1VQ71

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq7100
1YJ9Z 2OTJZ 1Q861 1NJI1 1VQP1 1VQ9Z 1Q862 3CCQZ 3G6E1 1NJI2 2OTJ1 3OW2Z 3G71Z 3CCS1 3CXCY 1VQLZ 3G711 1VQ8Z 1VQ51 2OTLZ 3CCJ1 1VQ81 1Q811 3CXCZ 2OTL1 1YJW1 1Q7Y2 1VQPZ 1Q812 1KD12 1KQSY 3CCE1 3CCSZ 1S721 3CPWY 1YIT1 1KQSZ 1VQ5Z 1N8R2 1YIJZ 1Q821 3CCUZ 3CCJZ 1YI2Z 1Q822 1W2BY 1YIJ1 1K9M2 3CCU1 1VQ7Z 1M1K1 1YJNZ 1YJWZ 1YI21 1Q7Y1 1M1K2 3CCEZ 1KD11 1K8A1 1VQ71 1YJN1 1VQOZ 1VQ41 3CME1 1M902 3CCM1 1K8A2 1W2BZ 1S72Z 1K732 3I56Z 1VQO1 1VQKZ 3CC7Z 3I55Z 1YITZ 1VQNZ 3CC2Z 3I561 1VQK1 3CC71 1N8R1 3I551 1VQN1 3CC21 1K9M1 3CPWZ 3CMAZ 1VQM1 2QA41 3CC41 1VQ4Z 3CMEZ 1VQ6Z 3CD6Z 3CCMZ 3CMA1 1M901 1YHQZ 1QVFY 1K731 1VQ61 3CD61 2QEXZ 1YHQ1 1YJ91 3G4SZ 1KC81 1VQ91 1JJ2Y 3CCQ1 2QEX1 3CCVZ 1KC82 1QVFZ 3G4S1 3CCV1 1QVGY 1VQMZ 2QA4Z 1VQL1 3CC4Z 3CCRZ 3CCLZ 1JJ2Z 3OW2Y 3CCR1 3CCL1 1QVGZ 3G6EZ
chains in the Genus database with same CATH superfamily
2JA5I 3GTMS 2OTJZ 4A3KI 1VQ9Z 1USPB 2LEXA 4E33A 2OOXB 2JS4A 3G71Z 4HGZA 2IV2X 1Z02A 2OOYB 4A3EI 3ESWA 2K5RA 4NH1C 1VQ81 1ZB8A 1S7MA 2DE7A 1FDOA 3S17I 4Y7NI 4NBFA 3CCE1 3S14I 3S1MI 3CCSZ 4BBSI 3HOWI 1VQ5Z 2NVYI 1TFIA 1YIJZ 2B63I 4A3II 1W2BY 4A93I 4MD8A 4RV9A 1VQ7Z 1YI21 1L1OC 2GTHA 1Q7Y1 1YJN1 4A3MI 2P3YA 4E2XA 3CCM1 1W2BZ 1S72Z 2V45A 3J81b 1K732 3I56Z 1VQKZ 3S16I 1YITZ 3IR7A 3CC71 2KPIA 1VQN1 3QWUA 1K83I 4MXUA 5FLXf 2G2KA 3HKZA 2RPRA 3M4OI 3CPWZ 2ZAEB 3CMAZ 2NVXI 2QA41 2QLVB 1DL6A 4E2ZA 1VQ4Z 2V8JA 1VQ6Z 3CD6Z 3VMGA 4RVDA 3GTKI 1QVFY 4NBAA 4HGYA 2QREB 2OZKA 2JA7I 1RO0A 1KC81 1VQ91 3EEDA 4A3GI 3Q87A 1KC82 2GTIA 1QVFZ 3I4NI 1TWAI 2LFUA 1JWHC 1NP6A 1QVGY 1VQMZ 1QF8A 4HH4A 3CCLZ 1VLAA 4RS4A 2E2JI 3JAMf 1KRLA 3S2DI 3FQMA 1NUIA 1QVGZ 3G6EZ 1Q861 3NDIA 5IP9I 2Y0SA 4EWCA 3GTPI 1Q862 4E2WA 2V3VA 3CCS1 3MZKB 3CXCY 1VQLZ 4A3LI 3HOYI 2RHBA 5IT9f 1VQ51 2OTLZ 2VPXA 4E32A 2K3RA 2Q4ZA 3CXCZ 3J80b 1Z01A 2VPYA 3KIFA 3BG1B 4E2YA 4MONA 1S721 3S1NI 1Y8CA 1LQLA 1YIT1 4QTTA 3K7AI 1YUAA 1N8R2 3HOUI 3CCUZ 3CCJZ 2WAQA 1K9M2 2PK7A 4NBDA 1YJWZ 3GKQA 2NVTI 5D1OA 4XX2A 1X3WA 2Q51A 4NBEA 1VQ41 2LIYA 3FKII 3D2LA 3IX0A 1VQO1 