1N8R1

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r100
3I55Z 3CCJZ 1YJN1 1JJ2Y 1YI21 1VQ41 1M1K1 1N8R1 1Q812 3G4SZ 1VQ61 1M901 3G711 2QA4Z 1JJ2Z 1KD12 1VQP1 1NJI2 1YIT1 1QVGZ 1K8A1 3CCU1 1VQL1 1S72Z 3CC21 2OTJZ 3CCRZ 1VQ8Z 1YHQ1 1VQK1 1YJW1 1VQNZ 3CCSZ 1KC81 3I551 1VQ5Z 3CCJ1 1N8R2 3CMEZ 1W2BY 1QVGY 3CCEZ 1Q861 1M902 1KQSY 1YIJZ 3G4S1 3G6EZ 1VQOZ 2QA41 2OTLZ 1K731 1K9M2 1W2BZ 3CCLZ 1KQSZ 1S721 1Q7Y1 1Q822 1VQ71 2OTJ1 3CD61 3CCR1 3CPWY 3CC4Z 1YJ9Z 3CCVZ 1VQN1 3CCS1 1VQ51 1M1K2 3CME1 3CPWZ 3CCQZ 1YIJ1 3CXCZ 3G6E1 1VQO1 1VQPZ 3CC7Z 2OTL1 1KD11 2QEXZ 1VQMZ 1QVFY 1K8A2 1NJI1 3I56Z 1VQ9Z 3CMAZ 3CCL1 3OW2Y 1Q7Y2 3CCMZ 1VQ81 1YJNZ 1QVFZ 3CC41 3CCV1 3CXCY 1YI2Z 1YJ91 1KC82 1VQ4Z 3OW2Z 1Q862 1VQ6Z 1Q811 3G71Z 3CCE1 3CCQ1 3CC71 1YITZ 1K732 2QEX1 1VQM1 3CCUZ 1VQLZ 1K9M1 3I561 1VQ91 1VQ7Z 3CMA1 3CC2Z 3CD6Z 1YHQZ 3CCM1 1Q821 1VQKZ 1YJWZ
chains in the Genus database with same CATH superfamily
1JJ2Y 1VQ41 1AA6A 1ZB8A 4S1TA 2Q51A 1FDOA 3I07A 3PO3I 3HKZA 1PFTA 1JJ2Z 5T67A 1KD12 1RLYA 1Z01A 1KRLA 4NBHA 2NVQI 2LIYA 3QWUA 4NBDA 4CL1A 4A3JI 4RVDA 1NUIA 5C3EI 5LL6f 3VMGA 1VQK1 3J81f 2RT9A 4HH4A 4MD8A 1VQ5Z 3CMEZ 1P9NA 2H85A 2V8JA 5FLMI 1K83I 1JWHC 3G4S1 3GCFA 2JS4A 4RV9A 1Z02A 4NBGA 2E7ZA 5T6BA 5A2Qf 4MH4A 3J80b 2QA41 3TE5B 5D1OA 2PMZA 2E9HA 2JUBA 4Y52I 1ZH1A 3D2LA 1VQ71 1WIIA 3GTLI 2OTJ1 3CC4Z 2M48A 2OOXB 5D1PA 2JA8I 4MXUA 3U50C 3RZOI 2RIQA 1YIJ1 2EGTA 1N2FA 1RNIA 4A3MI 2E2JI 1VQMZ 1K8A2 2GTHA 1VQ9Z 2DE6A 2WAQA 3M3YI 4BXXI 1YJNZ 1YI2Z 3CCV1 1KC82 2VPYA 1Q862 3CCQ1 2P3YA 2GTIA 4HGYA 3LUSA 2JIOA 3CC71 4E31A 3CCUZ 2JNYA 3GTKI 4MONA 1VQLZ 2JA5I 4A3BI 3S1QI 5C4XI 4A3CI 1LQLA 3CD6Z 2E2II 2V3VA 4RVHA 4HGZA 4AYBA 4A3LI 3P5JB 3CCJZ 3GKQA 1I3QI 3KIFA 4MRIA 2KPIA 2F4MA 1QF8A 1USPA 3S1NI 1VQ61 1FDIA 1ML8A 2R7ZI 3IX0A 4EWCA 1YIT1 3J80f 2G2KA 2J6AA 2RHBA 3CC21 3CCRZ 3HOZI 2IZ3A 4TNUA 4NOZA 3CCSZ 2OOYB 2AKLA 3S2DI 2RPRA 1USPB 3MONA 3FQQA 1Z03A 3G6EZ 3S1MI 3I4MI 4A3II 4NB8A 1K731 1RQFA 4X6AI 2W03A 3NH4A 4RS4A 5C44I 2R93I 3EERA 3H0GI 3IR7A 4NBAA 1Q7Y1 1Q822 2JMOA 1YJ9Z 2NAPA 1VQ51 1TWHI 1WZNA 3CME1 3T4NB 