4Y52I

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I02
4X6AI 1Y1VI 4QTTA 1PFTA 3GKQA 3GTGI 3PO3S 2NVQI 4NB9A 3GTKI 3GTPI 3HOXI 3S1RI 3GTMI 1LQLA 4A3JI 2JNYA 5C44I 3S1NI 4A3DI 4A3GI 3GTJI 4MH4A 3K7AI 4A3LI 3CQZI 1WW9A 2R7ZI 3U50C 2HF1A 3VB9A 2B63I 3S15I 3H0GI 2DE7A 4A3KI 1YUAA 1X3WA 4NBHA 3FKII 3S17I 3Q87A 2JA7I 4QTUA 1TWAI 4A3CI 5IP7I 3H3VJ 5C4JI 4Y52I 1RO4A 4BY1I 3GTOI 3LUSA 4BBSI 3S14I 3PO3I 1I50I 2VUMI 1TWGI 1TFIA 3ESWA 3GCFA 2F4OA 4NBCA 1Y1WI 4NOZA 1ML8A 3I07A 5FLMI 2JA6I 2DE5A 4A3II 4A3BI 1R9TI 3PO2I 3HOVI 2E2HI 1N2FA 2BJOA 2NVXI 4Y7NI 3S16I 5CM2M 1RLYA 2JA8I 4NBBA 3D6WA 5IP9I 4A3MI 3I4NI 2NVYI 3S2DI 4BBRI 2JR6A 4XX2A 4NB8A 1SFOI 3M3YI 4NBAA 4NBDA 2R93I 1I6HI 3HOUI 1WCMI 3S1MI 4NBFA 3RZDI 3GTQI 3EERA 3VMGA 2NVTI 3VMHA 3HOYI 2JS4A 3HOZI 1Y1VS 2YU9I 1I3QI 2P3YA 1TWFI 1VLAA 2RBLA 4BY7I 4NBEA 2E2II 1DL6A 3GTMS 4A3FI 1TWHI 2JA5I 3I4MI 4A3EI 1NUIA 2J6AA 2E2JI 2PK7A 5C3EI 1USPB 1ZB9A 1QYPA 3S2HI 4BXXI 3GTLI 1ZB8A 2KPIA 5C4XI 4NBGA 4A93I 2DE6A 3RZOI 2R92I 3HOWI 3S1QI 1X3ZA 3VMIA 1TWCI 2F4MA 2K5RA 3M4OI 1L1OC 2AKLA 1K83I 1USPA
chains in the Genus database with same CATH superfamily
2GTIA 3CD61 3JAMf 4QTTA 2QA41 2V8KA 4RS4A 4NFRA 5D1OA 3IR7A 2E9HA 2NVQI 4E31A 1M1K1 2VPZA 3S1RI 1M901 1FDIA 3I56Z 3CCE1 1KRLA 2JIQA 4DQYB 2QEX1 3CQZI 1WW9A 4MD9A 3VB9A 2B63I 3S15I 3H0GI 1YJ9Z 3NDJA 2RIQA 4AYBA 3G4SZ 3I561 1VQ51 2LIYA 2JA7I 3TE5B 4NH1C 1QVGZ 1Z02A 5C4JI 1RO4A 4BY1I 1VQMZ 1JWHC 1TFIA 4E33A 4NBCA 1Y1WI 1Q16A 4A3BI 3HOVI 1RO0A 2NVXI 3CCJZ 1Z03A 2EGTA 4E2ZA 2JA8I 1YITZ 1K9M2 3D6WA 1Q861 1KC81 2NVYI 2PMZA 2OTLZ 3HKZA 5A2Qb 3KIHA 1SIWA 1VQLZ 2VUGA 2LFUA 3HOZI 1RO2A 2YU9I 2RHBA 1S72Z 2I3CA 3CCMZ 4BY7I 4MONA 2QLVB 1S7MA 3CXCZ 2LEXA 3BG0B 1JJ2Y 3CCV1 3FQQA 2E2JI 1USPB 3S2HI 4BXXI 1VQNZ 1QVFZ 3F3FC 1YUKA 3I551 2R92I 3CMEZ 4DGLA 1X3ZA 4TNUA 3VMIA 4E2XA 1TWCI 1L1OC 4RVDA 2AKLA 3NH8A 3CPWZ 2O4HA 1VQP1 4NB9A 3GTKI 3G6EZ 4S1TA 1LQLA 1YIJZ 5FLXb 3CCUZ 3K7AI 4MH4A 1VQK1 2V45A 