3CD61

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6100
2OTJ1 3CCRZ 1S72Z 3CMEZ 1VQMZ 1YJW1 1VQPZ 3CCQZ 2OTL1 1VQK1 1W2BY 3G4SZ 3G71Z 1YI2Z 2QA41 1VQ51 1W2BZ 1YJ9Z 1YITZ 1JJ2Y 3CXCZ 3G6E1 3I561 3CC41 1Q811 1VQ91 3CCVZ 2QEXZ 1Q861 3CCLZ 1YHQZ 1K8A1 3CC71 1VQOZ 1YJNZ 1VQNZ 3CC21 3CCM1 1M1K1 3CCS1 1VQ8Z 3CD61 3CCUZ 3I55Z 1VQ7Z 1K732 1VQ41 3CCR1 1KD12 3CCEZ 1S721 3CME1 1VQM1 1JJ2Z 1VQP1 3CCQ1 1Q7Y2 1QVFY 1K731 3OW2Y 3G4S1 3CCJZ 3G711 3CMAZ 1QVFZ 1YI21 1YJ91 1KC82 3OW2Z 1KD11 1YIT1 1VQ6Z 1KQSY 1YIJZ 1VQLZ 1KQSZ 2OTJZ 1M902 3CCV1 2QEX1 1YJWZ 3CCL1 2OTLZ 1VQKZ 1NJI2 1Q822 1YHQ1 1N8R2 3CPWY 1VQO1 2QA4Z 1YJN1 1VQ5Z 1VQN1 1M901 1VQ81 3CCU1 3G6EZ 3I551 1VQ71 1NJI1 1Q821 3I56Z 3CC4Z 1N8R1 1VQ9Z 1K9M2 3CCE1 1Q812 1Q7Y1 1QVGY 3CXCY 1Q862 1QVGZ 3CC7Z 1KC81 3CCJ1 3CMA1 1K8A2 3CC2Z 3CCMZ 3CCSZ 1K9M1 3CD6Z 1VQ61 1M1K2 1YIJ1 3CPWZ 1VQL1 1VQ4Z
chains in the Genus database with same CATH superfamily
2QRCB 2GTIA 3CMEZ 1X0TA 2NVYI 3CCQZ 1VQK1 1WW9A 2I3CA 1VQ51 2W03A 1YJ9Z 1JJ2Y 3CXCZ 2G2KA 3I561 4Y7NI 3CCVZ 2IV2X 2DE6A 3NDIA 4E33A 2J6AA 2O53A 4BBSI 1ZB8A 3CC71 2B63I 4MRIA 1VQNZ 1I6HI 1X3WA 4AYBA 1Y8CA 3I55Z 3IR7A 1NUIA 2OZKA 3Q87A 4X6AI 3NH4A 2LIYA 3CCEZ 2VPWA 1VQM1 2R6MA 2JS4A 1K731 3D2LA 3G4S1 5T64A 1QVFZ 1YI21 1SIWA 1KD11 3HKZA 4NB8A 5A2Qb 1ZH1A 4A3CI 1KQSZ 2OTJZ 1M902 1YJWZ 2W04A 3CCL1 3JAMf 1Q822 2RT9A 3CQZI 4RV9A 1VQO1 5T6BA 2Y0SA 2QA4Z 4MD7A 2IZ3A 3FKII 1X3ZA 5C3EI 3GTJI 3I4NI 1N8R1 1VQ9Z 1LQLA 5IP9I 3D6WA 3RZDI 3K7AI 3CXCY 2YADA 3BG0B 3NH5A 3F3FC 1QVGZ 2VPYA 3CC2Z 1K9M1 3CD6Z 4MONA 1VQ61 2K3RA 3GKQA 4A3JI 2V3VA 1VQL1 2E2II 4RS4A 1R9TI 3CCRZ 3RZOI 4QTTA 4CL1A 5C4JI 2QLVB 3J81f 1VQPZ 2OTL1 5FLXb 1W2BY 3HOYI 1TWAI 3G6E1 2VUGA 3M4OI 3CC41 2V45A 2QEXZ 1TWFI 3GTKI 2V8IA 2WAQA 4NBFA 3GTOI 4NB9A 3F3PC 3CCM1 3HOZI 3CCS1 5LL6f 3VMGA 1VQ8Z 3GTLI 1YUKA 1S7MA 4E2WA 1VQ7Z 5C4XI 1K732 1JWHC 2QKDA 2Q51A 4E31A 4RVDA 2AYDA 1KD12 1S721 2RPRA 4MD9A 2JIRA 3S1QI 1NP6A 4MH4A 3MONA 2VUMI 3OW2Y 2WB1A 3G711 3CCJZ 4A3DI 1FDOA 2DE5A 3TE5B 4NBDA 1YIT1 2O4HA 5IT9b 1RO4A 1TWHI 1YIJZ 4A3MI 3EERA 1Y1WI 2M6NA 4RVHA 1VQKZ 