1VQ71

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq7100
1VQKZ 3CCQZ 1QVFY 3OW2Y 3CCR1 3CME1 3CC21 3G711 1Q7Y2 2QEX1 3CD61 3CCJ1 3CCE1 2OTJZ 3G6EZ 1W2BZ 3CCS1 3I551 1Q822 1Q812 1Q811 1VQ4Z 3CCVZ 2OTL1 1VQ51 3G4S1 3CCL1 1Q862 1Q861 1QVFZ 3I561 1VQL1 3OW2Z 3CCMZ 1YIJ1 3CCQ1 1VQ7Z 1VQ61 1K732 1YI2Z 1VQ91 3CCU1 3CC7Z 1K731 1YJ91 1VQ8Z 1S721 1VQMZ 3CC4Z 2QA4Z 1YITZ 1VQP1 1QVGY 1YJW1 1VQNZ 1YJNZ 3CPWY 3CCV1 1YHQ1 1N8R1 1VQOZ 1K9M1 1KD12 3CCRZ 1KD11 3CMEZ 3CCM1 1VQK1 1K8A1 2QEXZ 3CMAZ 1M902 1M901 3CD6Z 3CCJZ 1KC81 1M1K2 1KQSY 1M1K1 3CCSZ 3I55Z 1QVGZ 1W2BY 2OTJ1 3G6E1 3CC41 3G4SZ 3CPWZ 3CXCY 3CCLZ 1NJI2 1NJI1 1VQN1 1VQ41 1N8R2 1JJ2Y 1VQLZ 1K9M2 1YIJZ 3CC2Z 1VQ6Z 1K8A2 3G71Z 3CMA1 1VQ9Z 3CCUZ 1Q7Y1 1KQSZ 1KC82 1VQ71 1YJ9Z 1S72Z 3CCEZ 1YI21 3CC71 1VQPZ 1Q821 1YJWZ 1VQ81 3CXCZ 1VQM1 1YHQZ 2OTLZ 1VQ5Z 2QA41 1YIT1 1JJ2Z 1YJN1 1VQO1 3I56Z
chains in the Genus database with same CATH superfamily
4MD9A 3CC21 2NVQI 2JA7I 3CD61 4RS4A 2VPZA 2RPRA 2VPXA 1YUAA 1VQ51 2RHBA 3HOWI 3K7AI 4BY1I 1Q862 2DE5A 1Q861 4RVHA 3S14I 2G2KA 2IV2X 3CCMZ 1YIJ1 5IT9f 4BY7I 3MZKB 1VQ61 3GTOI 2JIMA 4NBAA 2F4MA 1YUKA 1YJ91 1X0TA 1WCMI 4MRIA 2IZ3A 2QA4Z 1X3ZA 1TFIA 2QRCB 3H3VJ 3FQQA 1YJNZ 4E2ZA 3VMHA 2O4HA 3J81f 3GCFA 3I4NI 4CL1A 3HOZI 3S1NI 3ESWA 1S7MA 3CMEZ 1K8A1 3NDJA 5T67A 5A2Qf 2QLVB 2OOXB 3MONA 1RLYA 2BJOA 2JR6A 1QVGZ 4DGLA 4E31A 4MXUA 3CCLZ 4RVDA 4E2YA 2VF1A 2RIQA 5IP7I 2PMZA 4A93I 1VQLZ 1WIIA 2P28A 1R9TI 4NBCA 1QF8A 1TWAI 4NBGA 3JAMb 2ZAEB 5T64A 3CC2Z 3TE5B 1USPA 3NFZA 2R93I 4AYBA 4A3GI 2JUBA 1VQPZ 1YJWZ 4A3FI 5AN9F 1VQ5Z 2QA41 2P3YA 3PO2I 2I3CA 2R6MA 3KIFA 1I3QI 1YJN1 3J80b 4BXXI 5FLMI 4A3II 3BG0B 3CME1 5FLXb 3G711 1X3WA 3D6WA 4NBBA 3GTKI 3H0GI 3HOXI 1ZH1A 2V3VA 1Q822 4DK1A 4MD8A 2V8IA 2PK7A 3CCL1 3RZDI 3M3YI 1QVFZ 1VQL1 1USPB 3CCQ1 1VQ7Z 1LQLA 2JMOA 3GKQA 1K732 1K731 2E2II 1VQMZ 3S1QI 4A3KI 5LL6f 4E30A 5D1OA 2V8JA 1VQP1 1QVGY 3M4OI 1YJW1 3JAMf 3CCV1 1N8R1 5T6BA 3FQMA 1K9M1 3NH5A 5C4XI 3GTQI 3CCJZ 1KC81 3U50C 2JIQA 4MD7A 1FDOA 3LUSA 3J80f 1Z03A 3J7A4 3G4SZ 3HKZA 2PM9A 2GTHA 5FLXf 4NBEA 3EERA 3GTGI 2V8KA 