2NVTI 4E2ZA 3CXCZ 3MZKB 4BY1I 4A3DI 1WW9A 1QVFY 2V8KA 1NJI1 3GTMI 3I56Z 4MD9A 1Q7Y2 2QRDB 4XX2A 5C4JI 3IFUA 1VQ81 1QVFZ 3CC41 1Y8CA 3KIHA 2GU2A 2O4HA 3K7AI 4DK1A 3GTOI 2P28A 2QR1B 2HF1A 3G71Z 3CCE1 1QYPA 2VUGA 5AN9F 2JA6I 3HOXI 2PM9A 3NH8A 2BJOA 5IP9I 1VQM1 1K9M1 2DE5A 1VQ91 4DQYB 1VQ7Z 3NDJA 2JR6A 1WJ2A 1TWCI 1YHQZ 2YU9I 3TDHB 5FLXf 2M6NA 1YJWZ 1TFIA 3I55Z 1YJN1 2VF1A 4NBFA 1YI21 3NFZA 3M4OI 2O53A 1N8R1 1M1K1 2JIMA 4E2YA 3D6WA 3EEDA 1M901 1SIWA 2PK7A 4E2XA 2QLVB 1VQP1 1QVGZ 2NVYI 3CCU1 2JIQA 1VQL1 1TWAI 2VPZA 1S72Z 3J81b 5T64A 3HOWI 3BG0B 1VQNZ 5IT9b 2DE7A 3Q87A 3CCJ1 2V45A 2IV2X 1N8R2 3HOUI 1W2BY 2B63I 1M902 2R92I 1VQOZ 2OTLZ 2V8IA 3MZLB 3VMHA 1W2BZ 3CCLZ 2QRCB 1RO0A 4BBRI 1L1OC 4QTUA 1RO2A 3CCR1 3CQZI 3S14I 1NP6A 3BG1B 3FKII 3FQMA 3CCS1 3S15I 4A3FI 1DL6A 1X3ZA 2F4OA 3G6E1 2JA7I 1KD11 2E2HI 2QEXZ 3S17I 3CMAZ 3NDIA 3CCMZ 4BBSI 3HOYI 1I50I 2LFUA 4NBEA 1YJ91 3CXCY 1VQ4Z 2RBLA 4DGLA 4A3EI 2QKDA 3D9XA 2W04A 1Q811 2I3CA 3JAMb 3GTJI 3GTPI 1K732 3VB9A 2R6MA 4A3KI 2NVXI 2JIRA 3I561 3RZDI 3H3VJ 1SFOI 4A93I 1Y1VS 1R9TI 1VQKZ 5IT9f 1TWGI 3S16I 1Q812 3G4SZ 2LEXA 2Q4ZA 3G711 4NB9A 2QA4Z 3GTGI 2AYDA 1ZB9A 1X3WA 1NJI2 1K8A1 1VLAA 2QREB 2OTJZ 1VQ8Z 1YHQ1 1YUAA 3PO3S 1YJW1 1TWFI 1Y1WI 4NBCA 1KC81 1WCMI 3I551 5IP7I 2IZ4A 2HU9A 2KI7B 1QVGY 3CCEZ 1X0TA 1Q861 1KQSY 1YIJZ 3HOVI 5D1OB 2ZAEB 1K9M2 1KQSZ 3J7A4 3PO2I 1S721 4NBBA 3CD61 3CPWY 4E33A 3CCVZ 4NFRA 4E2WA 1VQN1 3VTNA 3NH5A 1M1K2 1YUKA 3GTMS 4E30A 3VMIA 4BY7I 2Y0SA 3CPWZ 3CCQZ 5A2Qb 1VQO1 3JAMf 1VQPZ 4MD7A 3CC7Z 3S1RI 2OTL1 1I6HI 2K5RA 4RVGA 3I4NI 3CCL1 3OW2Y 4NH1C 3GTQI 4QTTA 2VUMI 4A3GI 2K3RA 2JIPA 4RVFA 3OW2Z 1S7MA 4Y7NI 1Y1VI 1VQ6Z 1RO4A 3ESWA 5CM2M 2OZKA 3F3PC 3F3FC 1Q16A 2VPXA 1YITZ 2QEX1 2VPWA 2YADA 5FLXb 3CMA1 3CC2Z 4E32A 3CCM1 3S2HI 3IF8A 1QXFA 2WB1A 1Q821
chains in the Genus database with same CATH topology