3F3FC 3S1RI 1WZNA 3RZDI 3MZLB 3NH5A 1WJ2A 3I551 1TWFI 3NFZA 3CC21 1Y1VI 5T64A 3EERA 4BXXI 1TWGI 2E2HI 1N2FA 1SIWA 2M6NA 2EGTA 2VUGA 1VQM1 1AA6A 3KIHA 3CMEZ 1YHQZ 1Y1WI 1Q16A 4MRIA 1K731 2VPZA 4E31A 3I4MI 3G4SZ 2QEX1 1TWHI 3LUSA 3T4NB 4NOZA 2R6MA 3CCV1 2H85A 2JA6I 3TE5B 3PO2I 1VQL1 4NBBA 5D1OB 1WW9A 3CC4Z 3CCRZ 2RT9A 2PMZA 4NFRA 2I3CA 1RNIA 4TNUA 5A2Qf 2M48A 2F4OA 1RO2A 3CCQZ 3D6WA 5IP7I 3NDJA 2OTJ1 1Y1VS 2VUMI 3S1QI 2JA8I 3M3YI 2QR1B 4X6AI 1QXFA 3G711 1VQ8Z 1R9TI 1X0TA 3NH4A 3CCJ1 4QTUA 3GTLI 3TDHB 3GTOI 1SFOI 3VMIA 1WIIA 1YJW1 2F4MA 1I3QI 1ML8A 1VQPZ 1KD12 1KQSY 2E2II 3MONA 3GTMI 3NH8A 1KQSZ 3HOXI 1RQFA 1Q821 1YI2Z 5T6BA 1Q822 1YIJ1 4A3JI 1M1K1 1YJNZ 2HF1A 2E7ZA 1I50I 2JIMA 2V8KA 1M1K2 5FLXb 1VQ71 2JNYA 3CME1 1M902 2W04A 2QRDB 2IZ3A 3F3PC 2R92I 4MD7A 3CC7Z 1TWCI 2NVQI 1VQNZ 3HOVI 2IZ4A 3I561 1VQK1 5A2Qb 1YUKA 1N8R1 2KI7B 2RIQA 2JIQA 3D9XA 1K9M1 4NB8A 2VF1A 5D1PA 2J6AA 3CC41 3J81f 2BJOA 5T67A 5FLMI 2RBLA 3CMA1 2PM9A 2R7ZI 3HOZI 1VQ61 3CD61 3JAMb 2GU2A 2DE5A 1JJ2Y 3VMHA 3CCQ1 3VTNA 2JUBA 3PO3I 2AYDA 4Y52I 3U50C 4DK1A 4DGLA 2DE6A 4DQYB 1JJ2Z 1RLYA 2JIOA 3OW2Y 3CCL1 5IT9b 5CM2M 1YJ9Z 4BBRI 1ZB9A 1NJI1 1VQP1 5C44I 3GTJI 2O53A 2V8IA 3G6E1 1NJI2 1I6HI 3OW2Z 1P9NA 4NB9A 5AN9F 4AYBA 4A3FI 4RVHA 2HU9A 2NAPA 3BG0B 2YU9I 3RZOI 1RO4A 5LL6f 2JIPA 3J7A4 2QRCB 2O4HA 3GTGI 1Q811 1X3ZA 2W03A 2OTL1 1Q7Y2 1Q812 4NBGA 3H0GI 3PO3S 2JR6A 3CPWY 4MD9A 4CL1A 3IFUA 3IF8A 4NBCA 4BY7I 1QYPA 3J80f 4A3BI 2P28A 3CCU1 1FDIA 1WCMI 1PFTA 3CCEZ 1KD11 1K8A1 2E9HA 2VPWA 1VQOZ 1K8A2 3P5JB 3VB9A 3I55Z 3CC2Z 1USPA 4NBHA 2JMOA 2YADA 1Z03A 4RVGA 3S2HI 5C4JI 3CCMZ 3S15I 1M901 3GCFA 3GTQI 2QEXZ 1YHQ1 3CQZI 1YJ91 2WB1A 3FQQA 4RVFA 3CCVZ 4E30A 2AKLA 3G4S1 4S1TA 1ZH1A 2JIRA 2QKDA 2QA4Z 2R93I 4BY1I 4MH4A 5C4XI 5C3EI 3CCR1 3H3VJ 4A3DI 4A3CI 3I07A
chains in the Genus database with same CATH topology