4HH4A 3Q87A 4MH4A 2AKLA 2RBLA 2RT9A 3G71Z 1K8A2 1VQ9Z 3CCUZ 1Q7Y1 3NDIA 3QWUA 1VQ71 1QYPA 1S72Z 4RV9A 5D1OB 2Q4ZA 2DE6A 2VPWA 3CQZI 5D1PA 2R92I 3CXCZ 1VQM1 2KPIA 2IZ4A 1JJ2Z 2R7ZI 1NP6A 4X6AI 3S17I 3RZOI 1VQKZ 3CCQZ 1Z01A 1QVFY 3S1MI 4NH1C 2QREB 2LEXA 4EWCA 3CCJ1 3CCE1 2OOYB 3G6EZ 4XX2A 1I50I 1TWHI 1Y8CA 2GU2A 3CCVZ 3G4S1 2JA8I 3P5JB 4A3DI 3IF8A 4A3EI 1K83I 2HU9A 3VB9A 2W03A 1TWGI 3I561 1DL6A 3OW2Z 1I6HI 4QTTA 4A3MI 1ZB8A 3S15I 1RO0A 1YI2Z 1VQ91 3CCU1 3CC7Z 2KI7B 1VQ8Z 1S721 5IT9b 3D9XA 2VUGA 3S16I 3VMIA 2E7ZA 4TNUA 2QR1B 4A3LI 2M48A 1KD12 2M6NA 3CCRZ 1KD11 1VQK1 2QEXZ 1M902 1M901 4A3CI 3T4NB 2QKDA 2NVYI 2Q51A 5C4JI 3CCSZ 3I55Z 2Y0SA 1W2BY 2JIPA 3G6E1 3CC41 5A2Qb 3CPWZ 3CXCY 1NJI2 1NJI1 1TWCI 1VQN1 1FDIA 1ML8A 1RO2A 1N8R2 1JJ2Y 2K5RA 2NAPA 2JNYA 1K9M2 4HGZA 1Y1VI 3HOYI 4E33A 3CMA1 3EEDA 2O53A 1KC82 1KQSZ 4DQYB 1KRLA 3CCEZ 1SFOI 1YI21 3CC71 3BG1B 3S2DI 2LIYA 1VQ81 1Y1VS 4RVGA 1YHQZ 2AYDA 3GTLI 1RQFA 3F3PC 3VMGA 2K3RA 3I56Z 1WZNA 2WB1A 5C3EI 2V45A 4BBSI 4A3BI 3NH8A 1WJ2A 3OW2Y 3CCR1 4MONA 5CM2M 3GTPI 1AA6A 4HGYA 2QEX1 1Q7Y2 1ZB9A 3I4MI 2JIRA 4E2WA 2OTJZ 1W2BZ 3CCS1 3I551 1Q812 2F4OA 3S1RI 1Q811 2E9HA 4S1TA 3I07A 1VQ4Z 2JA5I 2OTL1 1WW9A 3KIHA 4NBDA 4Y7NI 3D2LA 2EGTA 4NB8A 2W04A 3MZLB 2NVXI 2HF1A 2YADA 3GTJI 4QTUA 1Q16A 4NB9A 4NOZA 2WAQA 3VTNA 4BBRI 4A3JI 1VLAA 2VPYA 1RO4A 3TDHB 3CC4Z 1YITZ 1PFTA 1VQNZ 3CPWY 3HOUI 1YHQ1 3GTMI 1VQOZ 3IX0A 2JS4A 4RVFA 2JIOA 5C44I 4NBFA 3F3FC 4NBHA 1P9NA 3CCM1 4NFRA 3CMAZ 3CD6Z 2E2JI 1Y1WI 3GTMS 2QRDB 1M1K2 1KQSY 1M1K1 1RNIA 3IFUA 5IP9I 3PO3I 1JWHC 2OTJ1 2E2HI 1Z02A 2DE7A 1VQ41 3S2HI 2LFUA 2J6AA 2H85A 1YIJZ 3PO3S 4Y52I 2OZKA 2B63I 3J81b 1VQ6Z 2GTIA 2NVTI 1NUIA 1TWFI 1YJ9Z 3IR7A 4E2XA 3HOVI 1L1OC 1Q821 2JA6I 3FKII 2VUMI 2OTLZ 2YU9I 1YIT1 4E32A 1SIWA 1VQO1 1N2FA 3NH4A 1QXFA
chains in the Genus database with same CATH topology