2JIOA 2HF1A 2Q4ZA 1YUAA 4NBHA 4RV9A 1YIJ1 4Y52I 3GTOI 1K9M1 3VTNA 1N8R2 3BG1B 1I50I 4DK1A 3ESWA 4MD8A 2F4OA 1Q812 1ML8A 3I07A 2JA6I 2DE5A 4A3II 1R9TI 1VQ8Z 3CC4Z 3IX0A 2OZKA 2E2HI 1RLYA 2V3VA 3CMAZ 1Q822 1VQ4Z 4MXUA 2E7ZA 5IP9I 1X0TA 3JAMb 4XX2A 2OOYB 1W2BY 4NB8A 3J7A4 3CC7Z 4NBAA 2W04A 4NBDA 1VQ6Z 4NBFA 3RZDI 4HH4A 3EERA 1YJ91 2OTJZ 3HOYI 3G4S1 2GU2A 1I3QI 5IT9f 2P3YA 1TWFI 4NBEA 3NFZA 4A3EI 1VQ61 1VQM1 5C3EI 4EWCA 3NH5A 2JUBA 3GTLI 3QWUA 1ZB8A 5C4XI 3NDIA 4NBGA 2VPXA 4A93I 3CC2Z 2DE6A 3CCJ1 1VQOZ 1FDOA 1YIT1 3S1QI 1M1K2 4A3GI 1USPA 4E2YA 4X6AI 2RPRA 2OTL1 1WZNA 3GKQA 3GTGI 1VQL1 3PO3S 5T67A 3CC21 4A3JI 2JNYA 5C44I 3S1NI 4A3DI 3F3PC 1S721 3GTJI 3CCM1 4A3LI 1YJWZ 2OOXB 1YI2Z 2QRDB 5T64A 1YJNZ 2YADA 3CCRZ 2QRCB 2DE7A 4A3KI 1Q811 1VQN1 3FKII 2M6NA 4QTUA 1K732 3CCSZ 2GTHA 1VQ7Z 1YJN1 4HGYA 5FLXf 4RVGA 5AN9F 3MZKB 3CME1 2JIMA 2JMOA 1Q821 4BBSI 2VPYA 3J81b 4MRIA 1KD12 1QVFY 3S14I 3PO3I 2ZAEB 3GCFA 2M48A 5FLMI 4MD7A 3G71Z 2KI7B 3CCLZ 1QF8A 2W03A 4Y7NI 5CM2M 3CPWY 3IF8A 3G6E1 3OW2Y 1NP6A 2PM9A 3I4NI 3S2DI 2JR6A 3CCU1 1SFOI 3M3YI 3J80b 2JIPA 2K3RA 2R93I 1I6HI 3HOUI 1WCMI 3S1MI 3GTQI 1Q7Y2 2NVTI 3EEDA 2JS4A 2IZ4A 1Y1VS 3D2LA 1KQSY 1NJI2 1WJ2A 3CCEZ 2RT9A 2VPWA 2QEXZ 2E2II 3GTMS 4A3FI 1NUIA 1QXFA 2J6AA 2PK7A 1W2BZ 1ZB9A 5D1PA 4E30A 1VQ5Z 4E2WA 5D1OB 1VQ81 3CC41 2O53A 1K8A2 3HOWI 3CMA1 2HU9A 4RVFA 2QKDA 1VQ41 3M4OI 1WIIA 1K83I 2Q51A 1Y1VI 3CC71 1PFTA 2G2KA 5A2Qf 2NAPA 2V8IA 3GTPI 3HOXI 2OTJ1 3GTMI 4HGZA 1QVGY 2IZ3A 1K731 2R7ZI 1RNIA 1Y8CA 3D9XA 3P5JB 2IV2X 3U50C 1KD11 5IT9b 1X3WA 1M902 3S17I 3Q87A 1VQ9Z 1JJ2Z 1TWAI 2WB1A 4A3CI 5T6BA 5IP7I 3H3VJ 1VQO1 3LUSA 3CCVZ 2VUMI 1TWGI 2AYDA 2VF1A 4CL1A 3KIFA 4NOZA 1VQ91 3PO2I 1N8R1 1N2FA 2BJOA 3I55Z 1Q7Y1 3S16I 4NBBA 1NJI1 3CXCY 3CCQZ 2QR1B 4BBRI 3J81f 1P9NA 1YJW1 4E32A 3MZLB 1YI21 3IFUA 1VQPZ 3CCR1 3VMGA 3NH4A 3VMHA 2V8JA 1Q862 1KC82 3CCQ1 3MONA 1K8A1 1VLAA 2RBLA 3CCS1 3OW2Z 1VQ71 1DL6A 1TWHI 1YHQZ 2JA5I 1VQKZ 3I4MI 3J80f 1RQFA 1QYPA 2QREB 5LL6f 3G711 2KPIA 3CD6Z 2QA4Z 2R6MA 3CCL1 3RZOI 1YHQ1 1ZH1A 2H85A 1KQSZ 2JIRA 4RVHA 1Z01A 2WAQA 3FQMA 3TDHB 2K5RA 2F4MA 1AA6A 2P28A 4A3MI 2Y0SA 3T4NB
