1N8R1

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r100
3CCQZ 1K9M1 3CD6Z 1YITZ 1VQK1 3CCVZ 1QVGZ 1Q821 1VQMZ 1VQNZ 1VQ4Z 3I551 3CCLZ 3CCS1 1VQ41 1VQM1 3CCMZ 1KQSY 1VQ61 2QEX1 1Q861 3CCV1 1VQLZ 3CCUZ 3CMA1 3G4S1 1VQ71 3G6EZ 3CCSZ 3G71Z 1M1K1 1YI21 3I561 1JJ2Z 1S72Z 3CC7Z 2QEXZ 3CCJ1 3I56Z 3CPWY 1VQN1 1VQ7Z 1M1K2 3CC41 1K732 1QVFZ 1N8R2 3G711 3CC21 1KD11 1N8R1 3CMEZ 1YJN1 1YJW1 3CXCY 3CC4Z 1VQ9Z 3CC2Z 1YJNZ 1VQ51 1KD12 2OTLZ 2OTJZ 1W2BY 1K731 1VQP1 1YHQZ 1Q7Y1 1YIT1 3CCM1 1NJI1 3I55Z 1S721 1VQPZ 3CCJZ 1QVGY 3CMAZ 3CCU1 1Q862 1VQ5Z 1VQL1 1K8A2 2OTL1 3CCRZ 2OTJ1 3CCEZ 1YIJZ 1W2BZ 1KQSZ 3CPWZ 1M902 3CCR1 1YJWZ 3CME1 1VQO1 1KC82 3G4SZ 1M901 3CCE1 1YIJ1 1YJ9Z 2QA41 1QVFY 3CXCZ 1Q822 1NJI2 1VQ81 3OW2Y 1Q811 1VQ6Z 1YJ91 3CCL1 3CCQ1 3CC71 1VQ8Z 1YHQ1 1VQKZ 1JJ2Y 1KC81 1Q812 3G6E1 1K8A1 1Q7Y2 1K9M2 1VQ91 2QA4Z 3CD61 1YI2Z 1VQOZ 3OW2Z
chains in the Genus database with same CATH superfamily
1WIIA 4HH4A 1K9M1 1YITZ 1VQK1 5T6BA 2F4MA 1QVGZ 2QRDB 1FDOA 1VQMZ 1RQFA 1ZH1A 3CCLZ 2VPYA 3IF8A 4NBHA 5CM2M 2DE5A 4DK1A 2QEX1 3GTMS 4MD8A 3S2HI 3M4OI 3GTMI 2EGTA 3G4S1 3G6EZ 3FQQA 4X6AI 5IP7I 3CCSZ 3G71Z 2PMZA 3I4NI 4NFRA 1S72Z 2Q51A 3CCJ1 3HOUI 4CL1A 3ESWA 3D6WA 3MZLB 1N8R1 3CMEZ 1YJW1 4RVHA 3F3FC 2QKDA 1KD12 2P3YA 4MD7A 1W2BY 3S17I 2AYDA 1YHQZ 4DGLA 3PO3I 4RV9A 1Q7Y1 3I4MI 2R92I 2IZ4A 3M3YI 1S721 2WAQA 4A3BI 3CCJZ 1QVGY 2VPZA 1VQL1 2OTL1 4BXXI 3MZKB 2PM9A 2JA5I 1QF8A 3BG1B 3D2LA 3GTLI 2OTJ1 3CCEZ 2G2KA 1KQSZ 4A3II 3S1QI 2RIQA 3KIFA 4NBGA 4A3EI 3EERA 1YIJ1 2JA7I 2Q4ZA 2YADA 3TE5B 1WZNA 4E30A 3CC71 1YHQ1 1DL6A 3VMGA 3NH4A 3S1MI 1X3WA 2LEXA 2LFUA 1K8A1 1ZB8A 2J6AA 1VQ91 2JIRA 4AYBA 3HOZI 2DE7A 3Q87A 2O4HA 2RT9A 3GTOI 2E2HI 3CCQZ 1ZB9A 4BBSI 1VQ4Z 2JIPA 2R7ZI 2V3VA 5D1OB 3S1RI 4NBAA 5FLXf 4TNUA 1VQ41 1X3ZA 1VLAA 5A2Qb 1KQSY 2NVTI 3H3VJ 4NBBA 4QTTA 3CCV1 3CMA1 2E9HA 1VQ71 2PK7A 1Z03A 3D9XA 2KPIA 2DE6A 1S7MA 2V8KA 3GCFA 2JA6I 3S15I 3PO3S 5FLMI 3CPWY 3VMIA 5IT9b 1YUAA 1YUKA 2VUGA 2QRCB 4A3GI 3CC4Z 3RZOI 1Y1WI 3CC2Z 2IZ3A 3FKII 2OTLZ 2GU2A 4A93I 3K7AI 3KIHA 4HGZA 1YIT1 1NJI1 4DQYB 1WCMI 4RVGA 4MXUA 3CCU1 