4MD9A 3CC21 2NVQI 2JA7I 3CD61 4RS4A 2RPRA 1YUAA 1VQ51 2RHBA 3HOWI 3K7AI 4BY1I 1Q862 2DE5A 1Q861 4RVHA 3S14I 2G2KA 3CCMZ 1YIJ1 5IT9f 4BY7I 3MZKB 1VQ61 3GTOI 4NBAA 2F4MA 1YUKA 1YJ91 1X0TA 1WCMI 4MRIA 2IZ3A 2QA4Z 1X3ZA 1TFIA 2QRCB 3H3VJ 3FQQA 1YJNZ 4E2ZA 3VMHA 2O4HA 3J81f 3GCFA 3I4NI 4CL1A 3HOZI 3S1NI 3ESWA 1S7MA 3CMEZ 1K8A1 3NDJA 5T67A 5A2Qf 2QLVB 2OOXB 3MONA 1RLYA 2BJOA 2JR6A 1QVGZ 4DGLA 4E31A 4MXUA 3CCLZ 4RVDA 4E2YA 2VF1A 2RIQA 5IP7I 2PMZA 4A93I 1VQLZ 1WIIA 2P28A 1R9TI 4NBCA 1QF8A 1TWAI 4NBGA 3JAMb 2ZAEB 5T64A 3CC2Z 3TE5B 1USPA 3NFZA 2R93I 4AYBA 4A3GI 2JUBA 1VQPZ 1YJWZ 4A3FI 5AN9F 1VQ5Z 2QA41 2P3YA 3PO2I 2I3CA 2R6MA 3KIFA 1I3QI 1YJN1 3J80b 4BXXI 5FLMI 4A3II 3BG0B 3CME1 5FLXb 3G711 1X3WA 3D6WA 4NBBA 3GTKI 3H0GI 3HOXI 1ZH1A 1Q822 4DK1A 4MD8A 2V8IA 2PK7A 3CCL1 3RZDI 3M3YI 1QVFZ 1VQL1 1USPB 3CCQ1 1VQ7Z 1LQLA 2JMOA 3GKQA 1K732 1K731 2E2II 1VQMZ 3S1QI 4A3KI 5LL6f 4E30A 5D1OA 2V8JA 1VQP1 1QVGY 3M4OI 1YJW1 3JAMf 3CCV1 1N8R1 5T6BA 3FQMA 1K9M1 3NH5A 5C4XI 3GTQI 3CCJZ 1KC81 3U50C 4MD7A 3LUSA 3J80f 1Z03A 3J7A4 3G4SZ 3HKZA 2PM9A 2GTHA 5FLXf 4NBEA 3EERA 3GTGI 2V8KA 4HH4A 3Q87A 4MH4A 2AKLA 2RBLA 2RT9A 3G71Z 1K8A2 1VQ9Z 3CCUZ 1Q7Y1 3NDIA 3QWUA 1VQ71 1QYPA 1S72Z 4RV9A 5D1OB 2Q4ZA 2DE6A 3CQZI 5D1PA 2R92I 3CXCZ 1VQM1 2KPIA 2IZ4A 1JJ2Z 2R7ZI 1NP6A 4X6AI 3S17I 3RZOI 1VQKZ 3CCQZ 1Z01A 1QVFY 3S1MI 4NH1C 2QREB 4EWCA 3CCJ1 3CCE1 2OOYB 3G6EZ 4XX2A 1I50I 1TWHI 2GU2A 3CCVZ 3G4S1 2JA8I 3P5JB 4A3DI 3IF8A 4A3EI 1K83I 2HU9A 3VB9A 2W03A 1TWGI 3I561 1DL6A 3OW2Z 1I6HI 4QTTA 4A3MI 1ZB8A 3S15I 1RO0A 1YI2Z 1VQ91 3CCU1 3CC7Z 2KI7B 1VQ8Z 1S721 5IT9b 3D9XA 2VUGA 3S16I 3VMIA 4TNUA 2QR1B 4A3LI 2M48A 1KD12 2M6NA 3CCRZ 1KD11 1VQK1 2QEXZ 1M902 1M901 4A3CI 3T4NB 2QKDA 2NVYI 2Q51A 5C4JI 3CCSZ 3I55Z 2Y0SA 1W2BY 3G6E1 3CC41 5A2Qb 3CPWZ 3CXCY 1NJI2 1NJI1 1TWCI 1VQN1 1ML8A 1RO2A 1N8R2 1JJ2Y 2K5RA 2JNYA 1K9M2 4HGZA 1Y1VI 3HOYI 4E33A 3CMA1 3EEDA 2O53A 1KC82 1KQSZ 4DQYB 1KRLA 3CCEZ 1SFOI 1YI21 3CC71 3BG1B 3S2DI 2LIYA 1VQ81 1Y1VS 4RVGA 1YHQZ 3GTLI 1RQFA 3F3PC 3VMGA 2K3RA 3I56Z 2WB1A 5C3EI 4BBSI 4A3BI 3NH8A 3OW2Y 3CCR1 4MONA 5CM2M 3GTPI 4HGYA 2QEX1 1Q7Y2 1ZB9A 3I4MI 4E2WA 2OTJZ 1W2BZ 3CCS1 3I551 1Q812 2F4OA 3S1RI 1Q811 2E9HA 4S1TA 3I07A 1VQ4Z 2JA5I 2OTL1 1WW9A 3KIHA 4NBDA 4Y7NI 2EGTA 4NB8A 2W04A 3MZLB 2NVXI 2HF1A 2YADA 3GTJI 4QTUA 4NB9A 4NOZA 2WAQA 3VTNA 4BBRI 4A3JI 