3CD61

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6100
3CXCY 1YJNZ 2QA41 1KQSZ 3CCUZ 3CCRZ 1KC82 3CC2Z 1KD11 1YJN1 3CCLZ 3CC21 1YITZ 1VQOZ 3CXCZ 3CCL1 1YIT1 2QEXZ 1Q812 1M902 1VQO1 2OTLZ 1K732 1VQ41 1JJ2Y 2QEX1 1W2BY 1K8A2 2OTL1 3CPWY 1QVFY 1VQ6Z 1Q862 1VQKZ 1JJ2Z 3CC41 1W2BZ 1KQSY 3CPWZ 1YHQZ 1YHQ1 2QA4Z 1KC81 1K9M2 1S721 3I551 3CCQZ 1Q811 1K731 1VQ4Z 3CCQ1 1VQ7Z 2OTJZ 1N8R2 3CMA1 1K8A1 1VQ71 2OTJ1 1Q861 1VQPZ 3CC71 1Q7Y2 1NJI2 1YJ9Z 1VQP1 3G4S1 3CC4Z 1VQ5Z 3G6E1 3CD6Z 3CCM1 1YJ91 1VQN1 3CD61 1VQ51 1VQ8Z 1VQ81 3CCJZ 3CCV1 1YIJ1 1QVGZ 1K9M1 1S72Z 3I55Z 3CCJ1 1Q822 1YI21 1M1K2 1M901 3CMAZ 1VQ9Z 3CC7Z 1Q7Y1 1VQ91 3CMEZ 3G4SZ 3G6EZ 3CCMZ 1YJWZ 3CME1 1VQNZ 1VQM1 1YJW1 1QVGY 3I56Z 1VQLZ 3OW2Y 3CCVZ 1YIJZ 3I561 1VQL1 3CCSZ 3CCU1 3CCR1 1KD12 1Q821 1YI2Z 3CCS1 1M1K1 3CCEZ 3OW2Z 3G71Z 3CCE1 1N8R1 3G711 1NJI1 1VQ61 1VQK1 1VQMZ 1QVFZ
chains in the Genus database with same CATH superfamily
4MD9A 3S1QI 2YU9I 3CCRZ 1KD11 2KPIA 3D6WA 3CCLZ 1YITZ 4A3JI 2HU9A 1VQ6Z 4RVGA 3VB9A 1WIIA 4NBEA 3BG1B 2PMZA 2V8IA 5CM2M 1YUAA 2VF1A 3GTJI 2RT9A 2JIPA 1K9M2 2GTHA 3S1MI 3I551 3GTQI 3I07A 4NFRA 2W04A 1K731 1TWGI 1RLYA 1VQ7Z 1JWHC 2DE6A 1NP6A 2LFUA 4MD8A 1K8A1 3JAMf 3IR7A 2OTJ1 1VQPZ 2I3CA 1NJI2 2JIMA 1N2FA 1VQ5Z 3NH5A 1YJ91 3NH8A 4E30A 1VQ81 3D2LA 2AKLA 2R92I 3CCV1 1ZB8A 3CQZI 2O53A 3I55Z 3CCJ1 1Q822 3GTLI 2VPZA 3K7AI 2W03A 1M901 3PO2I 5D1PA 2O4HA 2WAQA 4S1TA 1Q7Y1 3CMEZ 2IV2X 3NDJA 4NBCA 2Q51A 4NBFA 2RHBA 2QKDA 1QVGY 3I56Z 1VQLZ 5C4XI 3CCVZ 3CCSZ 2GU2A 2E2JI 3M4OI 3IF8A 4NBAA 3HOUI 3NH4A 1AA6A 4A3LI 2PK7A 3J80b 4A3KI 4Y52I 4CL1A 1Z02A 1R9TI 1VQK1 2M6NA 4A3MI 4E31A 2E9HA 2BJOA 4BY7I 3CXCY 1KQSZ 4HGYA 3CC2Z 2F4OA 1ZB9A 5FLMI 5C3EI 3CXCZ 3CCL1 1YIT1 2DE7A 1M902 1VQ41 2JUBA 2V3VA 4EWCA 3S15I 4NBGA 3CPWY 2V45A 1QVFY 1Q862 2P3YA 1VQKZ 3U50C 3CC41 1P9NA 3CPWZ 1LQLA 3S17I 1KC81 3BG0B 2Y0SA 4E2YA 4A3II 1S721 3HOVI 4E2XA 3CCQZ 4BXXI 3J80f 2JNYA 1Q811 2NVYI 1VQ4Z 3S16I 1VQ71 2JIQA 5T6BA 4A3FI 1VQP1 3G4S1 3CC4Z 1TFIA 1VQ51 5FLXb 3HKZA 3RZDI 4NBDA 3GTGI 1Q16A 2J6AA 2OOYB 1QF8A 1S72Z 2NAPA 3MZLB 4RVDA 2QREB 2ZAEB 