1VQ5Z 2B63I 3HOYI 3IR7A 2HF1A 3P5JB 1YIJZ 1W2BZ 1QXFA 3J7A4 3CME1 1YJWZ 3S16I 1USPB 2R93I 2JIMA 2QA41 2F4OA 2RPRA 5FLXb 1Q811 2GTHA 1VQ6Z 4E31A 2VPXA 3CCL1 3CCQ1 1VQ8Z 3VMHA 1VQKZ 4NBFA 1KC81 2GTIA 1I3QI 2R6MA 1Q812 1Q7Y2 2K5RA 1K9M2 3J81b 4A3FI 1YI2Z 1VQOZ 4A3JI 2JMOA 4NBCA 1TFIA 2V8IA 3CD6Z 1AA6A 4E2ZA 5LL6f 1Q821 3S2DI 1VQNZ 3I551 4E2XA 3U50C 1Y1VI 2O53A 3CCS1 1RO0A 1VQM1 2JUBA 3CCMZ 3IX0A 1Y8CA 1Q861 2VUMI 1WJ2A 4RVDA 1RO4A 1VQLZ 3GTKI 5C3EI 2H85A 3QWUA 3J81f 1WW9A 1M1K1 1YI21 1Y1VS 2LIYA 4Y7NI 2I3CA 1P9NA 2QEXZ 1NP6A 2JIOA 3I56Z 1LQLA 1TWHI 1SIWA 2W04A 3BG0B 3NFZA 2BJOA 4NB8A 3J80b 1VQ7Z 1M1K2 1RLYA 1N8R2 3G711 3CC21 1YJN1 1Z01A 2NAPA 4A3LI 3NH8A 4E2YA 2JR6A 4A3MI 2IV2X 3TDHB 1VQ9Z 1YJNZ 1K83I 2VPWA 4NBDA 1K731 1L1OC 1TWGI 1KRLA 3EEDA 3NDJA 3I55Z 1I50I 1VQPZ 1RNIA 2JNYA 3F3PC 2VF1A 1SFOI 4XX2A 1Q862 1K8A2 2OZKA 3IFUA 3CPWZ 1M902 3CCR1 2OOXB 3HOVI 2NVXI 1KC82 3G4SZ 4BY1I 3CXCZ 1Q822 4NH1C 1VQ81 4A3DI 3NH5A 5C44I 3GTJI 2RBLA 4RS4A 2E2JI 5C4JI 2K3RA 2WB1A 5D1PA 4MONA 4NBEA 1ML8A 1TWFI 1FDIA 2KI7B 3G6E1 3CD61 3OW2Z 3JAMb 2V8JA 4A3KI 3CCVZ 2M48A 3JAMf 2OOYB 5A2Qf 3GTGI 2JS4A 2JA8I 3PO2I 2QR1B 3H0GI 1VQ61 1RO2A 3S1NI 1N2FA 1NUIA 3CCUZ 3S14I 2E7ZA 1R9TI 4Y52I 2ZAEB 1QYPA 4EWCA 3LUSA 5IP9I 3I561 4MD9A 1JJ2Z 4E32A 4E33A 3CC7Z 3NDIA 3J80f 4NOZA 5D1OA 3T4NB 1VQN1 3VB9A 2NVYI 3CC41 3HKZA 4HGYA 1K732 5T67A 1I6HI 1QVFZ 3GTPI 3GTQI 2QREB 1KD11 3CXCY 3GKQA 4MRIA 1PFTA 3HOXI 4MH4A 2V45A 1VQ51 2NVQI 2OTJZ 2E2II 1VQP1 5AN9F 4RVFA 4A3CI 5T64A 3CCM1 2Y0SA 4NB9A 3RZDI 4QTUA 3CMAZ 3I07A 4BBRI 3CCRZ 4BY7I 1JWHC 5IT9f 4E2WA 1X0TA 1TWCI 2HU9A 4S1TA 1VQO1 3VTNA 1M901 3CCE1 1YJ9Z 2AKLA 1Z02A 3CQZI 1QVFY 1NJI2 3MONA 3OW2Y 1YJ91 2M6NA 3FQMA 1JJ2Y 2YU9I 2RHBA 1Q16A 5C4XI 2JIQA 2QA4Z 1TWAI 1USPA 2P28A 3HOWI 2W03A 2QLVB
chains in the Genus database with same CATH topology