1JJ2Y 1VQ41 1ZB8A 4S1TA 2Q51A 3I07A 3PO3I 3HKZA 1PFTA 1JJ2Z 5T67A 1KD12 1RLYA 1Z01A 1KRLA 4NBHA 2NVQI 2LIYA 3QWUA 4NBDA 4CL1A 4A3JI 4RVDA 1NUIA 5C3EI 5LL6f 3VMGA 1VQK1 3J81f 2RT9A 4HH4A 4MD8A 1VQ5Z 3CMEZ 1P9NA 2H85A 2V8JA 5FLMI 1K83I 1JWHC 3G4S1 3GCFA 2JS4A 4RV9A 1Z02A 4NBGA 5T6BA 5A2Qf 2QA41 4MH4A 3J80b 3TE5B 5D1OA 2PMZA 2E9HA 2JUBA 4Y52I 1ZH1A 1VQ71 1WIIA 3GTLI 2OTJ1 3CC4Z 2M48A 2OOXB 5D1PA 2JA8I 4MXUA 3U50C 3RZOI 2RIQA 1YIJ1 2EGTA 1N2FA 1RNIA 4A3MI 2E2JI 1VQMZ 1K8A2 2GTHA 1VQ9Z 2DE6A 2WAQA 3M3YI 4BXXI 1YJNZ 1YI2Z 3CCV1 1KC82 1Q862 3CCQ1 2P3YA 2GTIA 4HGYA 3LUSA 3CC71 4E31A 3CCUZ 2JNYA 3GTKI 4MONA 1VQLZ 2JA5I 4A3BI 3S1QI 5C4XI 4A3CI 1LQLA 3CD6Z 2E2II 4RVHA 4HGZA 4AYBA 4A3LI 3P5JB 3CCJZ 3GKQA 1I3QI 3KIFA 4MRIA 2KPIA 2F4MA 1QF8A 1USPA 3S1NI 1VQ61 1ML8A 2R7ZI 3IX0A 4EWCA 1YIT1 3J80f 2G2KA 2J6AA 2RHBA 3CC21 3CCRZ 3HOZI 2IZ3A 4TNUA 4NOZA 3CCSZ 2OOYB 2AKLA 3S2DI 2RPRA 1USPB 3MONA 3FQQA 1Z03A 3G6EZ 3S1MI 3I4MI 4A3II 4NB8A 1K731 1RQFA 4X6AI 2W03A 3NH4A 4RS4A 5C44I 2R93I 3EERA 3H0GI 4NBAA 1Q7Y1 1Q822 2JMOA 1YJ9Z 1VQ51 1TWHI 3CME1 3T4NB 2NVTI 4E2ZA 3CXCZ 3MZKB 4BY1I 4A3DI 1WW9A 1QVFY 2V8KA 1NJI1 3GTMI 3I56Z 4MD9A 1Q7Y2 2QRDB 4XX2A 5C4JI 3IFUA 1VQ81 1QVFZ 3CC41 3KIHA 2GU2A 2O4HA 3K7AI 4DK1A 3GTOI 2P28A 2QR1B 2HF1A 3G71Z 3CCE1 1QYPA 2VUGA 5AN9F 2JA6I 3HOXI 2PM9A 3NH8A 2BJOA 5IP9I 1VQM1 1K9M1 2DE5A 1VQ91 4DQYB 1VQ7Z 3NDJA 2JR6A 1TWCI 1YHQZ 2YU9I 3TDHB 5FLXf 2M6NA 1YJWZ 1TFIA 3I55Z 1YJN1 2VF1A 4NBFA 1YI21 3NFZA 3M4OI 2O53A 1N8R1 1M1K1 4E2YA 3D6WA 3EEDA 1M901 2PK7A 4E2XA 2QLVB 1VQP1 1QVGZ 2NVYI 3CCU1 1VQL1 1TWAI 1S72Z 3J81b 5T64A 3HOWI 3BG0B 1VQNZ 5IT9b 2DE7A 3Q87A 3CCJ1 1N8R2 3HOUI 1W2BY 2B63I 1M902 2R92I 1VQOZ 2OTLZ 2V8IA 3MZLB 3VMHA 1W2BZ 3CCLZ 2QRCB 1RO0A 4BBRI 1L1OC 4QTUA 1RO2A 3CCR1 3CQZI 3S14I 1NP6A 3BG1B 3FKII 3FQMA 3CCS1 3S15I 4A3FI 1DL6A 1X3ZA 2F4OA 3G6E1 2JA7I 1KD11 2E2HI 2QEXZ 3S17I 3CMAZ 3NDIA 3CCMZ 4BBSI 3HOYI 1I50I 2LFUA 4NBEA 1YJ91 3CXCY 1VQ4Z 2RBLA 4DGLA 4A3EI 2QKDA 3D9XA 2W04A 1Q811 2I3CA 3JAMb 3GTJI 3GTPI 1K732 3VB9A 2R6MA 4A3KI 2NVXI 3I561 3RZDI 3H3VJ 1SFOI 4A93I 1Y1VS 1R9TI 1VQKZ 5IT9f 1TWGI 3S16I 1Q812 3G4SZ 2Q4ZA 3G711 4NB9A 2QA4Z 3GTGI 1ZB9A 1X3WA 1NJI2 1K8A1 1VLAA 2QREB 2OTJZ 1VQ8Z 1YHQ1 1YUAA 3PO3S 1YJW1 1TWFI 1Y1WI 4NBCA 1KC81 1WCMI 3I551 5IP7I 2IZ4A 2HU9A 2KI7B 1QVGY 3CCEZ 1X0TA 1Q861 