chains in the Genus database with same CATH topology
2GTIA 3CD61 3JAMf 4QTTA 2QA41 2V8KA 4RS4A 4NFRA 5D1OA 2NVQI 2E9HA 4E31A 1M1K1 3S1RI 1M901 3I56Z 3CCE1 1KRLA 4DQYB 2QEX1 3CQZI 1WW9A 4MD9A 3VB9A 2B63I 3S15I 3H0GI 1YJ9Z 3NDJA 2RIQA 4AYBA 3G4SZ 3I561 1VQ51 2LIYA 2JA7I 3TE5B 4NH1C 1QVGZ 1Z02A 5C4JI 1RO4A 4BY1I 1VQMZ 1JWHC 1TFIA 4E33A 4NBCA 1Y1WI 4A3BI 3HOVI 1RO0A 2NVXI 3CCJZ 1Z03A 2EGTA 4E2ZA 2JA8I 1YITZ 1K9M2 3D6WA 1Q861 1KC81 2NVYI 2PMZA 2OTLZ 3HKZA 5A2Qb 3KIHA 1VQLZ 2VUGA 2LFUA 3HOZI 1RO2A 2YU9I 2RHBA 1S72Z 2I3CA 3CCMZ 4BY7I 4MONA 2QLVB 1S7MA 3CXCZ 3BG0B 1JJ2Y 3CCV1 3FQQA 2E2JI 1USPB 3S2HI 4BXXI 1VQNZ 1QVFZ 3F3FC 1YUKA 3I551 2R92I 3CMEZ 4DGLA 1X3ZA 4TNUA 3VMIA 4E2XA 1TWCI 1L1OC 4RVDA 2AKLA 3NH8A 3CPWZ 2O4HA 1VQP1 4NB9A 3GTKI 3G6EZ 4S1TA 1LQLA 1YIJZ 5FLXb 3CCUZ 3K7AI 4MH4A 1VQK1 2HF1A 2Q4ZA 1YUAA 4NBHA 4RV9A 1YIJ1 4Y52I 3GTOI 1K9M1 3VTNA 1N8R2 3BG1B 1I50I 4DK1A 3ESWA 4MD8A 2F4OA 1Q812 1ML8A 3I07A 2JA6I 2DE5A 4A3II 1R9TI 1VQ8Z 3CC4Z 3IX0A 2OZKA 2E2HI 1RLYA 3CMAZ 1Q822 1VQ4Z 4MXUA 5IP9I 1X0TA 3JAMb 4XX2A 2OOYB 1W2BY 4NB8A 3J7A4 3CC7Z 4NBAA 2W04A 4NBDA 1VQ6Z 4NBFA 3RZDI 4HH4A 3EERA 1YJ91 2OTJZ 3HOYI 3G4S1 2GU2A 1I3QI 5IT9f 2P3YA 1TWFI 4NBEA 3NFZA 4A3EI 1VQ61 1VQM1 5C3EI 4EWCA 3NH5A 2JUBA 3GTLI 3QWUA 1ZB8A 5C4XI 3NDIA 4NBGA 4A93I 3CC2Z 2DE6A 3CCJ1 1VQOZ 1YIT1 3S1QI 1M1K2 4A3GI 1USPA 4E2YA 4X6AI 2RPRA 2OTL1 3GKQA 3GTGI 1VQL1 3PO3S 5T67A 3CC21 4A3JI 2JNYA 5C44I 3S1NI 4A3DI 3F3PC 1S721 3GTJI 3CCM1 4A3LI 1YJWZ 2OOXB 1YI2Z 2QRDB 5T64A 1YJNZ 2YADA 3CCRZ 2QRCB 2DE7A 4A3KI 1Q811 1VQN1 3FKII 2M6NA 4QTUA 1K732 3CCSZ 2GTHA 1VQ7Z 1YJN1 4HGYA 5FLXf 4RVGA 5AN9F 3MZKB 3CME1 1Q821 2JMOA 4BBSI 3J81b 3S14I 4MRIA 1KD12 1QVFY 3PO3I 2ZAEB 3GCFA 2M48A 5FLMI 4MD7A 3G71Z 2KI7B 3CCLZ 1QF8A 2W03A 4Y7NI 5CM2M 3CPWY 3IF8A 3G6E1 3OW2Y 