1WIIA 4HH4A 1K9M1 1YITZ 1VQK1 5T6BA 2F4MA 1QVGZ 2QRDB 1VQMZ 1RQFA 1ZH1A 3CCLZ 3IF8A 4NBHA 5CM2M 2DE5A 4DK1A 2QEX1 3GTMS 4MD8A 3S2HI 3M4OI 3GTMI 2EGTA 3G4S1 3G6EZ 3FQQA 4X6AI 5IP7I 3CCSZ 3G71Z 2PMZA 3I4NI 4NFRA 1S72Z 2Q51A 3CCJ1 3HOUI 4CL1A 3ESWA 3D6WA 3MZLB 1N8R1 3CMEZ 1YJW1 4RVHA 3F3FC 2QKDA 1KD12 2P3YA 4MD7A 1W2BY 3S17I 1YHQZ 4DGLA 3PO3I 4RV9A 1Q7Y1 3I4MI 2R92I 2IZ4A 3M3YI 1S721 2WAQA 4A3BI 3CCJZ 1QVGY 1VQL1 2OTL1 4BXXI 3MZKB 2PM9A 2JA5I 1QF8A 3BG1B 3GTLI 2OTJ1 3CCEZ 2G2KA 1KQSZ 4A3II 3S1QI 2RIQA 3KIFA 4NBGA 4A3EI 3EERA 1YIJ1 2JA7I 2Q4ZA 2YADA 3TE5B 4E30A 3CC71 1YHQ1 1DL6A 3VMGA 3NH4A 3S1MI 1X3WA 2LFUA 1K8A1 1ZB8A 2J6AA 1VQ91 4AYBA 3HOZI 2DE7A 3Q87A 2O4HA 2RT9A 3GTOI 2E2HI 3CCQZ 1ZB9A 4BBSI 1VQ4Z 2R7ZI 5D1OB 3S1RI 4NBAA 5FLXf 4TNUA 1VQ41 1X3ZA 1VLAA 5A2Qb 1KQSY 2NVTI 3H3VJ 4NBBA 4QTTA 3CCV1 3CMA1 2E9HA 1VQ71 2PK7A 1Z03A 3D9XA 2KPIA 2DE6A 1S7MA 2V8KA 3GCFA 2JA6I 3S15I 3PO3S 5FLMI 3CPWY 3VMIA 5IT9b 1YUAA 1YUKA 2VUGA 2QRCB 4A3GI 3CC4Z 3RZOI 1Y1WI 3CC2Z 2IZ3A 3FKII 2OTLZ 2GU2A 4A93I 3K7AI 3KIHA 4HGZA 1YIT1 1NJI1 4DQYB 1WCMI 4RVGA 4MXUA 3CCU1 1VQ5Z 2B63I 3HOYI 2HF1A 3P5JB 1YIJZ 1W2BZ 3J7A4 3CME1 1YJWZ 3S16I 1USPB 2R93I 2QA41 2F4OA 2RPRA 5FLXb 1Q811 2GTHA 1VQ6Z 4E31A 3CCL1 3CCQ1 1VQ8Z 3VMHA 1VQKZ 4NBFA 1KC81 2GTIA 1I3QI 2R6MA 1Q812 1Q7Y2 2K5RA 1K9M2 3J81b 4A3FI 1YI2Z 1VQOZ 4A3JI 2JMOA 4NBCA 1TFIA 2V8IA 3CD6Z 4E2ZA 5LL6f 1Q821 3S2DI 1VQNZ 3I551 4E2XA 3U50C 1Y1VI 2O53A 3CCS1 1RO0A 1VQM1 2JUBA 3CCMZ 3IX0A 1Q861 2VUMI 4RVDA 1RO4A 1VQLZ 3GTKI 5C3EI 2H85A 3QWUA 3J81f 1WW9A 1M1K1 1YI21 1Y1VS 2LIYA 4Y7NI 2I3CA 1P9NA 2QEXZ 1NP6A 3I56Z 1LQLA 1TWHI 2W04A 3BG0B 3NFZA 2BJOA 4NB8A 3J80b 1VQ7Z 1M1K2 1RLYA 1N8R2 3G711 3CC21 1YJN1 1Z01A 4A3LI 3NH8A 4E2YA 2JR6A 4A3MI 3TDHB 1VQ9Z 1YJNZ 1K83I 4NBDA 1K731 1L1OC 1TWGI 1KRLA 3EEDA 3NDJA 3I55Z 1I50I 1VQPZ 1RNIA 2JNYA 3F3PC 2VF1A 1SFOI 4XX2A 1Q862 1K8A2 2OZKA 3IFUA 3CPWZ 1M902 3CCR1 2OOXB 3HOVI 2NVXI 1KC82 3G4SZ 4BY1I 3CXCZ 1Q822 4NH1C 1VQ81 4A3DI 3NH5A 5C44I 3GTJI 2RBLA 4RS4A 2E2JI 5C4JI 2K3RA 2WB1A 5D1PA 4MONA 4NBEA 1ML8A 1TWFI 2KI7B 3G6E1 3CD61 3OW2Z 3JAMb 2V8JA 4A3KI 3CCVZ 2M48A 3JAMf 2OOYB 5A2Qf 3GTGI 2JS4A 2JA8I 3PO2I 2QR1B 3H0GI 1VQ61 1RO2A 3S1NI 1N2FA 1NUIA 3CCUZ 3S14I 1R9TI 4Y52I 2ZAEB 1QYPA 4EWCA 3LUSA 5IP9I 3I561 4MD9A 1JJ2Z 4E32A 4E33A 3CC7Z 3NDIA 3J80f 4NOZA 5D1OA 3T4NB 1VQN1 