3FQMA 3T4NB 2K3RA 1M1K2 4NBBA 2M48A 3HOXI 4A3DI 2QR1B 1VQ9Z 4RVFA 1RO2A 2WB1A 2QRDB 3G4SZ 2RIQA 4NB9A 1WJ2A 4NBHA 3VMIA 1ZH1A 3IFUA 3CME1 3S1NI 2GTIA 3HOZI 4NH1C 3GTMI 5T64A 3P5JB 3GTMS 2VPWA 4BBRI 3I561 3VTNA 1USPB 1VQL1 1KD12 3I4MI 3CCS1 4RS4A 2JA6I 3IX0A 2VUMI 2KI7B 3RZOI 2YADA 2JIRA 4MONA 1I3QI 2E2HI 1RO0A 1YJNZ 1RQFA 3TDHB 3CC21 1VQOZ 2E2II 5C4JI 2LIYA 2QEXZ 2OTLZ 1K732 1JJ2Y 4DK1A 1W2BY 1K8A2 2B63I 3H0GI 1TWCI 4MXUA 3GCFA 3VMHA 2NVTI 1JJ2Z 2HF1A 1W2BZ 3H3VJ 1KQSY 1YHQZ 3MONA 1ML8A 1Y1VI 2G2KA 3CCQ1 1Y1VS 2P28A 2RBLA 3CMA1 3EERA 3Q87A 1Q7Y2 1NUIA 3CD6Z 3G6E1 1FDIA 2JA5I 2VPXA 4A3CI 2F4MA 1QXFA 2JA7I 2PM9A 4NB8A 2JIOA 1YIJ1 1VLAA 1K9M1 5A2Qb 3I4NI 4E2ZA 1Z03A 4MH4A 3CMAZ 1X3WA 3D9XA 5IT9b 1VQ91 1SFOI 1TWHI 3JAMb 3G6EZ 1YJWZ 5D1OB 1X3ZA 1USPA 3HOYI 1SIWA 2R93I 1DL6A 2VPYA 1Z01A 3OW2Y 2K5RA 4MD7A 4BY1I 1YIJZ 3CCU1 2IZ4A 1Q821 3J7A4 1TWAI 3M3YI 3CCEZ 3OW2Z 1X0TA 2H85A 3G71Z 4HH4A 3QWUA 1N8R1 2NVQI 3S2DI 4RVHA 1PFTA 4TNUA 4DGLA 3HOWI 1Y8CA 5IP7I 4E32A 2IZ3A 2JA8I 1RO4A 5IP9I 5A2Qf 2QA41 3CCUZ 3KIFA 1KC82 1YJN1 4A3GI 1YUKA 5IT9f 5C44I 1Q812 2AYDA 1VQO1 3GTPI 5AN9F 2QEX1 2OTL1 1WCMI 2QRCB 5FLXf 2Q4ZA 3EEDA 1KRLA 1TWFI 1YHQ1 2QA4Z 3S1RI 3LUSA 2R7ZI 3VMGA 2OTJZ 1N8R2 2VUGA 3J81b 4XX2A 3GKQA 5T67A 4A93I 1Q861 2V8KA 3CC71 4A3BI 3PO3I 1YJ9Z 3CCM1 1Y1WI 3PO3S 1VQN1 3FQQA 3CD61 2V8JA 4A3EI 1VQ8Z 4NOZA 3S2HI 3TE5B 3NDIA 3F3FC 3CCJZ 1QVGZ 1WW9A 1FDOA 1I50I 1S7MA 1YI21 2RPRA 3GTKI 4X6AI 5D1OA 1QYPA 4RV9A 2OZKA 3MZKB 3NFZA 2DE5A 4E2WA 3KIHA 2R6MA 3CC7Z 1I6HI 2E7ZA 3CCMZ 4AYBA 2JR6A 1VQNZ 1VQM1 1YJW1 2NVXI 3S14I 4Y7NI 3GTOI 2EGTA 5LL6f 4QTUA 3CCR1 1YI2Z 3FKII 2LEXA 1M1K1 3ESWA 3J81f 2JMOA 3CCE1 4E33A 3G711 1K83I 3F3PC 1L1OC 2QLVB 4BBSI 4QTTA 1WZNA 1RNIA 1NJI1 1VQ61 4MRIA 1VQMZ 4HGZA 1QVFZ 4DQYB 2JS4A 2OOXB
chains in the Genus database with same CATH topology