2JA5I 3GTMS 2OTJZ 4A3KI 1VQ9Z 1USPB 4E33A 2OOXB 2JS4A 3G71Z 4HGZA 1Z02A 2OOYB 4A3EI 3ESWA 2K5RA 4NH1C 1VQ81 1ZB8A 1S7MA 2DE7A 3S17I 4Y7NI 4NBFA 3CCE1 3S14I 3S1MI 3CCSZ 4BBSI 3HOWI 1VQ5Z 2NVYI 1TFIA 1YIJZ 2B63I 4A3II 1W2BY 4A93I 4MD8A 4RV9A 1VQ7Z 1YI21 1L1OC 2GTHA 1Q7Y1 1YJN1 4A3MI 2P3YA 4E2XA 3CCM1 1W2BZ 1S72Z 3J81b 1K732 3I56Z 1VQKZ 3S16I 1YITZ 3CC71 2KPIA 1VQN1 3QWUA 1K83I 4MXUA 5FLXf 2G2KA 3HKZA 2RPRA 3M4OI 3CPWZ 2ZAEB 3CMAZ 2NVXI 2QA41 2QLVB 1DL6A 4E2ZA 1VQ4Z 2V8JA 1VQ6Z 3CD6Z 3VMGA 4RVDA 3GTKI 1QVFY 4NBAA 4HGYA 2QREB 2OZKA 2JA7I 1RO0A 1KC81 1VQ91 3EEDA 4A3GI 3Q87A 1KC82 2GTIA 1QVFZ 3I4NI 1TWAI 2LFUA 1JWHC 1NP6A 1QVGY 1VQMZ 1QF8A 4HH4A 3CCLZ 1VLAA 4RS4A 2E2JI 3JAMf 1KRLA 3S2DI 3FQMA 1NUIA 1QVGZ 3G6EZ 1Q861 3NDIA 5IP9I 2Y0SA 4EWCA 3GTPI 1Q862 4E2WA 3CCS1 3MZKB 3CXCY 1VQLZ 4A3LI 3HOYI 2RHBA 5IT9f 1VQ51 2OTLZ 4E32A 2K3RA 2Q4ZA 3CXCZ 3J80b 1Z01A 3KIFA 3BG1B 4E2YA 4MONA 1S721 3S1NI 1LQLA 1YIT1 4QTTA 3K7AI 1YUAA 1N8R2 3HOUI 3CCUZ 3CCJZ 2WAQA 1K9M2 2PK7A 4NBDA 1YJWZ 3GKQA 2NVTI 5D1OA 4XX2A 1X3WA 2Q51A 4NBEA 1VQ41 2LIYA 3FKII 3IX0A 1VQO1 3F3FC 3S1RI 3RZDI 3MZLB 3NH5A 3I551 1TWFI 3NFZA 3CC21 1Y1VI 5T64A 3EERA 4BXXI 1TWGI 2E2HI 1N2FA 2M6NA 2EGTA 2VUGA 1VQM1 3KIHA 3CMEZ 1YHQZ 1Y1WI 4MRIA 1K731 4E31A 3I4MI 3G4SZ 2QEX1 1TWHI 3LUSA 3T4NB 4NOZA 2R6MA 3CCV1 2H85A 2JA6I 3TE5B 3PO2I 1VQL1 4NBBA 5D1OB 1WW9A 3CC4Z 3CCRZ 2RT9A 2PMZA 4NFRA 2I3CA 1RNIA 4TNUA 5A2Qf 2M48A 2F4OA 1RO2A 3CCQZ 3D6WA 5IP7I 3NDJA 2OTJ1 1Y1VS 2VUMI 3S1QI 2JA8I 3M3YI 2QR1B 4X6AI 3G711 1VQ8Z 1R9TI 1X0TA 3NH4A 3CCJ1 4QTUA 3GTLI 3TDHB 3GTOI 1SFOI 3VMIA 1WIIA 1YJW1 2F4MA 1I3QI 1ML8A 1VQPZ 1KD12 1KQSY 2E2II 3MONA 3GTMI 3NH8A 1KQSZ 3HOXI 1RQFA 1Q821 1YI2Z 5T6BA 1Q822 1YIJ1 4A3JI 1M1K1 1YJNZ 2HF1A 1I50I 2V8KA 1M1K2 5FLXb 1VQ71 2JNYA 3CME1 1M902 2W04A 2QRDB 2IZ3A 3F3PC 2R92I 4MD7A 3CC7Z 1TWCI 2NVQI 1VQNZ 3HOVI 2IZ4A 3I561 1VQK1 5A2Qb 1YUKA 1N8R1 2KI7B 2RIQA 3D9XA 1K9M1 4NB8A 2VF1A 5D1PA 2J6AA 3J81f 3CC41 2BJOA 5T67A 5FLMI 2RBLA 3CMA1 2PM9A 2R7ZI 3HOZI 1VQ61 3CD61 3JAMb 2GU2A 2DE5A 1JJ2Y 3VMHA 3CCQ1 3VTNA 2JUBA 3PO3I 4Y52I 3U50C 4DK1A 4DGLA 2DE6A 4DQYB 1JJ2Z 1RLYA 3OW2Y 3CCL1 5IT9b 5CM2M 1YJ9Z 4BBRI 1ZB9A 1NJI1 1VQP1 5C44I 3GTJI 2O53A 2V8IA 3G6E1 1NJI2 1I6HI 3OW2Z 1P9NA 4NB9A 5AN9F 4AYBA 4A3FI 4RVHA 2HU9A 3RZOI 3BG0B 2YU9I 1RO4A 5LL6f 3J7A4 2QRCB 2O4HA 3GTGI 1Q811 