3VB9A 2NVYI 3CC41 3HKZA 4HGYA 1K732 5T67A 1I6HI 1QVFZ 3GTPI 3GTQI 2QREB 1KD11 3CXCY 3GKQA 4MRIA 1PFTA 3HOXI 4MH4A 1VQ51 2NVQI 2OTJZ 2E2II 1VQP1 5AN9F 4RVFA 4A3CI 5T64A 3CCM1 2Y0SA 4NB9A 3RZDI 4QTUA 3CMAZ 3I07A 4BBRI 3CCRZ 4BY7I 1JWHC 5IT9f 4E2WA 1X0TA 1TWCI 2HU9A 4S1TA 1VQO1 3VTNA 1M901 3CCE1 1YJ9Z 2AKLA 1Z02A 3CQZI 1QVFY 1NJI2 3MONA 3OW2Y 1YJ91 2M6NA 3FQMA 1JJ2Y 2YU9I 2RHBA 5C4XI 2QA4Z 1TWAI 1USPA 2P28A 3HOWI 2W03A 2QLVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ Z;  1K9M 1;  3CD6 Z;  1YIT Z;  1VQK 1;  3CCV Z;  1QVG Z;  1Q82 1;  1VQM Z;  1VQN Z;  1VQ4 Z;  3I55 1;  3CCL Z;  3CCS 1;  1VQ4 1;  1VQM 1;  3CCM Z;  1KQS Y;  1VQ6 1;  2QEX 1;  1Q86 1;  3CCV 1;  1VQL Z;  3CCU Z;  3CMA 1;  3G4S 1;  1VQ7 1;  3G6E Z;  3CCS Z;  3G71 Z;  1M1K 1;  1YI2 1;  3I56 1;  1JJ2 Z;  1S72 Z;  3CC7 Z;  2QEX Z;  3CCJ 1;  3I56 Z;  3CPW Y;  1VQN 1;  1VQ7 Z;  1M1K 2;  3CC4 1;  1K73 2;  1QVF Z;  1N8R 2;  3G71 1;  3CC2 1;  1KD1 1;  1N8R 1;  3CME Z;  1YJN 1;  1YJW 1;  3CXC Y;  3CC4 Z;  1VQ9 Z;  3CC2 Z;  1YJN Z;  1VQ5 1;  1KD1 2;  2OTL Z;  2OTJ Z;  1W2B Y;  1K73 1;  1VQP 1;  1YHQ Z;  1Q7Y 1;  1YIT 1;  3CCM 1;  1NJI 1;  3I55 Z;  1S72 1;  1VQP Z;  3CCJ Z;  1QVG Y;  3CMA Z;  3CCU 1;  1Q86 2;  1VQ5 Z;  1VQL 1;  1K8A 2;  2OTL 1;  3CCR Z;  2OTJ 1;  3CCE Z;  1YIJ Z;  1W2B Z;  1KQS Z;  3CPW Z;  1M90 2;  3CCR 1;  1YJW Z;  3CME 1;  1VQO 1;  1KC8 2;  3G4S Z;  1M90 1;  3CCE 1;  1YIJ 1;  1YJ9 Z;  2QA4 1;  1QVF Y;  3CXC Z;  1Q82 2;  1NJI 2;  1VQ8 1;  3OW2 Y;  1Q81 1;  1VQ6 Z;  1YJ9 1;  3CCL 1;  3CCQ 1;  3CC7 1;  1VQ8 Z;  1YHQ 1;  1VQK Z;  1JJ2 Y;  1KC8 1;  1Q81 2;  3G6E 1;  1K8A 1;  1Q7Y 2;  1K9M 2;  1VQ9 1;  2QA4 Z;  3CD6 1;  1YI2 Z;  1VQO Z;  3OW2 Z; 
#chains in the Genus database with same CATH topology
 1WII A;  4HH4 A;  1K9M 1;  1YIT Z;  1VQK 1;  5T6B A;  2F4M A;  1QVG Z;  2QRD B;  1FDO A;  1VQM Z;  1RQF A;  1ZH1 A;  3CCL Z;  2VPY A;  3IF8 A;  4NBH A;  5CM2 M;  2DE5 A;  4DK1 A;  2QEX 1;  3GTM S;  4MD8 A;  3S2H I;  3M4O I;  3GTM I;  2EGT A;  3G4S 1;  3G6E Z;  3FQQ A;  4X6A I;  5IP7 I;  3CCS Z;  3G71 Z;  2PMZ A;  3I4N