4MD9A 3S1QI 2YU9I 3CCRZ 1KD11 2KPIA 3D6WA 3CCLZ 1YITZ 4A3JI 2HU9A 1VQ6Z 4RVGA 3VB9A 1WIIA 4NBEA 3BG1B 2PMZA 2V8IA 5CM2M 1YUAA 2VF1A 3GTJI 2RT9A 1K9M2 2GTHA 3S1MI 3I551 3GTQI 3I07A 4NFRA 2W04A 1K731 1TWGI 1RLYA 1VQ7Z 1JWHC 2DE6A 1NP6A 2LFUA 4MD8A 1K8A1 3JAMf 2OTJ1 1VQPZ 2I3CA 1NJI2 1N2FA 1VQ5Z 3NH5A 1YJ91 3NH8A 4E30A 1VQ81 2AKLA 2R92I 3CCV1 1ZB8A 3CQZI 2O53A 3I55Z 3CCJ1 1Q822 3GTLI 3K7AI 2W03A 1M901 3PO2I 5D1PA 2O4HA 2WAQA 4S1TA 1Q7Y1 3CMEZ 3NDJA 4NBCA 2Q51A 4NBFA 2RHBA 2QKDA 1QVGY 3I56Z 1VQLZ 5C4XI 3CCVZ 3CCSZ 2GU2A 2E2JI 3M4OI 3IF8A 4NBAA 3HOUI 3NH4A 4A3LI 2PK7A 3J80b 4A3KI 4Y52I 4CL1A 1Z02A 1R9TI 1VQK1 2M6NA 4A3MI 4E31A 2E9HA 2BJOA 4BY7I 3CXCY 1KQSZ 4HGYA 3CC2Z 2F4OA 1ZB9A 5FLMI 5C3EI 3CXCZ 3CCL1 1YIT1 2DE7A 1M902 1VQ41 2JUBA 4EWCA 3S15I 4NBGA 3CPWY 1QVFY 1Q862 2P3YA 1VQKZ 3U50C 3CC41 1P9NA 3CPWZ 1LQLA 3S17I 1KC81 3BG0B 2Y0SA 4E2YA 4A3II 1S721 3HOVI 4E2XA 3CCQZ 4BXXI 3J80f 2JNYA 1Q811 2NVYI 1VQ4Z 3S16I 1VQ71 5T6BA 4A3FI 1VQP1 3G4S1 3CC4Z 1TFIA 1VQ51 5FLXb 3HKZA 3RZDI 4NBDA 3GTGI 2OOYB 2J6AA 1QF8A 1S72Z 3MZLB 4RVDA 2QREB 2ZAEB 3FQMA 3T4NB 2K3RA 1M1K2 4NBBA 2M48A 3HOXI 4A3DI 2QR1B 1VQ9Z 4RVFA 1RO2A 2WB1A 2QRDB 3G4SZ 2RIQA 4NB9A 4NBHA 3VMIA 1ZH1A 3IFUA 3CME1 3S1NI 2GTIA 3HOZI 4NH1C 3GTMI 5T64A 3P5JB 3GTMS 4BBRI 3I561 1VQL1 3VTNA 1USPB 1KD12 3I4MI 3CCS1 4RS4A 2JA6I 3IX0A 2VUMI 2KI7B 3RZOI 2YADA 4MONA 1I3QI 2E2HI 1RO0A 1YJNZ 1RQFA 3TDHB 3CC21 1VQOZ 2E2II 5C4JI 2LIYA 2QEXZ 2OTLZ 1K732 1JJ2Y 4DK1A 1W2BY 1K8A2 2B63I 3H0GI 1TWCI 4MXUA 3GCFA 3VMHA 2NVTI 1JJ2Z 2HF1A 1W2BZ 3H3VJ 1KQSY 1YHQZ 3MONA 1ML8A 1Y1VI 2G2KA 3CCQ1 1Y1VS 2P28A 2RBLA 3CMA1 3EERA 3Q87A 1Q7Y2 1NUIA 3CD6Z 3G6E1 2JA5I 4A3CI 2F4MA 2JA7I 2PM9A 4NB8A 1YIJ1 1K9M1 1VLAA 5A2Qb 3I4NI 4E2ZA 1Z03A 4MH4A 3CMAZ 1X3WA 3D9XA 5IT9b 1VQ91 1SFOI 1TWHI 3JAMb 3G6EZ 1YJWZ 5D1OB 1X3ZA 1USPA 3HOYI 2R93I 1DL6A 1Z01A 3OW2Y 2K5RA 4MD7A 4BY1I 1YIJZ 3CCU1 2IZ4A 1Q821 3J7A4 1TWAI 3M3YI 3CCEZ 3OW2Z 1X0TA 2H85A 3G71Z 4HH4A 3QWUA 1N8R1 2NVQI 3S2DI 4RVHA 1PFTA 4TNUA 4DGLA 3HOWI 5IP7I 4E32A 2IZ3A 2JA8I 1RO4A 5IP9I 5A2Qf 2QA41 3CCUZ 3KIFA 1KC82 1YJN1 4A3GI 1YUKA 5IT9f 5C44I 1Q812 1VQO1 3GTPI 5AN9F 2QEX1 2OTL1 1WCMI 2QRCB 5FLXf 2Q4ZA 3EEDA 1KRLA 1TWFI 1YHQ1 2QA4Z 3S1RI 3LUSA 2R7ZI 3VMGA 2OTJZ 1N8R2 2VUGA 3J81b 4XX2A 3GKQA 5T67A 4A93I 1Q861 2V8KA 3CC71 4A3BI 3PO3I 1YJ9Z 3CCM1 1Y1WI 3PO3S 