1X3ZA 2W03A 2OTL1 1Q7Y2 1Q812 4NBGA 3H0GI 3PO3S 2JR6A 3CPWY 4MD9A 4CL1A 3IFUA 3IF8A 4NBCA 4BY7I 1QYPA 3J80f 4A3BI 2P28A 3CCU1 1WCMI 1PFTA 3CCEZ 1KD11 1K8A1 2E9HA 1VQOZ 1K8A2 3P5JB 3VB9A 3I55Z 3CC2Z 1USPA 4NBHA 2JMOA 2YADA 1Z03A 4RVGA 3S2HI 5C4JI 3CCMZ 3S15I 1M901 3GCFA 3GTQI 2QEXZ 1YHQ1 3CQZI 1YJ91 2WB1A 3FQQA 4RVFA 3CCVZ 4E30A 2AKLA 3G4S1 4S1TA 1ZH1A 2QKDA 2QA4Z 2R93I 4BY1I 4MH4A 5C4XI 5C3EI 3CCR1 3H3VJ 4A3DI 4A3CI 3I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  2OTJ Z;  1Q86 1;  1NJI 1;  1VQP 1;  1VQ9 Z;  1Q86 2;  3CCQ Z;  3G6E 1;  1NJI 2;  2OTJ 1;  3OW2 Z;  3G71 Z;  3CCS 1;  3CXC Y;  1VQL Z;  3G71 1;  1VQ8 Z;  1VQ5 1;  2OTL Z;  3CCJ 1;  1VQ8 1;  1Q81 1;  3CXC Z;  2OTL 1;  1YJW 1;  1Q7Y 2;  1VQP Z;  1Q81 2;  1KD1 2;  1KQS Y;  3CCE 1;  3CCS Z;  1S72 1;  3CPW Y;  1YIT 1;  1KQS Z;  1VQ5 Z;  1N8R 2;  1YIJ Z;  1Q82 1;  3CCU Z;  3CCJ Z;  1YI2 Z;  1Q82 2;  1W2B Y;  1YIJ 1;  1K9M 2;  3CCU 1;  1VQ7 Z;  1M1K 1;  1YJN Z;  1YJW Z;  1YI2 1;  1Q7Y 1;  1M1K 2;  3CCE Z;  1KD1 1;  1K8A 1;  1VQ7 1;  1YJN 1;  1VQO Z;  1VQ4 1;  3CME 1;  1M90 2;  3CCM 1;  1K8A 2;  1W2B Z;  1S72 Z;  1K73 2;  3I56 Z;  1VQO 1;  1VQK Z;  3CC7 Z;  3I55 Z;  1YIT Z;  1VQN Z;  3CC2 Z;  3I56 1;  1VQK 1;  3CC7 1;  1N8R 1;  3I55 1;  1VQN 1;  3CC2 1;  1K9M 1;  3CPW Z;  3CMA Z;  1VQM 1;  2QA4 1;  3CC4 1;  1VQ4 Z;  3CME Z;  1VQ6 Z;  3CD6 Z;  3CCM Z;  3CMA 1;  1M90 1;  1YHQ Z;  1QVF Y;  1K73 1;  1VQ6 1;  3CD6 1;  2QEX Z;  1YHQ 1;  1YJ9 1;  3G4S Z;  1KC8 1;  1VQ9 1;  1JJ2 Y;  3CCQ 1;  2QEX 1;  3CCV Z;  1KC8 2;  1QVF Z;  3G4S 1;  3CCV 1;  1QVG Y;  1VQM Z;  2QA4 Z;  1VQL 1;  3CC4 Z;  3CCR Z;  3CCL Z;  1JJ2 Z;  3OW2 Y;  3CCR 1;  3CCL 1;  1QVG Z;  3G6E Z; 
#chains in the Genus database with same CATH topology
 2JA5 I;  3GTM S;  2OTJ Z;  4A3K I;  1VQ9 Z;  1USP B;  2LEX A;  4E33 A;  2OOX B;  2JS4 A;  3G71 Z;  4HGZ A;  2IV2 X;  1Z02 A;  2OOY B;  4A3E I;  3ESW A;  2K5R A;  4NH1 C;  1VQ8 1;  1ZB8 A;  1S7M A;  2DE7 A;  1FDO A;  3S17 I;  4Y7N I;  4NBF A;  3CCE 1;  3S14 I;  3S1M I;  3CCS Z;  4BBS I;  3HOW I;  1VQ5 Z;  2NVY I;  1TFI