1KQSY 1YIJZ 3HOVI 5D1OB 2ZAEB 1K9M2 1KQSZ 3J7A4 3PO2I 1S721 4NBBA 3CD61 3CPWY 4E33A 3CCVZ 4NFRA 4E2WA 1VQN1 3VTNA 3NH5A 1M1K2 1YUKA 3GTMS 4E30A 3VMIA 4BY7I 2Y0SA 3CPWZ 3CCQZ 5A2Qb 1VQO1 3JAMf 1VQPZ 4MD7A 3CC7Z 3S1RI 2OTL1 1I6HI 2K5RA 4RVGA 3I4NI 3CCL1 3OW2Y 4NH1C 3GTQI 4QTTA 2VUMI 4A3GI 2K3RA 4RVFA 3OW2Z 1S7MA 4Y7NI 1Y1VI 1VQ6Z 1RO4A 3ESWA 5CM2M 2OZKA 3F3PC 3F3FC 1YITZ 2QEX1 2YADA 5FLXb 3CMA1 3CC2Z 4E32A 3CCM1 3S2HI 3IF8A 2WB1A 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Z;  3CCJ Z;  1YJN 1;  1JJ2 Y;  1YI2 1;  1VQ4 1;  1M1K 1;  1N8R 1;  1Q81 2;  3G4S Z;  1VQ6 1;  1M90 1;  3G71 1;  2QA4 Z;  1JJ2 Z;  1KD1 2;  1VQP 1;  1NJI 2;  1YIT 1;  1QVG Z;  1K8A 1;  3CCU 1;  1VQL 1;  1S72 Z;  3CC2 1;  2OTJ Z;  3CCR Z;  1VQ8 Z;  1YHQ 1;  1VQK 1;  1YJW 1;  1VQN Z;  3CCS Z;  1KC8 1;  3I55 1;  1VQ5 Z;  3CCJ 1;  1N8R 2;  3CME Z;  1W2B Y;  1QVG Y;  3CCE Z;  1Q86 1;  1M90 2;  1KQS Y;  1YIJ Z;  3G4S 1;  3G6E Z;  1VQO Z;  2QA4 1;  2OTL Z;  1K73 1;  1K9M 2;  1W2B Z;  3CCL Z;  1KQS Z;  1S72 1;  1Q7Y 1;  1Q82 2;  1VQ7 1;  2OTJ 1;  3CD6 1;  3CCR 1;  3CPW Y;  3CC4 Z;  1YJ9 Z;  3CCV Z;  1VQN 1;  3CCS 1;  1VQ5 1;  1M1K 2;  3CME 1;  3CPW Z;  3CCQ Z;  1YIJ 1;  3CXC Z;  3G6E 1;  1VQO 1;  1VQP Z;  3CC7 Z;  2OTL 1;  1KD1 1;  2QEX Z;  1VQM Z;  1QVF Y;  1K8A 2;  1NJI 1;  3I56 Z;  1VQ9 Z;  3CMA Z;  3CCL 1;  3OW2 Y;  1Q7Y 2;  3CCM Z;  1VQ8 1;  1YJN Z;  1QVF Z;  3CC4 1;  3CCV 1;  3CXC Y;  1YI2 Z;  1YJ9 1;  1KC8 2;  1VQ4 Z;  3OW2 Z;  1Q86 2;  1VQ6 Z;  1Q81 1;  3G71 Z;  3CCE 1;  3CCQ 1;  3CC7 1;  1YIT Z;  1K73 2;  2QEX 1;  1VQM 1;  3CCU Z;  1VQL Z;  1K9M 1;  3I56 1;  1VQ9 1;  1VQ7 Z;  3CMA 1;  3CC2 Z;  3CD6 Z;  1YHQ Z;  3CCM 1;  1Q82 1;  1VQK Z;  1YJW Z; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  1VQ4 1;  1AA6 A;  1ZB8 A;  4S1T A;  2Q51 A;  1FDO A;  3I07 A;  3PO3 I;  3HKZ A;  1PFT A;  1JJ2 Z;  5T67 A;  1KD1 2;  1RLY A;  1Z01 A;  1KRL A;  4NBH A;  2NVQ I;  2LIY A;  3QWU A;  4NBD A;  4CL1 A;  4A3J I;  4RVD A;  1NUI A;  5C3E I;  5LL6 f;  3VMG A;  1VQK 1;  3J81 f;  2RT9 A;  4HH4 A;  4MD8 A;  1VQ5 Z;  3CME