1VLAA 1RO4A 3TDHB 3CC4Z 1YITZ 1PFTA 1VQNZ 3CPWY 3HOUI 1YHQ1 3GTMI 1VQOZ 3IX0A 2JS4A 4RVFA 5C44I 4NBFA 3F3FC 4NBHA 1P9NA 3CCM1 4NFRA 3CMAZ 3CD6Z 2E2JI 1Y1WI 3GTMS 2QRDB 1M1K2 1KQSY 1M1K1 1RNIA 3IFUA 5IP9I 3PO3I 1JWHC 2OTJ1 2E2HI 1Z02A 2DE7A 1VQ41 3S2HI 2LFUA 2J6AA 2H85A 1YIJZ 3PO3S 4Y52I 2OZKA 2B63I 3J81b 1VQ6Z 2GTIA 2NVTI 1NUIA 1TWFI 1YJ9Z 4E2XA 3HOVI 1L1OC 1Q821 2JA6I 3FKII 2VUMI 2OTLZ 2YU9I 1YIT1 4E32A 1VQO1 1N2FA 3NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK Z;  3CCQ Z;  1QVF Y;  3OW2 Y;  3CCR 1;  3CME 1;  3CC2 1;  3G71 1;  1Q7Y 2;  2QEX 1;  3CD6 1;  3CCJ 1;  3CCE 1;  2OTJ Z;  3G6E Z;  1W2B Z;  3CCS 1;  3I55 1;  1Q82 2;  1Q81 2;  1Q81 1;  1VQ4 Z;  3CCV Z;  2OTL 1;  1VQ5 1;  3G4S 1;  3CCL 1;  1Q86 2;  1Q86 1;  1QVF Z;  3I56 1;  1VQL 1;  3OW2 Z;  3CCM Z;  1YIJ 1;  3CCQ 1;  1VQ7 Z;  1VQ6 1;  1K73 2;  1YI2 Z;  1VQ9 1;  3CCU 1;  3CC7 Z;  1K73 1;  1YJ9 1;  1VQ8 Z;  1S72 1;  1VQM Z;  3CC4 Z;  2QA4 Z;  1YIT Z;  1VQP 1;  1QVG Y;  1YJW 1;  1VQN Z;  1YJN Z;  3CPW Y;  3CCV 1;  1YHQ 1;  1N8R 1;  1VQO Z;  1K9M 1;  1KD1 2;  3CCR Z;  1KD1 1;  3CME Z;  3CCM 1;  1VQK 1;  1K8A 1;  2QEX Z;  3CMA Z;  1M90 2;  1M90 1;  3CD6 Z;  3CCJ Z;  1KC8 1;  1M1K 2;  1KQS Y;  1M1K 1;  3CCS Z;  3I55 Z;  1QVG Z;  1W2B Y;  2OTJ 1;  3G6E 1;  3CC4 1;  3G4S Z;  3CPW Z;  3CXC Y;  3CCL Z;  1NJI 2;  1NJI 1;  1VQN 1;  1VQ4 1;  1N8R 2;  1JJ2 Y;  1VQL Z;  1K9M 2;  1YIJ Z;  3CC2 Z;  1VQ6 Z;  1K8A 2;  3G71 Z;  3CMA 1;  1VQ9 Z;  3CCU Z;  1Q7Y 1;  1KQS Z;  1KC8 2;  1VQ7 1;  1YJ9 Z;  1S72 Z;  3CCE Z;  1YI2 1;  3CC7 1;  1VQP Z;  1Q82 1;  1YJW Z;  1VQ8 1;  3CXC Z;  1VQM 1;  1YHQ Z;  2OTL Z;  1VQ5 Z;  2QA4 1;  1YIT 1;  1JJ2 Z;  1YJN 1;  1VQO 1;  3I56 Z; 
#chains in the Genus database with same CATH topology
 4MD9 A;  3CC2 1;  2NVQ I;  2JA7 I;  3CD6 1;  4RS4 A;  2VPZ A;  2RPR A;  2VPX A;  1YUA A;  1VQ5 1;  2RHB A;  3HOW I;  3K7A I;  4BY1 I;  1Q86 2;  2DE5 A;  1Q86 1;  4RVH A;  3S14 I;  2G2K A;  2IV2 X;  3CCM Z;  1YIJ 1;  5IT9 f;  4BY7 I;  3MZK B;  1VQ6 1;  3GTO I;  2JIM A;  4NBA A;  2F4M A;  1YUK A;  1YJ9 1;  1X0T A;  