1NP6A 2PM9A 3I4NI 3S2DI 2JR6A 3CCU1 1SFOI 3M3YI 3J80b 2K3RA 2R93I 1I6HI 3HOUI 1WCMI 3S1MI 3GTQI 1Q7Y2 2NVTI 3EEDA 2JS4A 1Y1VS 2IZ4A 1KQSY 1NJI2 3CCEZ 2RT9A 2QEXZ 2E2II 3GTMS 4A3FI 1NUIA 2J6AA 2PK7A 1W2BZ 1ZB9A 5D1PA 4E30A 1VQ5Z 4E2WA 5D1OB 1VQ81 3CC41 2O53A 1K8A2 3HOWI 3CMA1 2HU9A 4RVFA 2QKDA 1VQ41 3M4OI 1WIIA 1K83I 2Q51A 1Y1VI 3CC71 1PFTA 2G2KA 5A2Qf 2V8IA 3GTPI 3HOXI 2OTJ1 3GTMI 4HGZA 1QVGY 2IZ3A 1K731 2R7ZI 1RNIA 3D9XA 3P5JB 3U50C 1KD11 5IT9b 1X3WA 1M902 3S17I 3Q87A 1VQ9Z 1JJ2Z 1TWAI 2WB1A 4A3CI 5T6BA 5IP7I 3H3VJ 1VQO1 3LUSA 3CCVZ 2VUMI 1TWGI 2VF1A 4CL1A 3KIFA 4NOZA 1VQ91 3PO2I 1N8R1 1N2FA 2BJOA 3I55Z 1Q7Y1 3S16I 4NBBA 1NJI1 3CXCY 3CCQZ 2QR1B 4BBRI 3J81f 1P9NA 1YJW1 4E32A 3MZLB 1YI21 3IFUA 1VQPZ 3CCR1 3VMGA 3NH4A 3VMHA 2V8JA 1Q862 1KC82 3CCQ1 3MONA 1K8A1 1VLAA 2RBLA 3CCS1 3OW2Z 1VQ71 1DL6A 1TWHI 1YHQZ 2JA5I 1VQKZ 3I4MI 3J80f 1RQFA 1QYPA 2QREB 5LL6f 3G711 2KPIA 3CD6Z 2QA4Z 2R6MA 3CCL1 3RZOI 1YHQ1 1ZH1A 2H85A 1KQSZ 4RVHA 1Z01A 2WAQA 3FQMA 3TDHB 2K5RA 2F4MA 2P28A 4A3MI 2Y0SA 3T4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6A I;  1Y1V I;  4QTT A;  1PFT A;  3GKQ A;  3GTG I;  3PO3 S;  2NVQ I;  4NB9 A;  3GTK I;  3GTP I;  3HOX I;  3S1R I;  3GTM I;  1LQL A;  4A3J I;  2JNY A;  5C44 I;  3S1N I;  4A3D I;  4A3G I;  3GTJ I;  4MH4 A;  3K7A I;  4A3L I;  3CQZ I;  1WW9 A;  2R7Z I;  3U50 C;  2HF1 A;  3VB9 A;  2B63 I;  3S15 I;  3H0G I;  2DE7 A;  4A3K I;  1YUA A;  1X3W A;  4NBH A;  3FKI I;  3S17 I;  3Q87 A;  2JA7 I;  4QTU A;  1TWA I;  4A3C I;  5IP7 I;  3H3V J;  5C4J I;  4Y52 I;  1RO4 A;  4BY1 I;  3GTO I;  3LUS A;  4BBS I;  3S14 I;  3PO3 I;  1I50 I;  2VUM I;  1TWG I;  1TFI A;  3ESW A;  3GCF A;  2F4O A;  4NBC A;  1Y1W I;  4NOZ A;  1ML8 A;  3I07 A;  5FLM I;  2JA6 I;  2DE5 A;  4A3I I;  4A3B I;  1R9T I;  3PO2 I;  3HOV I;  2E2H I;  1N2F A;  2BJO A;  2NVX I;  4Y7N I;  3S16 I;  5CM2 M;  1RLY A;  2JA8 I;  4NBB A;  3D6W A;  5IP9 I;  4A3M I;  3I4N I;  2NVY I;  3S2D I;  4BBR I;  