A;  1YIJ Z;  2B63 I;  4A3I I;  1W2B Y;  4A93 I;  4MD8 A;  4RV9 A;  1VQ7 Z;  1YI2 1;  1L1O C;  2GTH A;  1Q7Y 1;  1YJN 1;  4A3M I;  2P3Y A;  4E2X A;  3CCM 1;  1W2B Z;  1S72 Z;  2V45 A;  3J81 b;  1K73 2;  3I56 Z;  1VQK Z;  3S16 I;  1YIT Z;  3IR7 A;  3CC7 1;  2KPI A;  1VQN 1;  3QWU A;  1K83 I;  4MXU A;  5FLX f;  2G2K A;  3HKZ A;  2RPR A;  3M4O I;  3CPW Z;  2ZAE B;  3CMA Z;  2NVX I;  2QA4 1;  2QLV B;  1DL6 A;  4E2Z A;  1VQ4 Z;  2V8J A;  1VQ6 Z;  3CD6 Z;  3VMG A;  4RVD A;  3GTK I;  1QVF Y;  4NBA A;  4HGY A;  2QRE B;  2OZK A;  2JA7 I;  1RO0 A;  1KC8 1;  1VQ9 1;  3EED A;  4A3G I;  3Q87 A;  1KC8 2;  2GTI A;  1QVF Z;  3I4N I;  1TWA I;  2LFU A;  1JWH C;  1NP6 A;  1QVG Y;  1VQM Z;  1QF8 A;  4HH4 A;  3CCL Z;  1VLA A;  4RS4 A;  2E2J I;  3JAM f;  1KRL A;  3S2D I;  3FQM A;  1NUI A;  1QVG Z;  3G6E Z;  1Q86 1;  3NDI A;  5IP9 I;  2Y0S A;  4EWC A;  3GTP I;  1Q86 2;  4E2W A;  2V3V A;  3CCS 1;  3MZK B;  3CXC Y;  1VQL Z;  4A3L I;  3HOY I;  2RHB A;  5IT9 f;  1VQ5 1;  2OTL Z;  2VPX A;  4E32 A;  2K3R A;  2Q4Z A;  3CXC Z;  3J80 b;  1Z01 A;  2VPY A;  3KIF A;  3BG1 B;  4E2Y A;  4MON A;  1S72 1;  3S1N I;  1Y8C A;  1LQL A;  1YIT 1;  4QTT A;  3K7A I;  1YUA A;  1N8R 2;  3HOU I;  3CCU Z;  3CCJ Z;  2WAQ A;  1K9M 2;  2PK7 A;  4NBD A;  1YJW Z;  3GKQ A;  2NVT I;  5D1O A;  4XX2 A;  1X3W A;  2Q51 A;  4NBE A;  1VQ4 1;  2LIY A;  3FKI I;  3D2L A;  3IX0 A;  1VQO 1;  3F3F C;  3S1R I;  1WZN A;  3RZD I;  3MZL B;  3NH5 A;  1WJ2 A;  3I55 1;  1TWF I;  3NFZ A;  3CC2 1;  1Y1V I;  5T64 A;  3EER A;  4BXX I;  1TWG I;  2E2H I;  1N2F A;  1SIW A;  2M6N A;  2EGT A;  2VUG A;  1VQM 1;  1AA6 A;  3KIH A;  3CME Z;  1YHQ Z;  1Y1W I;  1Q16 A;  4MRI A;  1K73 1;  2VPZ A;  4E31 A;  3I4M I;  3G4S Z;  2QEX 1;  1TWH I;  3LUS A;  3T4N B;  4NOZ A;  2R6M A;  3CCV 1;  2H85 A;  2JA6 I;  3TE5 B;  3PO2 I;  1VQL 1;  4NBB A;  5D1O B;  1WW9 A;  3CC4 Z;  3CCR Z;  2RT9 A;  2PMZ A;  4NFR A;  2I3C A;  1RNI A;  4TNU A;  5A2Q f;  2M48 A;  2F4O A;  1RO2 A;  3CCQ Z;  3D6W A;  5IP7 I;  3NDJ A;  2OTJ 1;  1Y1V S;  2VUM I;  3S1Q I;  2JA8 I;  3M3Y I;  2QR1 B;  4X6A I;  