1WCM I;  4MRI A;  2IZ3 A;  2QA4 Z;  1X3Z A;  1TFI A;  2QRC B;  3H3V J;  3FQQ A;  1YJN Z;  4E2Z A;  3VMH A;  2O4H A;  3J81 f;  3GCF A;  3I4N I;  4CL1 A;  3HOZ I;  3S1N I;  3ESW A;  1S7M A;  3CME Z;  1K8A 1;  3NDJ A;  5T67 A;  5A2Q f;  2QLV B;  2OOX B;  3MON A;  1RLY A;  2BJO A;  2JR6 A;  1QVG Z;  4DGL A;  4E31 A;  4MXU A;  3CCL Z;  4RVD A;  4E2Y A;  2VF1 A;  2RIQ A;  5IP7 I;  2PMZ A;  4A93 I;  1VQL Z;  1WII A;  2P28 A;  1R9T I;  4NBC A;  1QF8 A;  1TWA I;  4NBG A;  3JAM b;  2ZAE B;  5T64 A;  3CC2 Z;  3TE5 B;  1USP A;  3NFZ A;  2R93 I;  4AYB A;  4A3G I;  2JUB A;  1VQP Z;  1YJW Z;  4A3F I;  5AN9 F;  1VQ5 Z;  2QA4 1;  2P3Y A;  3PO2 I;  2I3C A;  2R6M A;  3KIF A;  1I3Q I;  1YJN 1;  3J80 b;  4BXX I;  5FLM I;  4A3I I;  3BG0 B;  3CME 1;  5FLX b;  3G71 1;  1X3W A;  3D6W A;  4NBB A;  3GTK I;  3H0G I;  3HOX I;  1ZH1 A;  2V3V A;  1Q82 2;  4DK1 A;  4MD8 A;  2V8I A;  2PK7 A;  3CCL 1;  3RZD I;  3M3Y I;  1QVF Z;  1VQL 1;  1USP B;  3CCQ 1;  1VQ7 Z;  1LQL A;  2JMO A;  3GKQ A;  1K73 2;  1K73 1;  2E2I I;  1VQM Z;  3S1Q I;  4A3K I;  5LL6 f;  4E30 A;  5D1O A;  2V8J A;  1VQP 1;  1QVG Y;  3M4O I;  1YJW 1;  3JAM f;  3CCV 1;  1N8R 1;  5T6B A;  3FQM A;  1K9M 1;  3NH5 A;  5C4X I;  3GTQ I;  3CCJ Z;  1KC8 1;  3U50 C;  2JIQ A;  4MD7 A;  1FDO A;  3LUS A;  3J80 f;  1Z03 A;  3J7A 4;  3G4S Z;  3HKZ A;  2PM9 A;  2GTH A;  5FLX f;  4NBE A;  3EER A;  3GTG I;  2V8K A;  4HH4 A;  3Q87 A;  4MH4 A;  2AKL A;  2RBL A;  2RT9 A;  3G71 Z;  1K8A 2;  1VQ9 Z;  3CCU Z;  1Q7Y 1;  3NDI A;  3QWU A;  1VQ7 1;  1QYP A;  1S72 Z;  4RV9 A;  5D1O B;  2Q4Z A;  2DE6 A;  2VPW A;  3CQZ I;  5D1P A;  2R92 I;  3CXC Z;  1VQM 1;  2KPI A;  2IZ4 A;  1JJ2 Z;  2R7Z I;  1NP6 A;  4X6A I;  3S17 I;  3RZO I;  1VQK Z;  3CCQ Z;  1Z01 A;  1QVF Y;  3S1M I;  4NH1 C;  2QRE B;  2LEX A;  4EWC A;  3CCJ 1;  3CCE 1;  2OOY B;  3G6E Z;  4XX2 A;  1I50 I;  1TWH I;  1Y8C A;  2GU2 A;  3CCV Z;  3G4S 1;  2JA8 I;  3P5J B;  4A3D I;  3IF8 A;  4A3E I;  1K83 I;  2HU9 A;  3VB9 A;  2W03 A;  1TWG I;  3I56 1;  1DL6 A;  3OW2 Z;  1I6H I;  4QTT A;  4A3M I;  1ZB8 A;  3S15 I;  1RO0 A;  1YI2 Z;  