3S16I 3VMIA 3HOWI 1YHQ1 3S17I 3IX0A 1N8R2 4BY7I 1YJN1 1VQ5Z 3M3YI 3CCU1 2QREB 2NAPA 2NVTI 3FQQA 5T67A 4NBAA 5FLMI 3S1RI 3I56Z 2ZAEB 4E30A 1K9M2 2KI7B 1Q812 4A3EI 4RVFA 2JMOA 2JIPA 1L1OC 2JR6A 1Q862 3H3VJ 2HU9A 3CC7Z 1QYPA 3BG1B 3CMA1 1K8A2 2GU2A 1M1K2 1RQFA 4NBEA 5C44I 2KPIA 4DK1A 3CPWZ 1VLAA 1VQMZ 2H85A 3TDHB 3G4SZ 1YI2Z 4NBBA 3GTMI 2VF1A 1Q811 1Z02A 1SFOI 4NBGA 3HOUI 2R93I 4A93I 1Q861 3CCLZ 1TFIA 1TWCI 2E2HI 2VPZA 1KRLA 2P3YA 1K8A1 1VQOZ 3NH8A 2HF1A 3EEDA 5FLXf 1M1K1 4MXUA 4HGZA 2BJOA 4HH4A 2E2JI 1VQ41 4A3FI 4A3LI 3NDJA 4EWCA 3CME1 3MZKB 5D1PA 3J80b 3CCQ1 1Q7Y2 1QVFY 2QR1B 3IFUA 1Z01A 3I4MI 1YJ91 1KC82 1VQ6Z 1KQSY 5CM2M 2PK7A 3HOXI 4NFRA 1VQLZ 2Q4ZA 3CCV1 2LEXA 2JIQA 2JA5I 2OTLZ 2IZ4A 1QF8A 4DQYB 3CPWY 4RVGA 3FQMA 1VQN1 1K83I 1ZB9A 2EGTA 1RO2A 4E2XA 3ESWA 4TNUA 4A3BI 4NBHA 2VPXA 3G6EZ 3KIFA 3I551 1QXFA 1NJI1 3U50C 3CC4Z 3D9XA 5IT9f 1RNIA 3QWUA 3CCE1 3VTNA 1Q7Y1 2JA8I 1QVGY 1KC81 3S14I 1WZNA 4BBRI 3CCMZ 1Y1VS 2QRDB 4QTUA 3CCSZ 4HGYA 4A3GI 3H0GI 2M48A 1AA6A 5D1OB 2OTJ1 2R7ZI 4BXXI 1RO0A 4DGLA 1S72Z 1YJW1 3GTMS 4BY1I 4NBCA 4MD8A 1USPB 3G71Z 5A2Qf 2QA41 1W2BZ 2JIOA 1YITZ 2PMZA 1I3QI 2RIQA 1VQ91 2P28A 3GCFA 2PM9A 4Y52I 4NH1C 1P9NA 3S1NI 1YHQZ 1YJNZ 1RLYA 4XX2A 3CC21 1Y1VI 3CD61 3GTQI 3CCUZ 2V8JA 3NFZA 1YUAA 3S2DI 2F4OA 4NOZA 2DE7A 2JA7I 3JAMb 4S1TA 3CCR1 1JJ2Z 3T4NB 1VQP1 3VMHA 2JUBA 5AN9F 1FDIA 3KIHA 1WCMI 3CMAZ 3PO3S 3OW2Z 3S15I 2GTHA 1Z03A 2AKLA 3HOVI 3I07A 1Q16A 5D1OA 2RBLA 4E2ZA 2LFUA 2OOYB 2V8KA 3GTGI 3GTPI 4A3II 3S2HI 1TWGI 2QEX1 2NVXI 2RHBA 1USPA 1NJI2 3J7A4 3VB9A 2K5RA 2JIMA 2R92I 3J80f 3PO2I 1M901 2E7ZA 1VQ81 2OOXB 3S1MI 5IP7I 4E32A 3LUSA 1DL6A 1VQ71 3J81b 1Q821 2JA6I 4E2YA 1I50I 3IF8A 1N2FA 3MZLB 2YU9I 3P5JB 1ML8A 1WIIA 4A3KI 3CCJ1 1WJ2A 2JNYA 3PO3I 1PFTA 2F4MA 2NVQI 1YIJ1 2E9HA 1VQ4Z
chains in the Genus database with same CATH topology