I;  4NFR A;  1S72 Z;  2Q51 A;  3CCJ 1;  3HOU I;  4CL1 A;  3ESW A;  3D6W A;  3MZL B;  1N8R 1;  3CME Z;  1YJW 1;  4RVH A;  3F3F C;  2QKD A;  1KD1 2;  2P3Y A;  4MD7 A;  1W2B Y;  3S17 I;  2AYD A;  1YHQ Z;  4DGL A;  3PO3 I;  4RV9 A;  1Q7Y 1;  3I4M I;  2R92 I;  2IZ4 A;  3M3Y I;  1S72 1;  2WAQ A;  4A3B I;  3CCJ Z;  1QVG Y;  2VPZ A;  1VQL 1;  2OTL 1;  4BXX I;  3MZK B;  2PM9 A;  2JA5 I;  1QF8 A;  3BG1 B;  3D2L A;  3GTL I;  2OTJ 1;  3CCE Z;  2G2K A;  1KQS Z;  4A3I I;  3S1Q I;  2RIQ A;  3KIF A;  4NBG A;  4A3E I;  3EER A;  1YIJ 1;  2JA7 I;  2Q4Z A;  2YAD A;  3TE5 B;  1WZN A;  4E30 A;  3CC7 1;  1YHQ 1;  1DL6 A;  3VMG A;  3NH4 A;  3S1M I;  1X3W A;  2LEX A;  2LFU A;  1K8A 1;  1ZB8 A;  2J6A A;  1VQ9 1;  2JIR A;  4AYB A;  3HOZ I;  2DE7 A;  3Q87 A;  2O4H A;  2RT9 A;  3GTO I;  2E2H I;  3CCQ Z;  1ZB9 A;  4BBS I;  1VQ4 Z;  2JIP A;  2R7Z I;  2V3V A;  5D1O B;  3S1R I;  4NBA A;  5FLX f;  4TNU A;  1VQ4 1;  1X3Z A;  1VLA A;  5A2Q b;  1KQS Y;  2NVT I;  3H3V J;  4NBB A;  4QTT A;  3CCV 1;  3CMA 1;  2E9H A;  1VQ7 1;  2PK7 A;  1Z03 A;  3D9X A;  2KPI A;  2DE6 A;  1S7M A;  2V8K A;  3GCF A;  2JA6 I;  3S15 I;  3PO3 S;  5FLM I;  3CPW Y;  3VMI A;  5IT9 b;  1YUA A;  1YUK A;  2VUG A;  2QRC B;  4A3G I;  3CC4 Z;  3RZO I;  1Y1W I;  3CC2 Z;  2IZ3 A;  3FKI I;  2OTL Z;  2GU2 A;  4A93 I;  3K7A I;  3KIH A;  4HGZ A;  1YIT 1;  1NJI 1;  4DQY B;  1WCM I;  4RVG A;  4MXU A;  3CCU 1;  1VQ5 Z;  2B63 I;  3HOY I;  3IR7 A;  2HF1 A;  3P5J B;  1YIJ Z;  1W2B Z;  1QXF A;  3J7A 4;  3CME 1;  1YJW Z;  3S16 I;  1USP B;  2R93 I;  2JIM A;  2QA4 1;  2F4O A;  2RPR A;  5FLX b;  1Q81 1;  2GTH A;  1VQ6 Z;  4E31 A;  2VPX A;  3CCL 1;  3CCQ 1;  1VQ8 Z;  3VMH A;  1VQK Z;  4NBF A;  1KC8 1;  2GTI A;  1I3Q I;  2R6M A;  1Q81 2;  1Q7Y 2;  2K5R A;  1K9M 2;  3J81 b;  4A3F I;  1YI2 Z;  1VQO Z;  4A3J I;  2JMO A;  4NBC A;  1TFI A;  2V8I A;  3CD6 Z;  1AA6 A;  4E2Z A;  5LL6 f;  1Q82 1;  3S2D I;  1VQN Z;  3I55 1;  4E2X A;  3U50 C;  1Y1V I;  2O53 A;  3CCS 1;  1RO0 A;  1VQM 1;  2JUB A;  3CCM Z;  3IX0 A;  1Y8C A;  1Q86 1;  2VUM I;  1WJ2 A;  4RVD A;  1RO4 A;  1VQL Z;  