Z;  1P9N A;  2H85 A;  2V8J A;  5FLM I;  1K83 I;  1JWH C;  3G4S 1;  3GCF A;  2JS4 A;  4RV9 A;  1Z02 A;  4NBG A;  2E7Z A;  5T6B A;  5A2Q f;  4MH4 A;  3J80 b;  2QA4 1;  3TE5 B;  5D1O A;  2PMZ A;  2E9H A;  2JUB A;  4Y52 I;  1ZH1 A;  3D2L A;  1VQ7 1;  1WII A;  3GTL I;  2OTJ 1;  3CC4 Z;  2M48 A;  2OOX B;  5D1P A;  2JA8 I;  4MXU A;  3U50 C;  3RZO I;  2RIQ A;  1YIJ 1;  2EGT A;  1N2F A;  1RNI A;  4A3M I;  2E2J I;  1VQM Z;  1K8A 2;  2GTH A;  1VQ9 Z;  2DE6 A;  2WAQ A;  3M3Y I;  4BXX I;  1YJN Z;  1YI2 Z;  3CCV 1;  1KC8 2;  2VPY A;  1Q86 2;  3CCQ 1;  2P3Y A;  2GTI A;  4HGY A;  3LUS A;  2JIO A;  3CC7 1;  4E31 A;  3CCU Z;  2JNY A;  3GTK I;  4MON A;  1VQL Z;  2JA5 I;  4A3B I;  3S1Q I;  5C4X I;  4A3C I;  1LQL A;  3CD6 Z;  2E2I I;  2V3V A;  4RVH A;  4HGZ A;  4AYB A;  4A3L I;  3P5J B;  3CCJ Z;  3GKQ A;  1I3Q I;  3KIF A;  4MRI A;  2KPI A;  2F4M A;  1QF8 A;  1USP A;  3S1N I;  1VQ6 1;  1FDI A;  1ML8 A;  2R7Z I;  3IX0 A;  4EWC A;  1YIT 1;  3J80 f;  2G2K A;  2J6A A;  2RHB A;  3CC2 1;  3CCR Z;  3HOZ I;  2IZ3 A;  4TNU A;  4NOZ A;  3CCS Z;  2OOY B;  2AKL A;  3S2D I;  2RPR A;  1USP B;  3MON A;  3FQQ A;  1Z03 A;  3G6E Z;  3S1M I;  3I4M I;  4A3I I;  4NB8 A;  1K73 1;  1RQF A;  4X6A I;  2W03 A;  3NH4 A;  4RS4 A;  5C44 I;  2R93 I;  3EER A;  3H0G I;  3IR7 A;  4NBA A;  1Q7Y 1;  1Q82 2;  2JMO A;  1YJ9 Z;  2NAP A;  1VQ5 1;  1TWH I;  1WZN A;  3CME 1;  3T4N B;  2NVT I;  4E2Z A;  3CXC Z;  3MZK B;  4BY1 I;  4A3D I;  1WW9 A;  1QVF Y;  2V8K A;  1NJI 1;  3GTM I;  3I56 Z;  4MD9 A;  1Q7Y 2;  2QRD B;  4XX2 A;  5C4J I;  3IFU A;  1VQ8 1;  1QVF Z;  3CC4 1;  1Y8C A;  3KIH A;  2GU2 A;  2O4H A;  3K7A I;  4DK1 A;  3GTO I;  2P28 A;  2QR1 B;  2HF1 A;  3G71 Z;  3CCE 1;  1QYP A;  2VUG A;  5AN9 F;  2JA6 I;  3HOX I;  2PM9 A;  3NH8 A;  2BJO A;  5IP9 I;  1VQM 1;  1K9M 1;  2DE5 A;  1VQ9 1;  4DQY B;  1VQ7 Z;  3NDJ A;  2JR6 A;  1WJ2 A;  1TWC I;  1YHQ Z;  2YU9 I;  3TDH B;  5FLX f;  2M6N A;  1YJW Z;  1TFI A;  3I55 Z;  1YJN 1;  2VF1 A;  4NBF A;  1YI2 1;  3NFZ A;  3M4O I;  2O53 A;  1N8R 1;  1M1K 1;  2JIM A;  4E2Y A;  3D6W A;  3EED A;  1M90 