2QRCB 2GTIA 3CMEZ 1X0TA 2NVYI 3CCQZ 1VQK1 1WW9A 2I3CA 1VQ51 2W03A 1YJ9Z 1JJ2Y 3CXCZ 2G2KA 3I561 4Y7NI 3CCVZ 2DE6A 3NDIA 4E33A 2J6AA 2O53A 4BBSI 1ZB8A 3CC71 2B63I 4MRIA 1VQNZ 1I6HI 1X3WA 4AYBA 3I55Z 1NUIA 2OZKA 3Q87A 4X6AI 3NH4A 2LIYA 3CCEZ 1VQM1 2R6MA 2JS4A 1K731 3G4S1 5T64A 1QVFZ 1YI21 1KD11 3HKZA 4NB8A 5A2Qb 1ZH1A 4A3CI 1KQSZ 2OTJZ 1M902 1YJWZ 2W04A 3CCL1 3JAMf 1Q822 2RT9A 3CQZI 4RV9A 1VQO1 5T6BA 2Y0SA 2QA4Z 4MD7A 2IZ3A 3FKII 1X3ZA 5C3EI 3GTJI 3I4NI 1N8R1 1VQ9Z 1LQLA 5IP9I 3D6WA 3RZDI 3K7AI 3CXCY 2YADA 3BG0B 3NH5A 3F3FC 1QVGZ 3CC2Z 1K9M1 3CD6Z 4MONA 1VQ61 2K3RA 3GKQA 4A3JI 1VQL1 2E2II 4RS4A 1R9TI 3CCRZ 3RZOI 4QTTA 4CL1A 5C4JI 2QLVB 3J81f 1VQPZ 2OTL1 5FLXb 1W2BY 3HOYI 1TWAI 3G6E1 2VUGA 3M4OI 3CC41 2QEXZ 1TWFI 3GTKI 2V8IA 2WAQA 4NBFA 3GTOI 4NB9A 3F3PC 3CCM1 3HOZI 3CCS1 5LL6f 3VMGA 1VQ8Z 3GTLI 1YUKA 1S7MA 4E2WA 1VQ7Z 5C4XI 1K732 1JWHC 2QKDA 2Q51A 4E31A 4RVDA 1KD12 1S721 2RPRA 4MD9A 3S1QI 1NP6A 4MH4A 3MONA 2VUMI 3OW2Y 2WB1A 3G711 3CCJZ 4A3DI 2DE5A 3TE5B 4NBDA 1YIT1 2O4HA 5IT9b 1RO4A 1TWHI 1YIJZ 4A3MI 3EERA 1Y1WI 2M6NA 4RVHA 1VQKZ 3S16I 3VMIA 3HOWI 1YHQ1 3S17I 3IX0A 1N8R2 4BY7I 1YJN1 1VQ5Z 3M3YI 3CCU1 2QREB 2NVTI 3FQQA 5T67A 4NBAA 5FLMI 3S1RI 3I56Z 2ZAEB 4E30A 1K9M2 2KI7B 1Q812 4A3EI 4RVFA 2JMOA 1L1OC 2JR6A 1Q862 3H3VJ 2HU9A 3CC7Z 1QYPA 3BG1B 3CMA1 1K8A2 2GU2A 1M1K2 1RQFA 4NBEA 5C44I 2KPIA 4DK1A 3CPWZ 1VLAA 1VQMZ 2H85A 3TDHB 3G4SZ 1YI2Z 4NBBA 3GTMI 2VF1A 1Q811 1Z02A 1SFOI 4NBGA 3HOUI 2R93I 4A93I 1Q861 3CCLZ 1TFIA 1TWCI 2E2HI 1KRLA 2P3YA 1K8A1 1VQOZ 3NH8A 2HF1A 3EEDA 5FLXf 1M1K1 4MXUA 4HGZA 2BJOA 4HH4A 2E2JI 1VQ41 4A3FI 4A3LI 3NDJA 4EWCA 3CME1 3MZKB 5D1PA 3J80b 3CCQ1 1Q7Y2 1QVFY 2QR1B 3IFUA 1Z01A 3I4MI 1YJ91 1KC82 1VQ6Z 1KQSY 5CM2M 2PK7A 3HOXI 4NFRA 1VQLZ 2Q4ZA 3CCV1 2JA5I 2OTLZ 2IZ4A 1QF8A 4DQYB 3CPWY 4RVGA 3FQMA 1VQN1 1K83I 1ZB9A 2EGTA 1RO2A 4E2XA 3ESWA 4TNUA 4A3BI 4NBHA 3KIFA 3G6EZ 3I551 1NJI1 3U50C 3CC4Z 3D9XA 5IT9f 1RNIA 3QWUA 3CCE1 3VTNA 1Q7Y1 2JA8I 1QVGY 1KC81 3S14I 4BBRI 3CCMZ 1Y1VS 2QRDB 4QTUA 3CCSZ 4HGYA 4A3GI 3H0GI 2M48A 5D1OB 2OTJ1 2R7ZI 4BXXI 1RO0A 4DGLA 1S72Z 1YJW1 3GTMS 4BY1I 4NBCA 4MD8A 1USPB 3G71Z 5A2Qf 2QA41 1W2BZ 1YITZ 2PMZA 1I3QI 2RIQA 1VQ91 2P28A 3GCFA 2PM9A 4Y52I 4NH1C 1P9NA 3S1NI 1YHQZ 1YJNZ 1RLYA 4XX2A 3CC21 1Y1VI 3CD61 3GTQI 3CCUZ 2V8JA 3NFZA 1YUAA 3S2DI 2F4OA 4NOZA 2DE7A 2JA7I 3JAMb 4S1TA 