1VQN1 3FQQA 3CD61 2V8JA 4A3EI 1VQ8Z 4NOZA 3S2HI 3TE5B 3NDIA 3F3FC 3CCJZ 1QVGZ 1WW9A 1I50I 1S7MA 1YI21 2RPRA 3GTKI 4X6AI 5D1OA 1QYPA 4RV9A 2OZKA 3MZKB 3NFZA 2DE5A 4E2WA 3KIHA 2R6MA 3CC7Z 1I6HI 3CCMZ 4AYBA 2JR6A 1VQNZ 1VQM1 1YJW1 2NVXI 3S14I 4Y7NI 3GTOI 2EGTA 5LL6f 4QTUA 3CCR1 1YI2Z 3FKII 1M1K1 3ESWA 3J81f 2JMOA 3CCE1 4E33A 3G711 1K83I 3F3PC 1L1OC 2QLVB 4BBSI 4QTTA 1RNIA 1NJI1 1VQ61 4MRIA 1VQMZ 4HGZA 1QVFZ 4DQYB 2JS4A 2OOXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC Y;  1YJN Z;  2QA4 1;  1KQS Z;  3CCU Z;  3CCR Z;  1KC8 2;  3CC2 Z;  1KD1 1;  1YJN 1;  3CCL Z;  3CC2 1;  1YIT Z;  1VQO Z;  3CXC Z;  3CCL 1;  1YIT 1;  2QEX Z;  1Q81 2;  1M90 2;  1VQO 1;  2OTL Z;  1K73 2;  1VQ4 1;  1JJ2 Y;  2QEX 1;  1W2B Y;  1K8A 2;  2OTL 1;  3CPW Y;  1QVF Y;  1VQ6 Z;  1Q86 2;  1VQK Z;  1JJ2 Z;  3CC4 1;  1W2B Z;  1KQS Y;  3CPW Z;  1YHQ Z;  1YHQ 1;  2QA4 Z;  1KC8 1;  1K9M 2;  1S72 1;  3I55 1;  3CCQ Z;  1Q81 1;  1K73 1;  1VQ4 Z;  3CCQ 1;  1VQ7 Z;  2OTJ Z;  1N8R 2;  3CMA 1;  1K8A 1;  1VQ7 1;  2OTJ 1;  1Q86 1;  1VQP Z;  3CC7 1;  1Q7Y 2;  1NJI 2;  1YJ9 Z;  1VQP 1;  3G4S 1;  3CC4 Z;  1VQ5 Z;  3G6E 1;  3CD6 Z;  3CCM 1;  1YJ9 1;  1VQN 1;  3CD6 1;  1VQ5 1;  1VQ8 Z;  1VQ8 1;  3CCJ Z;  3CCV 1;  1YIJ 1;  1QVG Z;  1K9M 1;  1S72 Z;  3I55 Z;  3CCJ 1;  1Q82 2;  1YI2 1;  1M1K 2;  1M90 1;  3CMA Z;  1VQ9 Z;  3CC7 Z;  1Q7Y 1;  1VQ9 1;  3CME Z;  3G4S Z;  3G6E Z;  3CCM Z;  1YJW Z;  3CME 1;  1VQN Z;  1VQM 1;  1YJW 1;  1QVG Y;  3I56 Z;  1VQL Z;  3OW2 Y;  3CCV Z;  1YIJ Z;  3I56 1;  1VQL 1;  3CCS Z;  3CCU 1;  3CCR 1;  1KD1 2;  1Q82 1;  1YI2 Z;  3CCS 1;  1M1K 1;  3CCE Z;  3OW2 Z;  3G71 Z;  3CCE 1;  1N8R 1;  3G71 1;  1NJI 1;  1VQ6 1;  1VQK 1;  1VQM Z;  1QVF Z; 
#chains in the Genus database with same CATH topology
 4MD9 A;  3S1Q I;  2YU9 I;  3CCR Z;  1KD1 1;  2KPI A;  3D6W A;  3CCL Z;  1YIT Z;  4A3J I;  2HU9 A;  1VQ6 Z;  4RVG A;  3VB9 A;  1WII A;  4NBE A;  3BG1 B;  2PMZ A;  2V8I A;  5CM2 M;  1YUA A;  2VF1 A;  3GTJ I;  2RT9 A;  2JIP A;  1K9M 2;  2GTH A;  3S1M I;  3I55 1;  3GTQ I;  3I07 A;  4NFR A;  2W04 A;  1K73 1;  1TWG I;  1RLY