1VQ9 1;  3CCU 1;  3CC7 Z;  2KI7 B;  1VQ8 Z;  1S72 1;  5IT9 b;  3D9X A;  2VUG A;  3S16 I;  3VMI A;  2E7Z A;  4TNU A;  2QR1 B;  4A3L I;  2M48 A;  1KD1 2;  2M6N A;  3CCR Z;  1KD1 1;  1VQK 1;  2QEX Z;  1M90 2;  1M90 1;  4A3C I;  3T4N B;  2QKD A;  2NVY I;  2Q51 A;  5C4J I;  3CCS Z;  3I55 Z;  2Y0S A;  1W2B Y;  2JIP A;  3G6E 1;  3CC4 1;  5A2Q b;  3CPW Z;  3CXC Y;  1NJI 2;  1NJI 1;  1TWC I;  1VQN 1;  1FDI A;  1ML8 A;  1RO2 A;  1N8R 2;  1JJ2 Y;  2K5R A;  2NAP A;  2JNY A;  1K9M 2;  4HGZ A;  1Y1V I;  3HOY I;  4E33 A;  3CMA 1;  3EED A;  2O53 A;  1KC8 2;  1KQS Z;  4DQY B;  1KRL A;  3CCE Z;  1SFO I;  1YI2 1;  3CC7 1;  3BG1 B;  3S2D I;  2LIY A;  1VQ8 1;  1Y1V S;  4RVG A;  1YHQ Z;  2AYD A;  3GTL I;  1RQF A;  3F3P C;  3VMG A;  2K3R A;  3I56 Z;  1WZN A;  2WB1 A;  5C3E I;  2V45 A;  4BBS I;  4A3B I;  3NH8 A;  1WJ2 A;  3OW2 Y;  3CCR 1;  4MON A;  5CM2 M;  3GTP I;  1AA6 A;  4HGY A;  2QEX 1;  1Q7Y 2;  1ZB9 A;  3I4M I;  2JIR A;  4E2W A;  2OTJ Z;  1W2B Z;  3CCS 1;  3I55 1;  1Q81 2;  2F4O A;  3S1R I;  1Q81 1;  2E9H A;  4S1T A;  3I07 A;  1VQ4 Z;  2JA5 I;  2OTL 1;  1WW9 A;  3KIH A;  4NBD A;  4Y7N I;  3D2L A;  2EGT A;  4NB8 A;  2W04 A;  3MZL B;  2NVX I;  2HF1 A;  2YAD A;  3GTJ I;  4QTU A;  1Q16 A;  4NB9 A;  4NOZ A;  2WAQ A;  3VTN A;  4BBR I;  4A3J I;  1VLA A;  2VPY A;  1RO4 A;  3TDH B;  3CC4 Z;  1YIT Z;  1PFT A;  1VQN Z;  3CPW Y;  3HOU I;  1YHQ 1;  3GTM I;  1VQO Z;  3IX0 A;  2JS4 A;  4RVF A;  2JIO A;  5C44 I;  4NBF A;  3F3F C;  4NBH A;  1P9N A;  3CCM 1;  4NFR A;  3CMA Z;  3CD6 Z;  2E2J I;  1Y1W I;  3GTM S;  2QRD B;  1M1K 2;  1KQS Y;  1M1K 1;  1RNI A;  3IFU A;  5IP9 I;  3PO3 I;  1JWH C;  2OTJ 1;  2E2H I;  1Z02 A;  2DE7 A;  1VQ4 1;  3S2H I;  2LFU A;  2J6A A;  2H85 A;  1YIJ Z;  3PO3 S;  4Y52 I;  2OZK A;  2B63 I;  3J81 b;  1VQ6 Z;  2GTI A;  2NVT I;  1NUI A;  1TWF I;  1YJ9 Z;  3IR7 A;  4E2X A;  3HOV I;  1L1O C;  1Q82 1;  2JA6 I;  3FKI I;  2VUM I;  2OTL Z;  2YU9 I;  1YIT 1;  4E32 A;  1SIW A;  1VQO 1;  1N2F A;  3NH4 A;  1QXF A; 
#chains in the Genus database with same CATH homology