3CCR1 1JJ2Z 3T4NB 1VQP1 3VMHA 2JUBA 5AN9F 3KIHA 1WCMI 3CMAZ 3PO3S 3OW2Z 3S15I 2GTHA 1Z03A 2AKLA 3HOVI 3I07A 5D1OA 2RBLA 4E2ZA 2LFUA 2OOYB 2V8KA 3GTGI 3GTPI 4A3II 3S2HI 1TWGI 2QEX1 2NVXI 2RHBA 1USPA 1NJI2 3J7A4 3VB9A 2K5RA 2R92I 3J80f 3PO2I 1M901 1VQ81 2OOXB 3S1MI 5IP7I 4E32A 3LUSA 1DL6A 1VQ71 3J81b 1Q821 2JA6I 4E2YA 1I50I 3IF8A 1N2FA 3MZLB 2YU9I 3P5JB 1ML8A 1WIIA 4A3KI 3CCJ1 2JNYA 3PO3I 1PFTA 2F4MA 2NVQI 1YIJ1 2E9HA 1VQ4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 1;  3CCR Z;  1S72 Z;  3CME Z;  1VQM Z;  1YJW 1;  1VQP Z;  3CCQ Z;  2OTL 1;  1VQK 1;  1W2B Y;  3G4S Z;  3G71 Z;  1YI2 Z;  2QA4 1;  1VQ5 1;  1W2B Z;  1YJ9 Z;  1YIT Z;  1JJ2 Y;  3CXC Z;  3G6E 1;  3I56 1;  3CC4 1;  1Q81 1;  1VQ9 1;  3CCV Z;  2QEX Z;  1Q86 1;  3CCL Z;  1YHQ Z;  1K8A 1;  3CC7 1;  1VQO Z;  1YJN Z;  1VQN Z;  3CC2 1;  3CCM 1;  1M1K 1;  3CCS 1;  1VQ8 Z;  3CD6 1;  3CCU Z;  3I55 Z;  1VQ7 Z;  1K73 2;  1VQ4 1;  3CCR 1;  1KD1 2;  3CCE Z;  1S72 1;  3CME 1;  1VQM 1;  1JJ2 Z;  1VQP 1;  3CCQ 1;  1Q7Y 2;  1QVF Y;  1K73 1;  3OW2 Y;  3G4S 1;  3CCJ Z;  3G71 1;  3CMA Z;  1QVF Z;  1YI2 1;  1YJ9 1;  1KC8 2;  3OW2 Z;  1KD1 1;  1YIT 1;  1VQ6 Z;  1KQS Y;  1YIJ Z;  1VQL Z;  1KQS Z;  2OTJ Z;  1M90 2;  3CCV 1;  2QEX 1;  1YJW Z;  3CCL 1;  2OTL Z;  1VQK Z;  1NJI 2;  1Q82 2;  1YHQ 1;  1N8R 2;  3CPW Y;  1VQO 1;  2QA4 Z;  1YJN 1;  1VQ5 Z;  1VQN 1;  1M90 1;  1VQ8 1;  3CCU 1;  3G6E Z;  3I55 1;  1VQ7 1;  1NJI 1;  1Q82 1;  3I56 Z;  3CC4 Z;  1N8R 1;  1VQ9 Z;  1K9M 2;  3CCE 1;  1Q81 2;  1Q7Y 1;  1QVG Y;  3CXC Y;  1Q86 2;  1QVG Z;  3CC7 Z;  1KC8 1;  3CCJ 1;  3CMA 1;  1K8A 2;  3CC2 Z;  3CCM Z;  3CCS Z;  1K9M 1;  3CD6 Z;  1VQ6 1;  1M1K 2;  1YIJ 1;  3CPW Z;  1VQL 1;  1VQ4 Z; 
#chains in the Genus database with same CATH topology
 2QRC B;  2GTI A;  3CME Z;  1X0T A;  2NVY I;  3CCQ Z;  1VQK 1;  1WW9 A;  2I3C A;  1VQ5 1;  2W03 A;  1YJ9 Z;  1JJ2 Y;  3CXC Z;  2G2K A;  3I56 1;  4Y7N I;  3CCV Z;  2IV2 X;  2DE6 A;  3NDI A;  4E33 A;  2J6A A;  2O53 A;  4BBS I;  1ZB8 A;  3CC7 1;  2B63 I;  4MRI A;  1VQN Z;  1I6H I;  1X3W A;  4AYB A;  1Y8C A;  3I55 Z;  3IR7 