A;  1VQ7 Z;  1JWH C;  2DE6 A;  1NP6 A;  2LFU A;  4MD8 A;  1K8A 1;  3JAM f;  3IR7 A;  2OTJ 1;  1VQP Z;  2I3C A;  1NJI 2;  2JIM A;  1N2F A;  1VQ5 Z;  3NH5 A;  1YJ9 1;  3NH8 A;  4E30 A;  1VQ8 1;  3D2L A;  2AKL A;  2R92 I;  3CCV 1;  1ZB8 A;  3CQZ I;  2O53 A;  3I55 Z;  3CCJ 1;  1Q82 2;  3GTL I;  2VPZ A;  3K7A I;  2W03 A;  1M90 1;  3PO2 I;  5D1P A;  2O4H A;  2WAQ A;  4S1T A;  1Q7Y 1;  3CME Z;  2IV2 X;  3NDJ A;  4NBC A;  2Q51 A;  4NBF A;  2RHB A;  2QKD A;  1QVG Y;  3I56 Z;  1VQL Z;  5C4X I;  3CCV Z;  3CCS Z;  2GU2 A;  2E2J I;  3M4O I;  3IF8 A;  4NBA A;  3HOU I;  3NH4 A;  1AA6 A;  4A3L I;  2PK7 A;  3J80 b;  4A3K I;  4Y52 I;  4CL1 A;  1Z02 A;  1R9T I;  1VQK 1;  2M6N A;  4A3M I;  4E31 A;  2E9H A;  2BJO A;  4BY7 I;  3CXC Y;  1KQS Z;  4HGY A;  3CC2 Z;  2F4O A;  1ZB9 A;  5FLM I;  5C3E I;  3CXC Z;  3CCL 1;  1YIT 1;  2DE7 A;  1M90 2;  1VQ4 1;  2JUB A;  2V3V A;  4EWC A;  3S15 I;  4NBG A;  3CPW Y;  2V45 A;  1QVF Y;  1Q86 2;  2P3Y A;  1VQK Z;  3U50 C;  3CC4 1;  1P9N A;  3CPW Z;  1LQL A;  3S17 I;  1KC8 1;  3BG0 B;  2Y0S A;  4E2Y A;  4A3I I;  1S72 1;  3HOV I;  4E2X A;  3CCQ Z;  4BXX I;  3J80 f;  2JNY A;  1Q81 1;  2NVY I;  1VQ4 Z;  3S16 I;  1VQ7 1;  2JIQ A;  5T6B A;  4A3F I;  1VQP 1;  3G4S 1;  3CC4 Z;  1TFI A;  1VQ5 1;  5FLX b;  3HKZ A;  3RZD I;  4NBD A;  3GTG I;  1Q16 A;  2J6A A;  2OOY B;  1QF8 A;  1S72 Z;  2NAP A;  3MZL B;  4RVD A;  2QRE B;  2ZAE B;  3FQM A;  3T4N B;  2K3R A;  1M1K 2;  4NBB A;  2M48 A;  3HOX I;  4A3D I;  2QR1 B;  1VQ9 Z;  4RVF A;  1RO2 A;  2WB1 A;  2QRD B;  3G4S Z;  2RIQ A;  4NB9 A;  1WJ2 A;  4NBH A;  3VMI A;  1ZH1 A;  3IFU A;  3CME 1;  3S1N I;  2GTI A;  3HOZ I;  4NH1 C;  3GTM I;  5T64 A;  3P5J B;  3GTM S;  2VPW A;  4BBR I;  3I56 1;  3VTN A;  1USP B;  1VQL 1;  1KD1 2;  3I4M I;  3CCS 1;  4RS4 A;  2JA6 I;  3IX0 A;  2VUM I;  2KI7 B;  3RZO I;  2YAD A;  2JIR A;  4MON A;  1I3Q I;  2E2H I;  1RO0 A;  1YJN Z;  1RQF A;  3TDH B;  3CC2 1;  1VQO Z;  2E2I I;  5C4J I;  2LIY A;  2QEX Z;  2OTL Z;  1K73 2;  1JJ2 Y;  4DK1 A;  1W2B Y;  1K8A 2;  2B63 I;  3H0G I;  1TWC I;  4MXU A;  3GCF A;  3VMH A;  