1;  1SIW A;  2PK7 A;  4E2X A;  2QLV B;  1VQP 1;  1QVG Z;  2NVY I;  3CCU 1;  2JIQ A;  1VQL 1;  1TWA I;  2VPZ A;  1S72 Z;  3J81 b;  5T64 A;  3HOW I;  3BG0 B;  1VQN Z;  5IT9 b;  2DE7 A;  3Q87 A;  3CCJ 1;  2V45 A;  2IV2 X;  1N8R 2;  3HOU I;  1W2B Y;  2B63 I;  1M90 2;  2R92 I;  1VQO Z;  2OTL Z;  2V8I A;  3MZL B;  3VMH A;  1W2B Z;  3CCL Z;  2QRC B;  1RO0 A;  4BBR I;  1L1O C;  4QTU A;  1RO2 A;  3CCR 1;  3CQZ I;  3S14 I;  1NP6 A;  3BG1 B;  3FKI I;  3FQM A;  3CCS 1;  3S15 I;  4A3F I;  1DL6 A;  1X3Z A;  2F4O A;  3G6E 1;  2JA7 I;  1KD1 1;  2E2H I;  2QEX Z;  3S17 I;  3CMA Z;  3NDI A;  3CCM Z;  4BBS I;  3HOY I;  1I50 I;  2LFU A;  4NBE A;  1YJ9 1;  3CXC Y;  1VQ4 Z;  2RBL A;  4DGL A;  4A3E I;  2QKD A;  3D9X A;  2W04 A;  1Q81 1;  2I3C A;  3JAM b;  3GTJ I;  3GTP I;  1K73 2;  3VB9 A;  2R6M A;  4A3K I;  2NVX I;  2JIR A;  3I56 1;  3RZD I;  3H3V J;  1SFO I;  4A93 I;  1Y1V S;  1R9T I;  1VQK Z;  5IT9 f;  1TWG I;  3S16 I;  1Q81 2;  3G4S Z;  2LEX A;  2Q4Z A;  3G71 1;  4NB9 A;  2QA4 Z;  3GTG I;  2AYD A;  1ZB9 A;  1X3W A;  1NJI 2;  1K8A 1;  1VLA A;  2QRE B;  2OTJ Z;  1VQ8 Z;  1YHQ 1;  1YUA A;  3PO3 S;  1YJW 1;  1TWF I;  1Y1W I;  4NBC A;  1KC8 1;  1WCM I;  3I55 1;  5IP7 I;  2IZ4 A;  2HU9 A;  2KI7 B;  1QVG Y;  3CCE Z;  1X0T A;  1Q86 1;  1KQS Y;  1YIJ Z;  3HOV I;  5D1O B;  2ZAE B;  1K9M 2;  1KQS Z;  3J7A 4;  3PO2 I;  1S72 1;  4NBB A;  3CD6 1;  3CPW Y;  4E33 A;  3CCV Z;  4NFR A;  4E2W A;  1VQN 1;  3VTN A;  3NH5 A;  1M1K 2;  1YUK A;  3GTM S;  4E30 A;  3VMI A;  4BY7 I;  2Y0S A;  3CPW Z;  3CCQ Z;  5A2Q b;  1VQO 1;  3JAM f;  1VQP Z;  4MD7 A;  3CC7 Z;  3S1R I;  2OTL 1;  1I6H I;  2K5R A;  4RVG A;  3I4N I;  3CCL 1;  3OW2 Y;  4NH1 C;  3GTQ I;  4QTT A;  2VUM I;  4A3G I;  2K3R A;  2JIP A;  4RVF A;  3OW2 Z;  1S7M A;  4Y7N I;  1Y1V I;  1VQ6 Z;  1RO4 A;  3ESW A;  5CM2 M;  2OZK A;  3F3P C;  3F3F C;  1Q16 A;  2VPX A;  1YIT Z;  2QEX 1;  2VPW A;  2YAD A;  5FLX b;  3CMA 1;  3CC2 Z;  4E32 A;  3CCM 1;  3S2H I;  3IF8 A;  1QXF A;  2WB1 A;  1Q82 1; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  1VQ4 1;  1ZB8 A;  4S1T A;  