I;  4RVF A;  1KC8 2;  2BJO A;  3TE5 B;  2YU9 I;  1YJW Z;  2P3Y A;  4A3M I;  3M4O I;  3G6E Z;  1KC8 1;  2R93 I;  3GTJ I;  3G6E 1;  1W2B Y;  1X0T A;  3CCS Z;  3J80 f;  2QA4 Z;  1K83 I;  2WB1 A;  3U50 C;  1YJN 1;  2WAQ A;  1Q81 1;  2QA4 1;  1R9T I;  2RHB A;  3CCL 1;  3CD6 1;  1Z02 A;  3MON A;  2IZ3 A;  2Y0S A;  3LUS A;  2H85 A;  4QTT A;  1VQ6 1;  2W03 A;  3T4N B;  2QRC B;  4NBB A;  4MH4 A;  2JR6 A;  3G71 1;  5C4X I;  1K9M 2;  2R92 I;  4Y52 I;  2QRE B;  4MD7 A;  3PO3 S;  4NB8 A;  3CPW Z;  2KI7 B;  5A2Q b;  2E2H I;  1TWC I;  1M90 2;  4BY7 I;  3I56 1;  3QWU A;  1YIJ Z;  3Q87 A;  3GTM I;  3K7A I;  1ZB9 A;  4BBS I;  4HGY A;  4RS4 A;  1YHQ Z;  3VTN A;  1M90 1;  4DGL A;  3D9X A;  2HU9 A;  3VMG A;  4HGZ A;  3J81 f;  4DQY B;  1N2F A;  3CPW Y;  1RLY A;  5FLM I;  3NDI A;  2QEX Z;  3JAM f;  3H0G I;  1TFI A;  1JJ2 Z;  2JA5 I;  3S15 I;  1NP6 A;  1S72 Z;  1VQP 1;  4NBA A;  5A2Q f;  4A3L I;  1L1O C;  2DE5 A;  4A3J I;  4NBH A;  3PO2 I;  3CC4 1;  1N8R 1;  4A3K I;  2PMZ A;  5T6B A;  4S1T A;  4Y7N I;  3CCJ Z;  2I3C A;  3S1R I;  3S17 I;  3CCJ 1;  1M1K 1;  1WW9 A;  2M6N A;  3CME Z;  3J7A 4;  2F4O A;  5D1O B;  5IT9 b;  3GKQ A;  3NH4 A;  1JJ2 Y;  3CCQ Z;  1QF8 A;  3CCQ 1;  1K8A 2;  4BBR I;  2E2I I;  2EGT A;  4E2Y A;  1RNI A;  4E2W A;  5C4J I;  4E31 A;  1YUK A;  5T64 A;  4A3I I;  1K8A 1;  1JWH C;  3ESW A;  4NH1 C;  3BG1 B;  1YJW 1;  1VQL Z;  1Q81 2;  1I50 I;  4NBE A;  2GU2 A;  1KQS Z;  1VQL 1;  2QRD B;  3I55 Z;  5FLX f;  2NVX I;  3CCS 1;  3F3F C;  1RO0 A;  4HH4 A;  1Y1W I;  3OW2 Z;  1VQ8 Z;  3HOZ I;  3FKI I;  2NVQ I;  4MD8 A;  1X3W A;  3EER A;  4E30 A;  4NBC A;  2QLV B;  1VQ9 Z;  3NDJ A;  2DE6 A;  1SFO I;  1KQS Y;  1VQ9 1;  3GTM S;  4DK1 A;  3CQZ I;  3GTQ I;  3CMA Z;  3CC2 Z;  3OW2 Y;  5T67 A;  2K3R A;  1USP B;  4NOZ A;  1Y1V I;  3CC2 1;  5IP7 I;  3GCF A;  4A3F I;  2Q51 A;  4E32 A;  3CCU Z;  3S2D I;  2KPI A;  1I6H I;  2RIQ A;  3HOV I;  1VQ5 Z;  4RVH A;  1YIJ 1;  1X3Z A;  4NFR A;  1WCM I;  3H3V J;  1VQ7 Z;  3FQM A;  4AYB A;  2VF1 A;  1VQ7 1;  1YHQ 1;  3CCR Z;  3GTO I;  2K5R A;  5IP9 I;  3HOW I;  1QYP A;  3FQQ A;  4A3D I;  2Q4Z A;  1N8R 2;  3I4M I;  1KD1 2;  4RVG A;  3HOX I;  4E33 A;  2QEX 1;  1QVG Z;  2V8J A;  1YI2 Z;  3HOY I;  2GTI A;  4E2X A;  2RBL A;  1S72 1;  1M1K 2;  4XX2 A;  3S1Q I;  1VQK Z;  2F4M A;  1KD1 1;  1K73 2;  3MZK B;  2J6A A;  1VLA A;  2LIY A;  3EED A;  2YAD A;  4NBG A;  3CME 1;  2R7Z I;  1K73 1;  2RT9 A;  1P9N A;  4A3E I;  1QVG Y;  3I4N I;  2OTL Z;  3RZO I;  2OTL 1;  3NFZ A;  1KRL A;  1Q86 2;  3P5J B;  2OTJ Z;  2PM9 A;  2GTH A;  4CL1 A;  3J80 b;  5C44 I;  1VQM Z;  1S7M A;  1DL6 A;  3GTK I;  1Q86 1;  2RPR A;  2OOY B;  1ZB8 A;  3IFU A;  3I55 1;  5IT9 f;  3HKZ A;  3MZL B;  1VQN Z;  1LQL A;  1TWA I;  5LL6 f;  1YIT Z;  2QR1 B;  1RO4 A;  1ML8 A;  1VQN 1;  1YIT 1;  1Z01 A;  1VQ8 1;  5D1P A;  1Y1V S;  5D1O A;  4QTU A;  2E2J I;  4A3C I;  3CXC Z;  4A3G I;  1RO2 A;  2M48 A;  4A93 I;  3S14 I;  3GTG I;  1YJN Z;  2JA6 I;  3M3Y I;  3CCL Z;  3CD6 Z;  3D6W A;  2JMO A;  3GTL I;  3S2H I;  2NVT I;  3HOU I;  2AKL A;  4NB9 A;  3CMA 1;  4X6A I;  2JUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...