2NVT I;  1JJ2 Z;  2HF1 A;  1W2B Z;  3H3V J;  1KQS Y;  1YHQ Z;  3MON A;  1ML8 A;  1Y1V I;  2G2K A;  3CCQ 1;  1Y1V S;  2P28 A;  2RBL A;  3CMA 1;  3EER A;  3Q87 A;  1Q7Y 2;  1NUI A;  3CD6 Z;  3G6E 1;  1FDI A;  2JA5 I;  2VPX A;  4A3C I;  2F4M A;  1QXF A;  2JA7 I;  2PM9 A;  4NB8 A;  2JIO A;  1YIJ 1;  1VLA A;  1K9M 1;  5A2Q b;  3I4N I;  4E2Z A;  1Z03 A;  4MH4 A;  3CMA Z;  1X3W A;  3D9X A;  5IT9 b;  1VQ9 1;  1SFO I;  1TWH I;  3JAM b;  3G6E Z;  1YJW Z;  5D1O B;  1X3Z A;  1USP A;  3HOY I;  1SIW A;  2R93 I;  1DL6 A;  2VPY A;  1Z01 A;  3OW2 Y;  2K5R A;  4MD7 A;  4BY1 I;  1YIJ Z;  3CCU 1;  2IZ4 A;  1Q82 1;  3J7A 4;  1TWA I;  3M3Y I;  3CCE Z;  3OW2 Z;  1X0T A;  2H85 A;  3G71 Z;  4HH4 A;  3QWU A;  1N8R 1;  2NVQ I;  3S2D I;  4RVH A;  1PFT A;  4TNU A;  4DGL A;  3HOW I;  1Y8C A;  5IP7 I;  4E32 A;  2IZ3 A;  2JA8 I;  1RO4 A;  5IP9 I;  5A2Q f;  2QA4 1;  3CCU Z;  3KIF A;  1KC8 2;  1YJN 1;  4A3G I;  1YUK A;  5IT9 f;  5C44 I;  1Q81 2;  2AYD A;  1VQO 1;  3GTP I;  5AN9 F;  2QEX 1;  2OTL 1;  1WCM I;  2QRC B;  5FLX f;  2Q4Z A;  3EED A;  1KRL A;  1TWF I;  1YHQ 1;  2QA4 Z;  3S1R I;  3LUS A;  2R7Z I;  3VMG A;  2OTJ Z;  1N8R 2;  2VUG A;  3J81 b;  4XX2 A;  3GKQ A;  5T67 A;  4A93 I;  1Q86 1;  2V8K A;  3CC7 1;  4A3B I;  3PO3 I;  1YJ9 Z;  3CCM 1;  1Y1W I;  3PO3 S;  1VQN 1;  3FQQ A;  3CD6 1;  2V8J A;  4A3E I;  1VQ8 Z;  4NOZ A;  3S2H I;  3TE5 B;  3NDI A;  3F3F C;  3CCJ Z;  1QVG Z;  1WW9 A;  1FDO A;  1I50 I;  1S7M A;  1YI2 1;  2RPR A;  3GTK I;  4X6A I;  5D1O A;  1QYP A;  4RV9 A;  2OZK A;  3MZK B;  3NFZ A;  2DE5 A;  4E2W A;  3KIH A;  2R6M A;  3CC7 Z;  1I6H I;  2E7Z A;  3CCM Z;  4AYB A;  2JR6 A;  1VQN Z;  1VQM 1;  1YJW 1;  2NVX I;  3S14 I;  4Y7N I;  3GTO I;  2EGT A;  5LL6 f;  4QTU A;  3CCR 1;  1YI2 Z;  3FKI I;  2LEX A;  1M1K 1;  3ESW A;  3J81 f;  2JMO A;  3CCE 1;  4E33 A;  3G71 1;  1K83 I;  3F3P C;  1L1O C;  2QLV B;  4BBS I;  4QTT A;  1WZN A;  1RNI A;  1NJI 1;  1VQ6 1;  4MRI A;  1VQM Z;  4HGZ A;  1QVF Z;  4DQY B;  2JS4 A;  2OOX B; 
#chains in the Genus database with same CATH homology