2JR6 A;  4XX2 A;  4NB8 A;  1SFO I;  3M3Y I;  4NBA A;  4NBD A;  2R93 I;  1I6H I;  3HOU I;  1WCM I;  3S1M I;  4NBF A;  3RZD I;  3GTQ I;  3EER A;  3VMG A;  2NVT I;  3VMH A;  3HOY I;  2JS4 A;  3HOZ I;  1Y1V S;  2YU9 I;  1I3Q I;  2P3Y A;  1TWF I;  1VLA A;  2RBL A;  4BY7 I;  4NBE A;  2E2I I;  1DL6 A;  3GTM S;  4A3F I;  1TWH I;  2JA5 I;  3I4M I;  4A3E I;  1NUI A;  2J6A A;  2E2J I;  2PK7 A;  5C3E I;  1USP B;  1ZB9 A;  1QYP A;  3S2H I;  4BXX I;  3GTL I;  1ZB8 A;  2KPI A;  5C4X I;  4NBG A;  4A93 I;  2DE6 A;  3RZO I;  2R92 I;  3HOW I;  3S1Q I;  1X3Z A;  3VMI A;  1TWC I;  2F4M A;  2K5R A;  3M4O I;  1L1O C;  2AKL A;  1K83 I;  1USP A; 
#chains in the Genus database with same CATH topology
 2GTI A;  3CD6 1;  3JAM f;  4QTT A;  2QA4 1;  2V8K A;  4RS4 A;  4NFR A;  5D1O A;  3IR7 A;  2E9H A;  2NVQ I;  4E31 A;  1M1K 1;  2VPZ A;  3S1R I;  1M90 1;  1FDI A;  3I56 Z;  3CCE 1;  1KRL A;  2JIQ A;  4DQY B;  2QEX 1;  3CQZ I;  1WW9 A;  4MD9 A;  3VB9 A;  2B63 I;  3S15 I;  3H0G I;  1YJ9 Z;  3NDJ A;  2RIQ A;  4AYB A;  3G4S Z;  3I56 1;  1VQ5 1;  2LIY A;  2JA7 I;  3TE5 B;  4NH1 C;  1QVG Z;  1Z02 A;  5C4J I;  1RO4 A;  4BY1 I;  1VQM Z;  1JWH C;  1TFI A;  4E33 A;  4NBC A;  1Y1W I;  1Q16 A;  4A3B I;  3HOV I;  1RO0 A;  2NVX I;  3CCJ Z;  1Z03 A;  2EGT A;  4E2Z A;  2JA8 I;  1YIT Z;  1K9M 2;  3D6W A;  1Q86 1;  1KC8 1;  2NVY I;  2PMZ A;  2OTL Z;  3HKZ A;  5A2Q b;  3KIH A;  1SIW A;  1VQL Z;  2VUG A;  2LFU A;  3HOZ I;  1RO2 A;  2YU9 I;  2RHB A;  1S72 Z;  2I3C A;  3CCM Z;  4BY7 I;  4MON A;  2QLV B;  1S7M A;  3CXC Z;  2LEX A;  3BG0 B;  1JJ2 Y;  3CCV 1;  3FQQ A;  2E2J I;  1USP B;  3S2H I;  4BXX I;  1VQN Z;  1QVF Z;  3F3F C;  1YUK A;  3I55 1;  2R92 I;  3CME Z;  4DGL A;  1X3Z A;  4TNU A;  3VMI A;  4E2X A;  1TWC I;  1L1O C;  4RVD A;  2AKL A;  3NH8 A;  3CPW Z;  2O4H A;  1VQP 1;  4NB9 A;  3GTK I;  3G6E Z;  4S1T A;  1LQL A;  1YIJ Z;  5FLX b;  3CCU Z;  3K7A I;  4MH4 A;  1VQK 1;  2V45 A;  2JIO A;  2HF1 A;  2Q4Z A;  