 4MD9 A;  3CC2 1;  2NVQ I;  2JA7 I;  3CD6 1;  4RS4 A;  2RPR A;  1YUA A;  1VQ5 1;  2RHB A;  3HOW I;  3K7A I;  4BY1 I;  1Q86 2;  2DE5 A;  1Q86 1;  4RVH A;  3S14 I;  2G2K A;  3CCM Z;  1YIJ 1;  5IT9 f;  4BY7 I;  3MZK B;  1VQ6 1;  3GTO I;  4NBA A;  2F4M A;  1YUK A;  1YJ9 1;  1X0T A;  1WCM I;  4MRI A;  2IZ3 A;  2QA4 Z;  1X3Z A;  1TFI A;  2QRC B;  3H3V J;  3FQQ A;  1YJN Z;  4E2Z A;  3VMH A;  2O4H A;  3J81 f;  3GCF A;  3I4N I;  4CL1 A;  3HOZ I;  3S1N I;  3ESW A;  1S7M A;  3CME Z;  1K8A 1;  3NDJ A;  5T67 A;  5A2Q f;  2QLV B;  2OOX B;  3MON A;  1RLY A;  2BJO A;  2JR6 A;  1QVG Z;  4DGL A;  4E31 A;  4MXU A;  3CCL Z;  4RVD A;  4E2Y A;  2VF1 A;  2RIQ A;  5IP7 I;  2PMZ A;  4A93 I;  1VQL Z;  1WII A;  2P28 A;  1R9T I;  4NBC A;  1QF8 A;  1TWA I;  4NBG A;  3JAM b;  2ZAE B;  5T64 A;  3CC2 Z;  3TE5 B;  1USP A;  3NFZ A;  2R93 I;  4AYB A;  4A3G I;  2JUB A;  1VQP Z;  1YJW Z;  4A3F I;  5AN9 F;  1VQ5 Z;  2QA4 1;  2P3Y A;  3PO2 I;  2I3C A;  2R6M A;  3KIF A;  1I3Q I;  1YJN 1;  3J80 b;  4BXX I;  5FLM I;  4A3I I;  3BG0 B;  3CME 1;  5FLX b;  3G71 1;  1X3W A;  3D6W A;  4NBB A;  3GTK I;  3H0G I;  3HOX I;  1ZH1 A;  1Q82 2;  4DK1 A;  4MD8 A;  2V8I A;  2PK7 A;  3CCL 1;  3RZD I;  3M3Y I;  1QVF Z;  1VQL 1;  1USP B;  3CCQ 1;  1VQ7 Z;  1LQL A;  2JMO A;  3GKQ A;  1K73 2;  1K73 1;  2E2I I;  1VQM Z;  3S1Q I;  4A3K I;  5LL6 f;  4E30 A;  5D1O A;  2V8J A;  1VQP 1;  1QVG Y;  3M4O I;  1YJW 1;  3JAM f;  3CCV 1;  1N8R 1;  5T6B A;  3FQM A;  1K9M 1;  3NH5 A;  5C4X I;  3GTQ I;  3CCJ Z;  1KC8 1;  3U50 C;  4MD7 A;  3LUS A;  3J80 f;  1Z03 A;  3J7A 4;  3G4S Z;  3HKZ A;  2PM9 A;  2GTH A;  5FLX f;  4NBE A;  3EER A;  3GTG I;  2V8K A;  4HH4 A;  3Q87 A;  4MH4 A;  2AKL A;  2RBL A;  2RT9 A;  3G71 Z;  1K8A 2;  1VQ9 Z;  3CCU Z;  1Q7Y 1;  3NDI A;  3QWU A;  1VQ7 1;  1QYP A;  1S72 Z;  4RV9 A;  5D1O B;  2Q4Z A;  2DE6 A;  3CQZ I;  5D1P A;  2R92 I;  3CXC Z;  1VQM 1;  2KPI A;  2IZ4 A;  1JJ2 Z;  2R7Z I;  1NP6 A;  4X6A I;  3S17 I;  3RZO I;  1VQK Z;  3CCQ Z;  1Z01 A;  1QVF Y;  3S1M I;  4NH1 C;  2QRE B;  4EWC A;  3CCJ 1;  3CCE 1;  2OOY B;  3G6E Z;  4XX2 A;  1I50 I;  1TWH I;  2GU2 A;  3CCV