1QXF A;  3G71 1;  1VQ8 Z;  1R9T I;  1X0T A;  3NH4 A;  3CCJ 1;  4QTU A;  3GTL I;  3TDH B;  3GTO I;  1SFO I;  3VMI A;  1WII A;  1YJW 1;  2F4M A;  1I3Q I;  1ML8 A;  1VQP Z;  1KD1 2;  1KQS Y;  2E2I I;  3MON A;  3GTM I;  3NH8 A;  1KQS Z;  3HOX I;  1RQF A;  1Q82 1;  1YI2 Z;  5T6B A;  1Q82 2;  1YIJ 1;  4A3J I;  1M1K 1;  1YJN Z;  2HF1 A;  2E7Z A;  1I50 I;  2JIM A;  2V8K A;  1M1K 2;  5FLX b;  1VQ7 1;  2JNY A;  3CME 1;  1M90 2;  2W04 A;  2QRD B;  2IZ3 A;  3F3P C;  2R92 I;  4MD7 A;  3CC7 Z;  1TWC I;  2NVQ I;  1VQN Z;  3HOV I;  2IZ4 A;  3I56 1;  1VQK 1;  5A2Q b;  1YUK A;  1N8R 1;  2KI7 B;  2RIQ A;  2JIQ A;  3D9X A;  1K9M 1;  4NB8 A;  2VF1 A;  5D1P A;  2J6A A;  3CC4 1;  3J81 f;  2BJO A;  5T67 A;  5FLM I;  2RBL A;  3CMA 1;  2PM9 A;  2R7Z I;  3HOZ I;  1VQ6 1;  3CD6 1;  3JAM b;  2GU2 A;  2DE5 A;  1JJ2 Y;  3VMH A;  3CCQ 1;  3VTN A;  2JUB A;  3PO3 I;  2AYD A;  4Y52 I;  3U50 C;  4DK1 A;  4DGL A;  2DE6 A;  4DQY B;  1JJ2 Z;  1RLY A;  2JIO A;  3OW2 Y;  3CCL 1;  5IT9 b;  5CM2 M;  1YJ9 Z;  4BBR I;  1ZB9 A;  1NJI 1;  1VQP 1;  5C44 I;  3GTJ I;  2O53 A;  2V8I A;  3G6E 1;  1NJI 2;  1I6H I;  3OW2 Z;  1P9N A;  4NB9 A;  5AN9 F;  4AYB A;  4A3F I;  4RVH A;  2HU9 A;  2NAP A;  3BG0 B;  2YU9 I;  3RZO I;  1RO4 A;  5LL6 f;  2JIP A;  3J7A 4;  2QRC B;  2O4H A;  3GTG I;  1Q81 1;  1X3Z A;  2W03 A;  2OTL 1;  1Q7Y 2;  1Q81 2;  4NBG A;  3H0G I;  3PO3 S;  2JR6 A;  3CPW Y;  4MD9 A;  4CL1 A;  3IFU A;  3IF8 A;  4NBC A;  4BY7 I;  1QYP A;  3J80 f;  4A3B I;  2P28 A;  3CCU 1;  1FDI A;  1WCM I;  1PFT A;  3CCE Z;  1KD1 1;  1K8A 1;  2E9H A;  2VPW A;  1VQO Z;  1K8A 2;  3P5J B;  3VB9 A;  3I55 Z;  3CC2 Z;  1USP A;  4NBH A;  2JMO A;  2YAD A;  1Z03 A;  4RVG A;  3S2H I;  5C4J I;  3CCM Z;  3S15 I;  1M90 1;  3GCF A;  3GTQ I;  2QEX Z;  1YHQ 1;  3CQZ I;  1YJ9 1;  2WB1 A;  3FQQ A;  4RVF A;  3CCV Z;  4E30 A;  2AKL A;  3G4S 1;  4S1T A;  1ZH1 A;  2JIR A;  2QKD A;  2QA4 Z;  2R93 I;  4BY1 I;  4MH4 A;  5C4X I;  5C3E I;  3CCR 1;  3H3V J;  4A3D I;  4A3C I;  3I07 A; 
#chains in the Genus database with same CATH homology