1YUA A;  4NBH A;  4RV9 A;  1YIJ 1;  4Y52 I;  3GTO I;  1K9M 1;  3VTN A;  1N8R 2;  3BG1 B;  1I50 I;  4DK1 A;  3ESW A;  4MD8 A;  2F4O A;  1Q81 2;  1ML8 A;  3I07 A;  2JA6 I;  2DE5 A;  4A3I I;  1R9T I;  1VQ8 Z;  3CC4 Z;  3IX0 A;  2OZK A;  2E2H I;  1RLY A;  2V3V A;  3CMA Z;  1Q82 2;  1VQ4 Z;  4MXU A;  2E7Z A;  5IP9 I;  1X0T A;  3JAM b;  4XX2 A;  2OOY B;  1W2B Y;  4NB8 A;  3J7A 4;  3CC7 Z;  4NBA A;  2W04 A;  4NBD A;  1VQ6 Z;  4NBF A;  3RZD I;  4HH4 A;  3EER A;  1YJ9 1;  2OTJ Z;  3HOY I;  3G4S 1;  2GU2 A;  1I3Q I;  5IT9 f;  2P3Y A;  1TWF I;  4NBE A;  3NFZ A;  4A3E I;  1VQ6 1;  1VQM 1;  5C3E I;  4EWC A;  3NH5 A;  2JUB A;  3GTL I;  3QWU A;  1ZB8 A;  5C4X I;  3NDI A;  4NBG A;  2VPX A;  4A93 I;  3CC2 Z;  2DE6 A;  3CCJ 1;  1VQO Z;  1FDO A;  1YIT 1;  3S1Q I;  1M1K 2;  4A3G I;  1USP A;  4E2Y A;  4X6A I;  2RPR A;  2OTL 1;  1WZN A;  3GKQ A;  3GTG I;  1VQL 1;  3PO3 S;  5T67 A;  3CC2 1;  4A3J I;  2JNY A;  5C44 I;  3S1N I;  4A3D I;  3F3P C;  1S72 1;  3GTJ I;  3CCM 1;  4A3L I;  1YJW Z;  2OOX B;  1YI2 Z;  2QRD B;  5T64 A;  1YJN Z;  2YAD A;  3CCR Z;  2QRC B;  2DE7 A;  4A3K I;  1Q81 1;  1VQN 1;  3FKI I;  2M6N A;  4QTU A;  1K73 2;  3CCS Z;  2GTH A;  1VQ7 Z;  1YJN 1;  4HGY A;  5FLX f;  4RVG A;  5AN9 F;  3MZK B;  3CME 1;  2JIM A;  2JMO A;  1Q82 1;  4BBS I;  2VPY A;  3J81 b;  4MRI A;  1KD1 2;  1QVF Y;  3S14 I;  3PO3 I;  2ZAE B;  3GCF A;  2M48 A;  5FLM I;  4MD7 A;  3G71 Z;  2KI7 B;  3CCL Z;  1QF8 A;  2W03 A;  4Y7N I;  5CM2 M;  3CPW Y;  3IF8 A;  3G6E 1;  3OW2 Y;  1NP6 A;  2PM9 A;  3I4N I;  3S2D I;  2JR6 A;  3CCU 1;  1SFO I;  3M3Y I;  3J80 b;  2JIP A;  2K3R A;  2R93 I;  1I6H I;  3HOU I;  1WCM I;  3S1M I;  3GTQ I;  1Q7Y 2;  2NVT I;  3EED A;  2JS4 A;  2IZ4 A;  1Y1V S;  3D2L A;  1KQS Y;  1NJI 2;  1WJ2 A;  3CCE Z;  2RT9 A;  2VPW A;  2QEX Z;  2E2I I;  3GTM S;  4A3F I;  1NUI A;  1QXF A;  2J6A A;  2PK7 A;  1W2B Z;  1ZB9 A;  5D1P A;  4E30 A;  1VQ5 Z;  4E2W A;  5D1O B;  1VQ8 1;  3CC4 1;  2O53 A;  1K8A 