Z;  3G4S 1;  2JA8 I;  3P5J B;  4A3D I;  3IF8 A;  4A3E I;  1K83 I;  2HU9 A;  3VB9 A;  2W03 A;  1TWG I;  3I56 1;  1DL6 A;  3OW2 Z;  1I6H I;  4QTT A;  4A3M I;  1ZB8 A;  3S15 I;  1RO0 A;  1YI2 Z;  1VQ9 1;  3CCU 1;  3CC7 Z;  2KI7 B;  1VQ8 Z;  1S72 1;  5IT9 b;  3D9X A;  2VUG A;  3S16 I;  3VMI A;  4TNU A;  2QR1 B;  4A3L I;  2M48 A;  1KD1 2;  2M6N A;  3CCR Z;  1KD1 1;  1VQK 1;  2QEX Z;  1M90 2;  1M90 1;  4A3C I;  3T4N B;  2QKD A;  2NVY I;  2Q51 A;  5C4J I;  3CCS Z;  3I55 Z;  2Y0S A;  1W2B Y;  3G6E 1;  3CC4 1;  5A2Q b;  3CPW Z;  3CXC Y;  1NJI 2;  1NJI 1;  1TWC I;  1VQN 1;  1ML8 A;  1RO2 A;  1N8R 2;  1JJ2 Y;  2K5R A;  2JNY A;  1K9M 2;  4HGZ A;  1Y1V I;  3HOY I;  4E33 A;  3CMA 1;  3EED A;  2O53 A;  1KC8 2;  1KQS Z;  4DQY B;  1KRL A;  3CCE Z;  1SFO I;  1YI2 1;  3CC7 1;  3BG1 B;  3S2D I;  2LIY A;  1VQ8 1;  1Y1V S;  4RVG A;  1YHQ Z;  3GTL I;  1RQF A;  3F3P C;  3VMG A;  2K3R A;  3I56 Z;  2WB1 A;  5C3E I;  4BBS I;  4A3B I;  3NH8 A;  3OW2 Y;  3CCR 1;  4MON A;  5CM2 M;  3GTP I;  4HGY A;  2QEX 1;  1Q7Y 2;  1ZB9 A;  3I4M I;  4E2W A;  2OTJ Z;  1W2B Z;  3CCS 1;  3I55 1;  1Q81 2;  2F4O A;  3S1R I;  1Q81 1;  2E9H A;  4S1T A;  3I07 A;  1VQ4 Z;  2JA5 I;  2OTL 1;  1WW9 A;  3KIH A;  4NBD A;  4Y7N I;  2EGT A;  4NB8 A;  2W04 A;  3MZL B;  2NVX I;  2HF1 A;  2YAD A;  3GTJ I;  4QTU A;  4NB9 A;  4NOZ A;  2WAQ A;  3VTN A;  4BBR I;  4A3J I;  1VLA A;  1RO4 A;  3TDH B;  3CC4 Z;  1YIT Z;  1PFT A;  1VQN Z;  3CPW Y;  3HOU I;  1YHQ 1;  3GTM I;  1VQO Z;  3IX0 A;  2JS4 A;  4RVF A;  5C44 I;  4NBF A;  3F3F C;  4NBH A;  1P9N A;  3CCM 1;  4NFR A;  3CMA Z;  3CD6 Z;  2E2J I;  1Y1W I;  3GTM S;  2QRD B;  1M1K 2;  1KQS Y;  1M1K 1;  1RNI A;  3IFU A;  5IP9 I;  3PO3 I;  1JWH C;  2OTJ 1;  2E2H I;  1Z02 A;  2DE7 A;  1VQ4 1;  3S2H I;  2LFU A;  2J6A A;  2H85 A;  1YIJ Z;  3PO3 S;  4Y52 I;  2OZK A;  2B63 I;  3J81 b;  1VQ6 Z;  2GTI A;  2NVT I;  1NUI A;  1TWF I;  1YJ9 Z;  4E2X A;  3HOV I;  1L1O C;  1Q82 1;  2JA6 I;  3FKI I;  2VUM I;  2OTL Z;  2YU9 I;  1YIT 1;  4E32 A;  1VQO 1;  1N2F A;  3NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...