A;  1NUI A;  2OZK A;  3Q87 A;  4X6A I;  3NH4 A;  2LIY A;  3CCE Z;  2VPW A;  1VQM 1;  2R6M A;  2JS4 A;  1K73 1;  3D2L A;  3G4S 1;  5T64 A;  1QVF Z;  1YI2 1;  1SIW A;  1KD1 1;  3HKZ A;  4NB8 A;  5A2Q b;  1ZH1 A;  4A3C I;  1KQS Z;  2OTJ Z;  1M90 2;  1YJW Z;  2W04 A;  3CCL 1;  3JAM f;  1Q82 2;  2RT9 A;  3CQZ I;  4RV9 A;  1VQO 1;  5T6B A;  2Y0S A;  2QA4 Z;  4MD7 A;  2IZ3 A;  3FKI I;  1X3Z A;  5C3E I;  3GTJ I;  3I4N I;  1N8R 1;  1VQ9 Z;  1LQL A;  5IP9 I;  3D6W A;  3RZD I;  3K7A I;  3CXC Y;  2YAD A;  3BG0 B;  3NH5 A;  3F3F C;  1QVG Z;  2VPY A;  3CC2 Z;  1K9M 1;  3CD6 Z;  4MON A;  1VQ6 1;  2K3R A;  3GKQ A;  4A3J I;  2V3V A;  1VQL 1;  2E2I I;  4RS4 A;  1R9T I;  3CCR Z;  3RZO I;  4QTT A;  4CL1 A;  5C4J I;  2QLV B;  3J81 f;  1VQP Z;  2OTL 1;  5FLX b;  1W2B Y;  3HOY I;  1TWA I;  3G6E 1;  2VUG A;  3M4O I;  3CC4 1;  2V45 A;  2QEX Z;  1TWF I;  3GTK I;  2V8I A;  2WAQ A;  4NBF A;  3GTO I;  4NB9 A;  3F3P C;  3CCM 1;  3HOZ I;  3CCS 1;  5LL6 f;  3VMG A;  1VQ8 Z;  3GTL I;  1YUK A;  1S7M A;  4E2W A;  1VQ7 Z;  5C4X I;  1K73 2;  1JWH C;  2QKD A;  2Q51 A;  4E31 A;  4RVD A;  2AYD A;  1KD1 2;  1S72 1;  2RPR A;  4MD9 A;  2JIR A;  3S1Q I;  1NP6 A;  4MH4 A;  3MON A;  2VUM I;  3OW2 Y;  2WB1 A;  3G71 1;  3CCJ Z;  4A3D I;  1FDO A;  2DE5 A;  3TE5 B;  4NBD A;  1YIT 1;  2O4H A;  5IT9 b;  1RO4 A;  1TWH I;  1YIJ Z;  4A3M I;  3EER A;  1Y1W I;  2M6N A;  4RVH A;  1VQK Z;  3S16 I;  3VMI A;  3HOW I;  1YHQ 1;  3S17 I;  3IX0 A;  1N8R 2;  4BY7 I;  1YJN 1;  1VQ5 Z;  3M3Y I;  3CCU 1;  2QRE B;  2NAP A;  2NVT I;  3FQQ A;  5T67 A;  4NBA A;  5FLM I;  3S1R I;  3I56 Z;  2ZAE B;  4E30 A;  1K9M 2;  2KI7 B;  1Q81 2;  4A3E I;  4RVF A;  2JMO A;  2JIP A;  1L1O C;  2JR6 A;  1Q86 2;  3H3V J;  2HU9 A;  3CC7 Z;  1QYP A;  3BG1 B;  3CMA 1;  1K8A 2;  2GU2 A;  1M1K 2;  1RQF A;  4NBE A;  5C44 I;  2KPI A;  4DK1 A;  3CPW Z;  1VLA A;  1VQM Z;  2H85 A;  3TDH B;  3G4S Z;  1YI2 Z;  4NBB A;  3GTM I;  2VF1 A;  1Q81 1;  1Z02 A;  1SFO I;  4NBG A;  3HOU I;  2R93 I;  4A93 I;  1Q86 1;  3CCL Z;  1TFI A;  1TWC I;  2E2H I;  2VPZ A;  1KRL A;  2P3Y A;  1K8A 1;  