 2JA5 I;  3GTM S;  2OTJ Z;  4A3K I;  1VQ9 Z;  1USP B;  4E33 A;  2OOX B;  2JS4 A;  3G71 Z;  4HGZ A;  1Z02 A;  2OOY B;  4A3E I;  3ESW A;  2K5R A;  4NH1 C;  1VQ8 1;  1ZB8 A;  1S7M A;  2DE7 A;  3S17 I;  4Y7N I;  4NBF A;  3CCE 1;  3S14 I;  3S1M I;  3CCS Z;  4BBS I;  3HOW I;  1VQ5 Z;  2NVY I;  1TFI A;  1YIJ Z;  2B63 I;  4A3I I;  1W2B Y;  4A93 I;  4MD8 A;  4RV9 A;  1VQ7 Z;  1YI2 1;  1L1O C;  2GTH A;  1Q7Y 1;  1YJN 1;  4A3M I;  2P3Y A;  4E2X A;  3CCM 1;  1W2B Z;  1S72 Z;  3J81 b;  1K73 2;  3I56 Z;  1VQK Z;  3S16 I;  1YIT Z;  3CC7 1;  2KPI A;  1VQN 1;  3QWU A;  1K83 I;  4MXU A;  5FLX f;  2G2K A;  3HKZ A;  2RPR A;  3M4O I;  3CPW Z;  2ZAE B;  3CMA Z;  2NVX I;  2QA4 1;  2QLV B;  1DL6 A;  4E2Z A;  1VQ4 Z;  2V8J A;  1VQ6 Z;  3CD6 Z;  3VMG A;  4RVD A;  3GTK I;  1QVF Y;  4NBA A;  4HGY A;  2QRE B;  2OZK A;  2JA7 I;  1RO0 A;  1KC8 1;  1VQ9 1;  3EED A;  4A3G I;  3Q87 A;  1KC8 2;  2GTI A;  1QVF Z;  3I4N I;  1TWA I;  2LFU A;  1JWH C;  1NP6 A;  1QVG Y;  1VQM Z;  1QF8 A;  4HH4 A;  3CCL Z;  1VLA A;  4RS4 A;  2E2J I;  3JAM f;  1KRL A;  3S2D I;  3FQM A;  1NUI A;  1QVG Z;  3G6E Z;  1Q86 1;  3NDI A;  5IP9 I;  2Y0S A;  4EWC A;  3GTP I;  1Q86 2;  4E2W A;  3CCS 1;  3MZK B;  3CXC Y;  1VQL Z;  4A3L I;  3HOY I;  2RHB A;  5IT9 f;  1VQ5 1;  2OTL Z;  4E32 A;  2K3R A;  2Q4Z A;  3CXC Z;  3J80 b;  1Z01 A;  3KIF A;  3BG1 B;  4E2Y A;  4MON A;  1S72 1;  3S1N I;  1LQL A;  1YIT 1;  4QTT A;  3K7A I;  1YUA A;  1N8R 2;  3HOU I;  3CCU Z;  3CCJ Z;  2WAQ A;  1K9M 2;  2PK7 A;  4NBD A;  1YJW Z;  3GKQ A;  2NVT I;  5D1O A;  4XX2 A;  1X3W A;  2Q51 A;  4NBE A;  1VQ4 1;  2LIY A;  3FKI I;  3IX0 A;  1VQO 1;  3F3F C;  3S1R I;  3RZD I;  3MZL B;  3NH5 A;  3I55 1;  1TWF I;  3NFZ A;  3CC2 1;  1Y1V I;  5T64 A;  3EER A;  4BXX I;  1TWG I;  2E2H I;  1N2F A;  2M6N A;  2EGT A;  2VUG A;  1VQM 1;  3KIH A;  3CME Z;  1YHQ Z;  1Y1W I;  4MRI A;  1K73 1;  4E31 A;  3I4M I;  3G4S Z;  2QEX 1;  1TWH I;  3LUS A;  3T4N B;  4NOZ A;  2R6M A;  3CCV 1;  2H85 A;  2JA6 I;  3TE5 B;  3PO2 I;  1VQL 1;  4NBB A;  5D1O B;  1WW9 A;  3CC4 Z;  3CCR Z;  2RT9 A;  2PMZ A;  4NFR A;  2I3C A;  1RNI A;  4TNU A;  5A2Q