2Q51 A;  3I07 A;  3PO3 I;  3HKZ A;  1PFT A;  1JJ2 Z;  5T67 A;  1KD1 2;  1RLY A;  1Z01 A;  1KRL A;  4NBH A;  2NVQ I;  2LIY A;  3QWU A;  4NBD A;  4CL1 A;  4A3J I;  4RVD A;  1NUI A;  5C3E I;  5LL6 f;  3VMG A;  1VQK 1;  3J81 f;  2RT9 A;  4HH4 A;  4MD8 A;  1VQ5 Z;  3CME Z;  1P9N A;  2H85 A;  2V8J A;  5FLM I;  1K83 I;  1JWH C;  3G4S 1;  3GCF A;  2JS4 A;  4RV9 A;  1Z02 A;  4NBG A;  5T6B A;  5A2Q f;  2QA4 1;  4MH4 A;  3J80 b;  3TE5 B;  5D1O A;  2PMZ A;  2E9H A;  2JUB A;  4Y52 I;  1ZH1 A;  1VQ7 1;  1WII A;  3GTL I;  2OTJ 1;  3CC4 Z;  2M48 A;  2OOX B;  5D1P A;  2JA8 I;  4MXU A;  3U50 C;  3RZO I;  2RIQ A;  1YIJ 1;  2EGT A;  1N2F A;  1RNI A;  4A3M I;  2E2J I;  1VQM Z;  1K8A 2;  2GTH A;  1VQ9 Z;  2DE6 A;  2WAQ A;  3M3Y I;  4BXX I;  1YJN Z;  1YI2 Z;  3CCV 1;  1KC8 2;  1Q86 2;  3CCQ 1;  2P3Y A;  2GTI A;  4HGY A;  3LUS A;  3CC7 1;  4E31 A;  3CCU Z;  2JNY A;  3GTK I;  4MON A;  1VQL Z;  2JA5 I;  4A3B I;  3S1Q I;  5C4X I;  4A3C I;  1LQL A;  3CD6 Z;  2E2I I;  4RVH A;  4HGZ A;  4AYB A;  4A3L I;  3P5J B;  3CCJ Z;  3GKQ A;  1I3Q I;  3KIF A;  4MRI A;  2KPI A;  2F4M A;  1QF8 A;  1USP A;  3S1N I;  1VQ6 1;  1ML8 A;  2R7Z I;  3IX0 A;  4EWC A;  1YIT 1;  3J80 f;  2G2K A;  2J6A A;  2RHB A;  3CC2 1;  3CCR Z;  3HOZ I;  2IZ3 A;  4TNU A;  4NOZ A;  3CCS Z;  2OOY B;  2AKL A;  3S2D I;  2RPR A;  1USP B;  3MON A;  3FQQ A;  1Z03 A;  3G6E Z;  3S1M I;  3I4M I;  4A3I I;  4NB8 A;  1K73 1;  1RQF A;  4X6A I;  2W03 A;  3NH4 A;  4RS4 A;  5C44 I;  2R93 I;  3EER A;  3H0G I;  4NBA A;  1Q7Y 1;  1Q82 2;  2JMO A;  1YJ9 Z;  1VQ5 1;  1TWH I;  3CME 1;  3T4N B;  2NVT I;  4E2Z A;  3CXC Z;  3MZK B;  4BY1 I;  4A3D I;  1WW9 A;  1QVF Y;  2V8K A;  1NJI 1;  3GTM I;  3I56 Z;  4MD9 A;  1Q7Y 2;  2QRD B;  4XX2 A;  5C4J I;  3IFU A;  1VQ8 1;  1QVF Z;  3CC4 1;  3KIH A;  2GU2 A;  2O4H A;  3K7A I;  4DK1 A;  3GTO I;  2P28 A;  2QR1 B;  2HF1 A;  3G71 Z;  3CCE 1;  1QYP A;  2VUG A;  5AN9 F;  2JA6 I;  3HOX I;  2PM9 A;  3NH8 A;  2BJO A;  5IP9 I;  1VQM 1;  1K9M 1;  2DE5 A;  1VQ9 1;  4DQY B;  1VQ7 Z;  3NDJ A;  2JR6 A;  1TWC I;  1YHQ Z;  2YU9 I;  3TDH B;  5FLX