1VQO Z;  3NH8 A;  2HF1 A;  3EED A;  5FLX f;  1M1K 1;  4MXU A;  4HGZ A;  2BJO A;  4HH4 A;  2E2J I;  1VQ4 1;  4A3F I;  4A3L I;  3NDJ A;  4EWC A;  3CME 1;  3MZK B;  5D1P A;  3J80 b;  3CCQ 1;  1Q7Y 2;  1QVF Y;  2QR1 B;  3IFU A;  1Z01 A;  3I4M I;  1YJ9 1;  1KC8 2;  1VQ6 Z;  1KQS Y;  5CM2 M;  2PK7 A;  3HOX I;  4NFR A;  1VQL Z;  2Q4Z A;  3CCV 1;  2LEX A;  2JIQ A;  2JA5 I;  2OTL Z;  2IZ4 A;  1QF8 A;  4DQY B;  3CPW Y;  4RVG A;  3FQM A;  1VQN 1;  1K83 I;  1ZB9 A;  2EGT A;  1RO2 A;  4E2X A;  3ESW A;  4TNU A;  4A3B I;  4NBH A;  2VPX A;  3G6E Z;  3KIF A;  3I55 1;  1QXF A;  1NJI 1;  3U50 C;  3CC4 Z;  3D9X A;  5IT9 f;  1RNI A;  3QWU A;  3CCE 1;  3VTN A;  1Q7Y 1;  2JA8 I;  1QVG Y;  1KC8 1;  3S14 I;  1WZN A;  4BBR I;  3CCM Z;  1Y1V S;  2QRD B;  4QTU A;  3CCS Z;  4HGY A;  4A3G I;  3H0G I;  2M48 A;  1AA6 A;  5D1O B;  2OTJ 1;  2R7Z I;  4BXX I;  1RO0 A;  4DGL A;  1S72 Z;  1YJW 1;  3GTM S;  4BY1 I;  4NBC A;  4MD8 A;  1USP B;  3G71 Z;  5A2Q f;  2QA4 1;  1W2B Z;  2JIO A;  1YIT Z;  2PMZ A;  1I3Q I;  2RIQ A;  1VQ9 1;  2P28 A;  3GCF A;  2PM9 A;  4Y52 I;  4NH1 C;  1P9N A;  3S1N I;  1YHQ Z;  1YJN Z;  1RLY A;  4XX2 A;  3CC2 1;  1Y1V I;  3CD6 1;  3GTQ I;  3CCU Z;  2V8J A;  3NFZ A;  1YUA A;  3S2D I;  2F4O A;  4NOZ A;  2DE7 A;  2JA7 I;  3JAM b;  4S1T A;  3CCR 1;  1JJ2 Z;  3T4N B;  1VQP 1;  3VMH A;  2JUB A;  5AN9 F;  1FDI A;  3KIH A;  1WCM I;  3CMA Z;  3PO3 S;  3OW2 Z;  3S15 I;  2GTH A;  1Z03 A;  2AKL A;  3HOV I;  3I07 A;  1Q16 A;  5D1O A;  2RBL A;  4E2Z A;  2LFU A;  2OOY B;  2V8K A;  3GTG I;  3GTP I;  4A3I I;  3S2H I;  1TWG I;  2QEX 1;  2NVX I;  2RHB A;  1USP A;  1NJI 2;  3J7A 4;  3VB9 A;  2K5R A;  2JIM A;  2R92 I;  3J80 f;  3PO2 I;  1M90 1;  2E7Z A;  1VQ8 1;  2OOX B;  3S1M I;  5IP7 I;  4E32 A;  3LUS A;  1DL6 A;  1VQ7 1;  3J81 b;  1Q82 1;  2JA6 I;  4E2Y A;  1I50 I;  3IF8 A;  1N2F A;  3MZL B;  2YU9 I;  3P5J B;  1ML8 A;  1WII A;  4A3K I;  3CCJ 1;  1WJ2 A;  2JNY A;  3PO3 I;  1PFT A;  2F4M A;  2NVQ I;  1YIJ 1;  2E9H A;  1VQ4 Z; 
#chains in the Genus database with same CATH homology