f;  2M48 A;  2F4O A;  1RO2 A;  3CCQ Z;  3D6W A;  5IP7 I;  3NDJ A;  2OTJ 1;  1Y1V S;  2VUM I;  3S1Q I;  2JA8 I;  3M3Y I;  2QR1 B;  4X6A I;  3G71 1;  1VQ8 Z;  1R9T I;  1X0T A;  3NH4 A;  3CCJ 1;  4QTU A;  3GTL I;  3TDH B;  3GTO I;  1SFO I;  3VMI A;  1WII A;  1YJW 1;  2F4M A;  1I3Q I;  1ML8 A;  1VQP Z;  1KD1 2;  1KQS Y;  2E2I I;  3MON A;  3GTM I;  3NH8 A;  1KQS Z;  3HOX I;  1RQF A;  1Q82 1;  1YI2 Z;  5T6B A;  1Q82 2;  1YIJ 1;  4A3J I;  1M1K 1;  1YJN Z;  2HF1 A;  1I50 I;  2V8K A;  1M1K 2;  5FLX b;  1VQ7 1;  2JNY A;  3CME 1;  1M90 2;  2W04 A;  2QRD B;  2IZ3 A;  3F3P C;  2R92 I;  4MD7 A;  3CC7 Z;  1TWC I;  2NVQ I;  1VQN Z;  3HOV I;  2IZ4 A;  3I56 1;  1VQK 1;  5A2Q b;  1YUK A;  1N8R 1;  2KI7 B;  2RIQ A;  3D9X A;  1K9M 1;  4NB8 A;  2VF1 A;  5D1P A;  2J6A A;  3J81 f;  3CC4 1;  2BJO A;  5T67 A;  5FLM I;  2RBL A;  3CMA 1;  2PM9 A;  2R7Z I;  3HOZ I;  1VQ6 1;  3CD6 1;  3JAM b;  2GU2 A;  2DE5 A;  1JJ2 Y;  3VMH A;  3CCQ 1;  3VTN A;  2JUB A;  3PO3 I;  4Y52 I;  3U50 C;  4DK1 A;  4DGL A;  2DE6 A;  4DQY B;  1JJ2 Z;  1RLY A;  3OW2 Y;  3CCL 1;  5IT9 b;  5CM2 M;  1YJ9 Z;  4BBR I;  1ZB9 A;  1NJI 1;  1VQP 1;  5C44 I;  3GTJ I;  2O53 A;  2V8I A;  3G6E 1;  1NJI 2;  1I6H I;  3OW2 Z;  1P9N A;  4NB9 A;  5AN9 F;  4AYB A;  4A3F I;  4RVH A;  2HU9 A;  3RZO I;  3BG0 B;  2YU9 I;  1RO4 A;  5LL6 f;  3J7A 4;  2QRC B;  2O4H A;  3GTG I;  1Q81 1;  1X3Z A;  2W03 A;  2OTL 1;  1Q7Y 2;  1Q81 2;  4NBG A;  3H0G I;  3PO3 S;  2JR6 A;  3CPW Y;  4MD9 A;  4CL1 A;  3IFU A;  3IF8 A;  4NBC A;  4BY7 I;  1QYP A;  3J80 f;  4A3B I;  2P28 A;  3CCU 1;  1WCM I;  1PFT A;  3CCE Z;  1KD1 1;  1K8A 1;  2E9H A;  1VQO Z;  1K8A 2;  3P5J B;  3VB9 A;  3I55 Z;  3CC2 Z;  1USP A;  4NBH A;  2JMO A;  2YAD A;  1Z03 A;  4RVG A;  3S2H I;  5C4J I;  3CCM Z;  3S15 I;  1M90 1;  3GCF A;  3GTQ I;  2QEX Z;  1YHQ 1;  3CQZ I;  1YJ9 1;  2WB1 A;  3FQQ A;  4RVF A;  3CCV Z;  4E30 A;  2AKL A;  3G4S 1;  4S1T A;  1ZH1 A;  2QKD A;  2QA4 Z;  2R93 I;  4BY1 I;  4MH4 A;  5C4X I;  5C3E I;  3CCR 1;  3H3V J;  4A3D I;  4A3C I;  3I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...