 4MD9 A;  3S1Q I;  2YU9 I;  3CCR Z;  1KD1 1;  2KPI A;  3D6W A;  3CCL Z;  1YIT Z;  4A3J I;  2HU9 A;  1VQ6 Z;  4RVG A;  3VB9 A;  1WII A;  4NBE A;  3BG1 B;  2PMZ A;  2V8I A;  5CM2 M;  1YUA A;  2VF1 A;  3GTJ I;  2RT9 A;  1K9M 2;  2GTH A;  3S1M I;  3I55 1;  3GTQ I;  3I07 A;  4NFR A;  2W04 A;  1K73 1;  1TWG I;  1RLY A;  1VQ7 Z;  1JWH C;  2DE6 A;  1NP6 A;  2LFU A;  4MD8 A;  1K8A 1;  3JAM f;  2OTJ 1;  1VQP Z;  2I3C A;  1NJI 2;  1N2F A;  1VQ5 Z;  3NH5 A;  1YJ9 1;  3NH8 A;  4E30 A;  1VQ8 1;  2AKL A;  2R92 I;  3CCV 1;  1ZB8 A;  3CQZ I;  2O53 A;  3I55 Z;  3CCJ 1;  1Q82 2;  3GTL I;  3K7A I;  2W03 A;  1M90 1;  3PO2 I;  5D1P A;  2O4H A;  2WAQ A;  4S1T A;  1Q7Y 1;  3CME Z;  3NDJ A;  4NBC A;  2Q51 A;  4NBF A;  2RHB A;  2QKD A;  1QVG Y;  3I56 Z;  1VQL Z;  5C4X I;  3CCV Z;  3CCS Z;  2GU2 A;  2E2J I;  3M4O I;  3IF8 A;  4NBA A;  3HOU I;  3NH4 A;  4A3L I;  2PK7 A;  3J80 b;  4A3K I;  4Y52 I;  4CL1 A;  1Z02 A;  1R9T I;  1VQK 1;  2M6N A;  4A3M I;  4E31 A;  2E9H A;  2BJO A;  4BY7 I;  3CXC Y;  1KQS Z;  4HGY A;  3CC2 Z;  2F4O A;  1ZB9 A;  5FLM I;  5C3E I;  3CXC Z;  3CCL 1;  1YIT 1;  2DE7 A;  1M90 2;  1VQ4 1;  2JUB A;  4EWC A;  3S15 I;  4NBG A;  3CPW Y;  1QVF Y;  1Q86 2;  2P3Y A;  1VQK Z;  3U50 C;  3CC4 1;  1P9N A;  3CPW Z;  1LQL A;  3S17 I;  1KC8 1;  3BG0 B;  2Y0S A;  4E2Y A;  4A3I I;  1S72 1;  3HOV I;  4E2X A;  3CCQ Z;  4BXX I;  3J80 f;  2JNY A;  1Q81 1;  2NVY I;  1VQ4 Z;  3S16 I;  1VQ7 1;  5T6B A;  4A3F I;  1VQP 1;  3G4S 1;  3CC4 Z;  1TFI A;  1VQ5 1;  5FLX b;  3HKZ A;  3RZD I;  4NBD A;  3GTG I;  2OOY B;  2J6A A;  1QF8 A;  1S72 Z;  3MZL B;  4RVD A;  2QRE B;  2ZAE B;  3FQM A;  3T4N B;  2K3R A;  1M1K 2;  4NBB A;  2M48 A;  3HOX I;  4A3D I;  2QR1 B;  1VQ9 Z;  4RVF A;  1RO2 A;  2WB1 A;  2QRD B;  3G4S Z;  2RIQ A;  4NB9 A;  4NBH A;  3VMI A;  1ZH1 A;  3IFU A;  3CME 1;  3S1N I;  2GTI A;  3HOZ I;  4NH1 C;  3GTM I;  5T64 A;  3P5J B;  3GTM S;  4BBR I;  3I56 1;  1VQL 1;  3VTN A;  1USP B;  1KD1 2;  3I4M I;  3CCS 1;  4RS4 A;  2JA6 I;  3IX0 A;  2VUM I;  2KI7 B;  3RZO I;  2YAD A;  4MON A;  1I3Q I;  2E2H I;  1RO0 A;  1YJN Z;  1RQF A;  3TDH B;  3CC2 1;  1VQO Z;  