2;  3HOW I;  3CMA 1;  2HU9 A;  4RVF A;  2QKD A;  1VQ4 1;  3M4O I;  1WII A;  1K83 I;  2Q51 A;  1Y1V I;  3CC7 1;  1PFT A;  2G2K A;  5A2Q f;  2NAP A;  2V8I A;  3GTP I;  3HOX I;  2OTJ 1;  3GTM I;  4HGZ A;  1QVG Y;  2IZ3 A;  1K73 1;  2R7Z I;  1RNI A;  1Y8C A;  3D9X A;  3P5J B;  2IV2 X;  3U50 C;  1KD1 1;  5IT9 b;  1X3W A;  1M90 2;  3S17 I;  3Q87 A;  1VQ9 Z;  1JJ2 Z;  1TWA I;  2WB1 A;  4A3C I;  5T6B A;  5IP7 I;  3H3V J;  1VQO 1;  3LUS A;  3CCV Z;  2VUM I;  1TWG I;  2AYD A;  2VF1 A;  4CL1 A;  3KIF A;  4NOZ A;  1VQ9 1;  3PO2 I;  1N8R 1;  1N2F A;  2BJO A;  3I55 Z;  1Q7Y 1;  3S16 I;  4NBB A;  1NJI 1;  3CXC Y;  3CCQ Z;  2QR1 B;  4BBR I;  3J81 f;  1P9N A;  1YJW 1;  4E32 A;  3MZL B;  1YI2 1;  3IFU A;  1VQP Z;  3CCR 1;  3VMG A;  3NH4 A;  3VMH A;  2V8J A;  1Q86 2;  1KC8 2;  3CCQ 1;  3MON A;  1K8A 1;  1VLA A;  2RBL A;  3CCS 1;  3OW2 Z;  1VQ7 1;  1DL6 A;  1TWH I;  1YHQ Z;  2JA5 I;  1VQK Z;  3I4M I;  3J80 f;  1RQF A;  1QYP A;  2QRE B;  5LL6 f;  3G71 1;  2KPI A;  3CD6 Z;  2QA4 Z;  2R6M A;  3CCL 1;  3RZO I;  1YHQ 1;  1ZH1 A;  2H85 A;  1KQS Z;  2JIR A;  4RVH A;  1Z01 A;  2WAQ A;  3FQM A;  3TDH B;  2K5R A;  2F4M A;  1AA6 A;  2P28 A;  4A3M I;  2Y0S A;  3T4N B; 
#chains in the Genus database with same CATH homology
 2GTI A;  3CD6 1;  3JAM f;  4QTT A;  2QA4 1;  2V8K A;  4RS4 A;  4NFR A;  5D1O A;  2NVQ I;  2E9H A;  4E31 A;  1M1K 1;  3S1R I;  1M90 1;  3I56 Z;  3CCE 1;  1KRL A;  4DQY B;  2QEX 1;  3CQZ I;  1WW9 A;  4MD9 A;  3VB9 A;  2B63 I;  3S15 I;  3H0G I;  1YJ9 Z;  3NDJ A;  2RIQ A;  4AYB A;  3G4S Z;  3I56 1;  1VQ5 1;  2LIY A;  2JA7 I;  3TE5 B;  4NH1 C;  1QVG Z;  1Z02 A;  5C4J I;  1RO4 A;  4BY1 I;  1VQM Z;  1JWH C;  1TFI A;  4E33 A;  4NBC A;  1Y1W I;  4A3B I;  3HOV I;  1RO0 A;  2NVX I;  3CCJ Z;  1Z03 A;  2EGT A;  4E2Z A;  2JA8 I;  1YIT Z;  1K9M 2;  3D6W A;  1Q86 1;  1KC8 1;  2NVY I;  2PMZ A;  2OTL Z;  3HKZ A;  5A2Q b;  3KIH A;  1VQL Z;  2VUG A;  2LFU A;  3HOZ I;  1RO2 A;  2YU9 I;  2RHB