f;  2M6N A;  1YJW Z;  1TFI A;  3I55 Z;  1YJN 1;  2VF1 A;  4NBF A;  1YI2 1;  3NFZ A;  3M4O I;  2O53 A;  1N8R 1;  1M1K 1;  4E2Y A;  3D6W A;  3EED A;  1M90 1;  2PK7 A;  4E2X A;  2QLV B;  1VQP 1;  1QVG Z;  2NVY I;  3CCU 1;  1VQL 1;  1TWA I;  1S72 Z;  3J81 b;  5T64 A;  3HOW I;  3BG0 B;  1VQN Z;  5IT9 b;  2DE7 A;  3Q87 A;  3CCJ 1;  1N8R 2;  3HOU I;  1W2B Y;  2B63 I;  1M90 2;  2R92 I;  1VQO Z;  2OTL Z;  2V8I A;  3MZL B;  3VMH A;  1W2B Z;  3CCL Z;  2QRC B;  1RO0 A;  4BBR I;  1L1O C;  4QTU A;  1RO2 A;  3CCR 1;  3CQZ I;  3S14 I;  1NP6 A;  3BG1 B;  3FKI I;  3FQM A;  3CCS 1;  3S15 I;  4A3F I;  1DL6 A;  1X3Z A;  2F4O A;  3G6E 1;  2JA7 I;  1KD1 1;  2E2H I;  2QEX Z;  3S17 I;  3CMA Z;  3NDI A;  3CCM Z;  4BBS I;  3HOY I;  1I50 I;  2LFU A;  4NBE A;  1YJ9 1;  3CXC Y;  1VQ4 Z;  2RBL A;  4DGL A;  4A3E I;  2QKD A;  3D9X A;  2W04 A;  1Q81 1;  2I3C A;  3JAM b;  3GTJ I;  3GTP I;  1K73 2;  3VB9 A;  2R6M A;  4A3K I;  2NVX I;  3I56 1;  3RZD I;  3H3V J;  1SFO I;  4A93 I;  1Y1V S;  1R9T I;  1VQK Z;  5IT9 f;  1TWG I;  3S16 I;  1Q81 2;  3G4S Z;  2Q4Z A;  3G71 1;  4NB9 A;  2QA4 Z;  3GTG I;  1ZB9 A;  1X3W A;  1NJI 2;  1K8A 1;  1VLA A;  2QRE B;  2OTJ Z;  1VQ8 Z;  1YHQ 1;  1YUA A;  3PO3 S;  1YJW 1;  1TWF I;  1Y1W I;  4NBC A;  1KC8 1;  1WCM I;  3I55 1;  5IP7 I;  2IZ4 A;  2HU9 A;  2KI7 B;  1QVG Y;  3CCE Z;  1X0T A;  1Q86 1;  1KQS Y;  1YIJ Z;  3HOV I;  5D1O B;  2ZAE B;  1K9M 2;  1KQS Z;  3J7A 4;  3PO2 I;  1S72 1;  4NBB A;  3CD6 1;  3CPW Y;  4E33 A;  3CCV Z;  4NFR A;  4E2W A;  1VQN 1;  3VTN A;  3NH5 A;  1M1K 2;  1YUK A;  3GTM S;  4E30 A;  3VMI A;  4BY7 I;  2Y0S A;  3CPW Z;  3CCQ Z;  5A2Q b;  1VQO 1;  3JAM f;  1VQP Z;  4MD7 A;  3CC7 Z;  3S1R I;  2OTL 1;  1I6H I;  2K5R A;  4RVG A;  3I4N I;  3CCL 1;  3OW2 Y;  4NH1 C;  3GTQ I;  4QTT A;  2VUM I;  4A3G I;  2K3R A;  4RVF A;  3OW2 Z;  1S7M A;  4Y7N I;  1Y1V I;  1VQ6 Z;  1RO4 A;  3ESW A;  5CM2 M;  2OZK A;  3F3P C;  3F3F C;  1YIT Z;  2QEX 1;  2YAD A;  5FLX b;  3CMA 1;  3CC2 Z;  4E32 A;  3CCM 1;  3S2H I;  3IF8 A;  2WB1 A;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...