2E2I I;  5C4J I;  2LIY A;  2QEX Z;  2OTL Z;  1K73 2;  1JJ2 Y;  4DK1 A;  1W2B Y;  1K8A 2;  2B63 I;  3H0G I;  1TWC I;  4MXU A;  3GCF A;  3VMH A;  2NVT I;  1JJ2 Z;  2HF1 A;  1W2B Z;  3H3V J;  1KQS Y;  1YHQ Z;  3MON A;  1ML8 A;  1Y1V I;  2G2K A;  3CCQ 1;  1Y1V S;  2P28 A;  2RBL A;  3CMA 1;  3EER A;  3Q87 A;  1Q7Y 2;  1NUI A;  3CD6 Z;  3G6E 1;  2JA5 I;  4A3C I;  2F4M A;  2JA7 I;  2PM9 A;  4NB8 A;  1YIJ 1;  1K9M 1;  1VLA A;  5A2Q b;  3I4N I;  4E2Z A;  1Z03 A;  4MH4 A;  3CMA Z;  1X3W A;  3D9X A;  5IT9 b;  1VQ9 1;  1SFO I;  1TWH I;  3JAM b;  3G6E Z;  1YJW Z;  5D1O B;  1X3Z A;  1USP A;  3HOY I;  2R93 I;  1DL6 A;  1Z01 A;  3OW2 Y;  2K5R A;  4MD7 A;  4BY1 I;  1YIJ Z;  3CCU 1;  2IZ4 A;  1Q82 1;  3J7A 4;  1TWA I;  3M3Y I;  3CCE Z;  3OW2 Z;  1X0T A;  2H85 A;  3G71 Z;  4HH4 A;  3QWU A;  1N8R 1;  2NVQ I;  3S2D I;  4RVH A;  1PFT A;  4TNU A;  4DGL A;  3HOW I;  5IP7 I;  4E32 A;  2IZ3 A;  2JA8 I;  1RO4 A;  5IP9 I;  5A2Q f;  2QA4 1;  3CCU Z;  3KIF A;  1KC8 2;  1YJN 1;  4A3G I;  1YUK A;  5IT9 f;  5C44 I;  1Q81 2;  1VQO 1;  3GTP I;  5AN9 F;  2QEX 1;  2OTL 1;  1WCM I;  2QRC B;  5FLX f;  2Q4Z A;  3EED A;  1KRL A;  1TWF I;  1YHQ 1;  2QA4 Z;  3S1R I;  3LUS A;  2R7Z I;  3VMG A;  2OTJ Z;  1N8R 2;  2VUG A;  3J81 b;  4XX2 A;  3GKQ A;  5T67 A;  4A93 I;  1Q86 1;  2V8K A;  3CC7 1;  4A3B I;  3PO3 I;  1YJ9 Z;  3CCM 1;  1Y1W I;  3PO3 S;  1VQN 1;  3FQQ A;  3CD6 1;  2V8J A;  4A3E I;  1VQ8 Z;  4NOZ A;  3S2H I;  3TE5 B;  3NDI A;  3F3F C;  3CCJ Z;  1QVG Z;  1WW9 A;  1I50 I;  1S7M A;  1YI2 1;  2RPR A;  3GTK I;  4X6A I;  5D1O A;  1QYP A;  4RV9 A;  2OZK A;  3MZK B;  3NFZ A;  2DE5 A;  4E2W A;  3KIH A;  2R6M A;  3CC7 Z;  1I6H I;  3CCM Z;  4AYB A;  2JR6 A;  1VQN Z;  1VQM 1;  1YJW 1;  2NVX I;  3S14 I;  4Y7N I;  3GTO I;  2EGT A;  5LL6 f;  4QTU A;  3CCR 1;  1YI2 Z;  3FKI I;  1M1K 1;  3ESW A;  3J81 f;  2JMO A;  3CCE 1;  4E33 A;  3G71 1;  1K83 I;  3F3P C;  1L1O C;  2QLV B;  4BBS I;  4QTT A;  1RNI A;  1NJI 1;  1VQ6 1;  4MRI A;  1VQM Z;  4HGZ A;  1QVF Z;  4DQY B;  2JS4 A;  2OOX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...