 2QRC B;  2GTI A;  3CME Z;  1X0T A;  2NVY I;  3CCQ Z;  1VQK 1;  1WW9 A;  2I3C A;  1VQ5 1;  2W03 A;  1YJ9 Z;  1JJ2 Y;  3CXC Z;  2G2K A;  3I56 1;  4Y7N I;  3CCV Z;  2DE6 A;  3NDI A;  4E33 A;  2J6A A;  2O53 A;  4BBS I;  1ZB8 A;  3CC7 1;  2B63 I;  4MRI A;  1VQN Z;  1I6H I;  1X3W A;  4AYB A;  3I55 Z;  1NUI A;  2OZK A;  3Q87 A;  4X6A I;  3NH4 A;  2LIY A;  3CCE Z;  1VQM 1;  2R6M A;  2JS4 A;  1K73 1;  3G4S 1;  5T64 A;  1QVF Z;  1YI2 1;  1KD1 1;  3HKZ A;  4NB8 A;  5A2Q b;  1ZH1 A;  4A3C I;  1KQS Z;  2OTJ Z;  1M90 2;  1YJW Z;  2W04 A;  3CCL 1;  3JAM f;  1Q82 2;  2RT9 A;  3CQZ I;  4RV9 A;  1VQO 1;  5T6B A;  2Y0S A;  2QA4 Z;  4MD7 A;  2IZ3 A;  3FKI I;  1X3Z A;  5C3E I;  3GTJ I;  3I4N I;  1N8R 1;  1VQ9 Z;  1LQL A;  5IP9 I;  3D6W A;  3RZD I;  3K7A I;  3CXC Y;  2YAD A;  3BG0 B;  3NH5 A;  3F3F C;  1QVG Z;  3CC2 Z;  1K9M 1;  3CD6 Z;  4MON A;  1VQ6 1;  2K3R A;  3GKQ A;  4A3J I;  1VQL 1;  2E2I I;  4RS4 A;  1R9T I;  3CCR Z;  3RZO I;  4QTT A;  4CL1 A;  5C4J I;  2QLV B;  3J81 f;  1VQP Z;  2OTL 1;  5FLX b;  1W2B Y;  3HOY I;  1TWA I;  3G6E 1;  2VUG A;  3M4O I;  3CC4 1;  2QEX Z;  1TWF I;  3GTK I;  2V8I A;  2WAQ A;  4NBF A;  3GTO I;  4NB9 A;  3F3P C;  3CCM 1;  3HOZ I;  3CCS 1;  5LL6 f;  3VMG A;  1VQ8 Z;  3GTL I;  1YUK A;  1S7M A;  4E2W A;  1VQ7 Z;  5C4X I;  1K73 2;  1JWH C;  2QKD A;  2Q51 A;  4E31 A;  4RVD A;  1KD1 2;  1S72 1;  2RPR A;  4MD9 A;  3S1Q I;  1NP6 A;  4MH4 A;  3MON A;  2VUM I;  3OW2 Y;  2WB1 A;  3G71 1;  3CCJ Z;  4A3D I;  2DE5 A;  3TE5 B;  4NBD A;  1YIT 1;  2O4H A;  5IT9 b;  1RO4 A;  1TWH I;  1YIJ Z;  4A3M I;  3EER A;  1Y1W I;  2M6N A;  4RVH A;  1VQK Z;  3S16 I;  3VMI A;  3HOW I;  1YHQ 1;  3S17 I;  3IX0 A;  1N8R 2;  4BY7 I;  1YJN 1;  1VQ5 Z;  3M3Y I;  3CCU 1;  2QRE B;  2NVT I;  3FQQ A;  5T67 A;  4NBA A;  5FLM I;  3S1R I;  3I56 Z;  2ZAE B;  4E30 A;  1K9M 2;  2KI7 B;  1Q81 2;  4A3E I;  4RVF A;  2JMO A;  1L1O C;  2JR6 A;  1Q86 2;  3H3V J;  2HU9 A;  3CC7 Z;  1QYP A;  3BG1 B;  3CMA 1;  1K8A 2;  2GU2 A;  1M1K 2;  1RQF A;  4NBE A;  5C44 I;  2KPI A;  4DK1 A;  3CPW Z;  1VLA A;  1VQM Z;  2H85 A;  3TDH B;  3G4S Z;  1YI2 Z;  4NBB A;  3GTM I;  