3GTK I;  5C3E I;  2H85 A;  3QWU A;  3J81 f;  1WW9 A;  1M1K 1;  1YI2 1;  1Y1V S;  2LIY A;  4Y7N I;  2I3C A;  1P9N A;  2QEX Z;  1NP6 A;  2JIO A;  3I56 Z;  1LQL A;  1TWH I;  1SIW A;  2W04 A;  3BG0 B;  3NFZ A;  2BJO A;  4NB8 A;  3J80 b;  1VQ7 Z;  1M1K 2;  1RLY A;  1N8R 2;  3G71 1;  3CC2 1;  1YJN 1;  1Z01 A;  2NAP A;  4A3L I;  3NH8 A;  4E2Y A;  2JR6 A;  4A3M I;  2IV2 X;  3TDH B;  1VQ9 Z;  1YJN Z;  1K83 I;  2VPW A;  4NBD A;  1K73 1;  1L1O C;  1TWG I;  1KRL A;  3EED A;  3NDJ A;  3I55 Z;  1I50 I;  1VQP Z;  1RNI A;  2JNY A;  3F3P C;  2VF1 A;  1SFO I;  4XX2 A;  1Q86 2;  1K8A 2;  2OZK A;  3IFU A;  3CPW Z;  1M90 2;  3CCR 1;  2OOX B;  3HOV I;  2NVX I;  1KC8 2;  3G4S Z;  4BY1 I;  3CXC Z;  1Q82 2;  4NH1 C;  1VQ8 1;  4A3D I;  3NH5 A;  5C44 I;  3GTJ I;  2RBL A;  4RS4 A;  2E2J I;  5C4J I;  2K3R A;  2WB1 A;  5D1P A;  4MON A;  4NBE A;  1ML8 A;  1TWF I;  1FDI A;  2KI7 B;  3G6E 1;  3CD6 1;  3OW2 Z;  3JAM b;  2V8J A;  4A3K I;  3CCV Z;  2M48 A;  3JAM f;  2OOY B;  5A2Q f;  3GTG I;  2JS4 A;  2JA8 I;  3PO2 I;  2QR1 B;  3H0G I;  1VQ6 1;  1RO2 A;  3S1N I;  1N2F A;  1NUI A;  3CCU Z;  3S14 I;  2E7Z A;  1R9T I;  4Y52 I;  2ZAE B;  1QYP A;  4EWC A;  3LUS A;  5IP9 I;  3I56 1;  4MD9 A;  1JJ2 Z;  4E32 A;  4E33 A;  3CC7 Z;  3NDI A;  3J80 f;  4NOZ A;  5D1O A;  3T4N B;  1VQN 1;  3VB9 A;  2NVY I;  3CC4 1;  3HKZ A;  4HGY A;  1K73 2;  5T67 A;  1I6H I;  1QVF Z;  3GTP I;  3GTQ I;  2QRE B;  1KD1 1;  3CXC Y;  3GKQ A;  4MRI A;  1PFT A;  3HOX I;  4MH4 A;  2V45 A;  1VQ5 1;  2NVQ I;  2OTJ Z;  2E2I I;  1VQP 1;  5AN9 F;  4RVF A;  4A3C I;  5T64 A;  3CCM 1;  2Y0S A;  4NB9 A;  3RZD I;  4QTU A;  3CMA Z;  3I07 A;  4BBR I;  3CCR Z;  4BY7 I;  1JWH C;  5IT9 f;  4E2W A;  1X0T A;  1TWC I;  2HU9 A;  4S1T A;  1VQO 1;  3VTN A;  1M90 1;  3CCE 1;  1YJ9 Z;  2AKL A;  1Z02 A;  3CQZ I;  1QVF Y;  1NJI 2;  3MON A;  3OW2 Y;  1YJ9 1;  2M6N A;  3FQM A;  1JJ2 Y;  2YU9 I;  2RHB A;  1Q16 A;  5C4X I;  2JIQ A;  2QA4 Z;  1TWA I;  1USP A;  2P28 A;  3HOW I;  2W03 A;  2QLV B; 
#chains in the Genus database with same CATH homology
 1WII A;  4HH4 A;  1K9M 1;  1YIT Z;  1VQK 1;  5T6B A;  2F4M A;  1QVG Z;  2QRD B;  1VQM Z;  1RQF A;  1ZH1 A;  3CCL Z;  3IF8 A;  4NBH A;  5CM2 M;  2DE5 A;  4DK1 A;  2QEX 1;  3GTM S;  4MD8 A;  3S2H I;  3M4O I;  3GTM I;  2EGT A;  3G4S 1;  3G6E Z;  3FQQ A;  4X6A I;  5IP7 I;  3CCS Z;  3G71 Z;  2PMZ A;  3I4N I;  4NFR A;  1S72 Z;  2Q51 A;  3CCJ 1;  3HOU I;  4CL1 A;  3ESW A;  3D6W A;  3MZL B;  1N8R 1;  3CME Z;  1YJW 1;  4RVH A;  3F3F C;  2QKD A;  1KD1 2;  2P3Y A;  4MD7 A;  1W2B Y;  3S17 I;  1YHQ Z;  4DGL A;  3PO3 I;  4RV9 A;  1Q7Y 1;  3I4M I;  2R92 I;  2IZ4 A;  3M3Y I;  1S72 1;  2WAQ A;  4A3B I;  3CCJ Z;  1QVG Y;  1VQL 1;  2OTL 1;  4BXX I;  3MZK B;  2PM9 A;  2JA5 I;  1QF8 A;  3BG1 B;  3GTL I;  2OTJ 1;  3CCE Z;  2G2K A;  1KQS Z;  4A3I I;  3S1Q I;  2RIQ A;  3KIF A;  4NBG A;  4A3E I;  3EER A;  1YIJ 1;  2JA7 I;  2Q4Z A;  2YAD A;  3TE5 B;  4E30 A;  3CC7 1;  1YHQ 1;  1DL6 A;  3VMG A;  3NH4 A;  3S1M I;  1X3W A;  2LFU A;  1K8A 1;  1ZB8 A;  2J6A A;  1VQ9 1;  4AYB A;  3HOZ I;  2DE7 A;  3Q87 A;  2O4H A;  2RT9 A;  3GTO I;  2E2H I;  3CCQ Z;  1ZB9 A;  4BBS I;  1VQ4 Z;  2R7Z I;  5D1O B;  3S1R I;  4NBA A;  5FLX f;  4TNU A;  1VQ4 1;  1X3Z A;  1VLA A;  5A2Q b;  1KQS Y;  2NVT I;  3H3V J;  4NBB A;  4QTT A;  3CCV 1;  3CMA 1;  2E9H A;  1VQ7 1;  2PK7 A;  1Z03 A;  3D9X A;  2KPI A;  2DE6 A;  1S7M A;  2V8K A;  3GCF A;  2JA6 I;  3S15 I;  3PO3 S;  5FLM I;  3CPW Y;  3VMI A;  5IT9 b;  1YUA A;  1YUK A;  2VUG A;  2QRC B;  4A3G I;  3CC4 Z;  3RZO I;  1Y1W I;  3CC2 Z;  2IZ3 A;  3FKI I;  2OTL Z;  2GU2 A;  4A93 I;  3K7A I;  3KIH A;  4HGZ A;  1YIT 1;  1NJI 1;  4DQY B;  1WCM I;  4RVG A;  4MXU A;  3CCU 1;  1VQ5 Z;  2B63 I;  3HOY I;  2HF1 A;  3P5J B;  1YIJ Z;  1W2B Z;  3J7A 4;  3CME 1;  1YJW Z;  3S16 I;  1USP B;  2R93 I;  2QA4 1;  2F4O A;  2RPR A;  5FLX b;  1Q81 1;  2GTH A;  1VQ6 Z;  4E31 A;  3CCL 1;  3CCQ 1;  1VQ8 Z;  3VMH A;  1VQK Z;  4NBF A;  1KC8 1;  2GTI A;  1I3Q I;  2R6M A;  1Q81 2;  1Q7Y 2;  2K5R A;  1K9M 2;  3J81 b;  4A3F I;  1YI2 Z;  1VQO Z;  4A3J I;  2JMO A;  4NBC A;  1TFI A;  2V8I A;  3CD6 Z;  4E2Z A;  5LL6 f;  1Q82 1;  3S2D I;  1VQN Z;  3I55 1;  4E2X A;  