2VF1 A;  1Q81 1;  1Z02 A;  1SFO I;  4NBG A;  3HOU I;  2R93 I;  4A93 I;  1Q86 1;  3CCL Z;  1TFI A;  1TWC I;  2E2H I;  1KRL A;  2P3Y A;  1K8A 1;  1VQO Z;  3NH8 A;  2HF1 A;  3EED A;  5FLX f;  1M1K 1;  4MXU A;  4HGZ A;  2BJO A;  4HH4 A;  2E2J I;  1VQ4 1;  4A3F I;  4A3L I;  3NDJ A;  4EWC A;  3CME 1;  3MZK B;  5D1P A;  3J80 b;  3CCQ 1;  1Q7Y 2;  1QVF Y;  2QR1 B;  3IFU A;  1Z01 A;  3I4M I;  1YJ9 1;  1KC8 2;  1VQ6 Z;  1KQS Y;  5CM2 M;  2PK7 A;  3HOX I;  4NFR A;  1VQL Z;  2Q4Z A;  3CCV 1;  2JA5 I;  2OTL Z;  2IZ4 A;  1QF8 A;  4DQY B;  3CPW Y;  4RVG A;  3FQM A;  1VQN 1;  1K83 I;  1ZB9 A;  2EGT A;  1RO2 A;  4E2X A;  3ESW A;  4TNU A;  4A3B I;  4NBH A;  3KIF A;  3G6E Z;  3I55 1;  1NJI 1;  3U50 C;  3CC4 Z;  3D9X A;  5IT9 f;  1RNI A;  3QWU A;  3CCE 1;  3VTN A;  1Q7Y 1;  2JA8 I;  1QVG Y;  1KC8 1;  3S14 I;  4BBR I;  3CCM Z;  1Y1V S;  2QRD B;  4QTU A;  3CCS Z;  4HGY A;  4A3G I;  3H0G I;  2M48 A;  5D1O B;  2OTJ 1;  2R7Z I;  4BXX I;  1RO0 A;  4DGL A;  1S72 Z;  1YJW 1;  3GTM S;  4BY1 I;  4NBC A;  4MD8 A;  1USP B;  3G71 Z;  5A2Q f;  2QA4 1;  1W2B Z;  1YIT Z;  2PMZ A;  1I3Q I;  2RIQ A;  1VQ9 1;  2P28 A;  3GCF A;  2PM9 A;  4Y52 I;  4NH1 C;  1P9N A;  3S1N I;  1YHQ Z;  1YJN Z;  1RLY A;  4XX2 A;  3CC2 1;  1Y1V I;  3CD6 1;  3GTQ I;  3CCU Z;  2V8J A;  3NFZ A;  1YUA A;  3S2D I;  2F4O A;  4NOZ A;  2DE7 A;  2JA7 I;  3JAM b;  4S1T A;  3CCR 1;  1JJ2 Z;  3T4N B;  1VQP 1;  3VMH A;  2JUB A;  5AN9 F;  3KIH A;  1WCM I;  3CMA Z;  3PO3 S;  3OW2 Z;  3S15 I;  2GTH A;  1Z03 A;  2AKL A;  3HOV I;  3I07 A;  5D1O A;  2RBL A;  4E2Z A;  2LFU A;  2OOY B;  2V8K A;  3GTG I;  3GTP I;  4A3I I;  3S2H I;  1TWG I;  2QEX 1;  2NVX I;  2RHB A;  1USP A;  1NJI 2;  3J7A 4;  3VB9 A;  2K5R A;  2R92 I;  3J80 f;  3PO2 I;  1M90 1;  1VQ8 1;  2OOX B;  3S1M I;  5IP7 I;  4E32 A;  3LUS A;  1DL6 A;  1VQ7 1;  3J81 b;  1Q82 1;  2JA6 I;  4E2Y A;  1I50 I;  3IF8 A;  1N2F A;  3MZL B;  2YU9 I;  3P5J B;  1ML8 A;  1WII A;  4A3K I;  3CCJ 1;  2JNY A;  3PO3 I;  1PFT A;  2F4M A;  2NVQ I;  1YIJ 1;  2E9H A;  1VQ4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...