3U50 C;  1Y1V I;  2O53 A;  3CCS 1;  1RO0 A;  1VQM 1;  2JUB A;  3CCM Z;  3IX0 A;  1Q86 1;  2VUM I;  4RVD A;  1RO4 A;  1VQL Z;  3GTK I;  5C3E I;  2H85 A;  3QWU A;  3J81 f;  1WW9 A;  1M1K 1;  1YI2 1;  1Y1V S;  2LIY A;  4Y7N I;  2I3C A;  1P9N A;  2QEX Z;  1NP6 A;  3I56 Z;  1LQL A;  1TWH I;  2W04 A;  3BG0 B;  3NFZ A;  2BJO A;  4NB8 A;  3J80 b;  1VQ7 Z;  1M1K 2;  1RLY A;  1N8R 2;  3G71 1;  3CC2 1;  1YJN 1;  1Z01 A;  4A3L I;  3NH8 A;  4E2Y A;  2JR6 A;  4A3M I;  3TDH B;  1VQ9 Z;  1YJN Z;  1K83 I;  4NBD A;  1K73 1;  1L1O C;  1TWG I;  1KRL A;  3EED A;  3NDJ A;  3I55 Z;  1I50 I;  1VQP Z;  1RNI A;  2JNY A;  3F3P C;  2VF1 A;  1SFO I;  4XX2 A;  1Q86 2;  1K8A 2;  2OZK A;  3IFU A;  3CPW Z;  1M90 2;  3CCR 1;  2OOX B;  3HOV I;  2NVX I;  1KC8 2;  3G4S Z;  4BY1 I;  3CXC Z;  1Q82 2;  4NH1 C;  1VQ8 1;  4A3D I;  3NH5 A;  5C44 I;  3GTJ I;  2RBL A;  4RS4 A;  2E2J I;  5C4J I;  2K3R A;  2WB1 A;  5D1P A;  4MON A;  4NBE A;  1ML8 A;  1TWF I;  2KI7 B;  3G6E 1;  3CD6 1;  3OW2 Z;  3JAM b;  2V8J A;  4A3K I;  3CCV Z;  2M48 A;  3JAM f;  2OOY B;  5A2Q f;  3GTG I;  2JS4 A;  2JA8 I;  3PO2 I;  2QR1 B;  3H0G I;  1VQ6 1;  1RO2 A;  3S1N I;  1N2F A;  1NUI A;  3CCU Z;  3S14 I;  1R9T I;  4Y52 I;  2ZAE B;  1QYP A;  4EWC A;  3LUS A;  5IP9 I;  3I56 1;  4MD9 A;  1JJ2 Z;  4E32 A;  4E33 A;  3CC7 Z;  3NDI A;  3J80 f;  4NOZ A;  5D1O A;  3T4N B;  1VQN 1;  3VB9 A;  2NVY I;  3CC4 1;  3HKZ A;  4HGY A;  1K73 2;  5T67 A;  1I6H I;  1QVF Z;  3GTP I;  3GTQ I;  2QRE B;  1KD1 1;  3CXC Y;  3GKQ A;  4MRI A;  1PFT A;  3HOX I;  4MH4 A;  1VQ5 1;  2NVQ I;  2OTJ Z;  2E2I I;  1VQP 1;  5AN9 F;  4RVF A;  4A3C I;  5T64 A;  3CCM 1;  2Y0S A;  4NB9 A;  3RZD I;  4QTU A;  3CMA Z;  3I07 A;  4BBR I;  3CCR Z;  4BY7 I;  1JWH C;  5IT9 f;  4E2W A;  1X0T A;  1TWC I;  2HU9 A;  4S1T A;  1VQO 1;  3VTN A;  1M90 1;  3CCE 1;  1YJ9 Z;  2AKL A;  1Z02 A;  3CQZ I;  1QVF Y;  1NJI 2;  3MON A;  3OW2 Y;  1YJ9 1;  2M6N A;  3FQM A;  1JJ2 Y;  2YU9 I;  2RHB A;  5C4X I;  2QA4 Z;  1TWA I;  1USP A;  2P28 A;  3HOW I;  2W03 A;  2QLV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...