A;  1S72 Z;  2I3C A;  3CCM Z;  4BY7 I;  4MON A;  2QLV B;  1S7M A;  3CXC Z;  3BG0 B;  1JJ2 Y;  3CCV 1;  3FQQ A;  2E2J I;  1USP B;  3S2H I;  4BXX I;  1VQN Z;  1QVF Z;  3F3F C;  1YUK A;  3I55 1;  2R92 I;  3CME Z;  4DGL A;  1X3Z A;  4TNU A;  3VMI A;  4E2X A;  1TWC I;  1L1O C;  4RVD A;  2AKL A;  3NH8 A;  3CPW Z;  2O4H A;  1VQP 1;  4NB9 A;  3GTK I;  3G6E Z;  4S1T A;  1LQL A;  1YIJ Z;  5FLX b;  3CCU Z;  3K7A I;  4MH4 A;  1VQK 1;  2HF1 A;  2Q4Z A;  1YUA A;  4NBH A;  4RV9 A;  1YIJ 1;  4Y52 I;  3GTO I;  1K9M 1;  3VTN A;  1N8R 2;  3BG1 B;  1I50 I;  4DK1 A;  3ESW A;  4MD8 A;  2F4O A;  1Q81 2;  1ML8 A;  3I07 A;  2JA6 I;  2DE5 A;  4A3I I;  1R9T I;  1VQ8 Z;  3CC4 Z;  3IX0 A;  2OZK A;  2E2H I;  1RLY A;  3CMA Z;  1Q82 2;  1VQ4 Z;  4MXU A;  5IP9 I;  1X0T A;  3JAM b;  4XX2 A;  2OOY B;  1W2B Y;  4NB8 A;  3J7A 4;  3CC7 Z;  4NBA A;  2W04 A;  4NBD A;  1VQ6 Z;  4NBF A;  3RZD I;  4HH4 A;  3EER A;  1YJ9 1;  2OTJ Z;  3HOY I;  3G4S 1;  2GU2 A;  1I3Q I;  5IT9 f;  2P3Y A;  1TWF I;  4NBE A;  3NFZ A;  4A3E I;  1VQ6 1;  1VQM 1;  5C3E I;  4EWC A;  3NH5 A;  2JUB A;  3GTL I;  3QWU A;  1ZB8 A;  5C4X I;  3NDI A;  4NBG A;  4A93 I;  3CC2 Z;  2DE6 A;  3CCJ 1;  1VQO Z;  1YIT 1;  3S1Q I;  1M1K 2;  4A3G I;  1USP A;  4E2Y A;  4X6A I;  2RPR A;  2OTL 1;  3GKQ A;  3GTG I;  1VQL 1;  3PO3 S;  5T67 A;  3CC2 1;  4A3J I;  2JNY A;  5C44 I;  3S1N I;  4A3D I;  3F3P C;  1S72 1;  3GTJ I;  3CCM 1;  4A3L I;  1YJW Z;  2OOX B;  1YI2 Z;  2QRD B;  5T64 A;  1YJN Z;  2YAD A;  3CCR Z;  2QRC B;  2DE7 A;  4A3K I;  1Q81 1;  1VQN 1;  3FKI I;  2M6N A;  4QTU A;  1K73 2;  3CCS Z;  2GTH A;  1VQ7 Z;  1YJN 1;  4HGY A;  5FLX f;  4RVG A;  5AN9 F;  3MZK B;  3CME 1;  1Q82 1;  2JMO A;  4BBS I;  3J81 b;  3S14 I;  4MRI A;  1KD1 2;  1QVF Y;  3PO3 I;  2ZAE B;  3GCF A;  2M48 A;  5FLM I;  4MD7 A;  3G71 Z;  2KI7 B;  3CCL Z;  1QF8 A;  2W03 A;  4Y7N I;  5CM2 M;  3CPW Y;  3IF8 A;  3G6E 1;  3OW2 Y;  1NP6 A;  2PM9 A;  3I4N I;  3S2D I;  2JR6 A;  3CCU 1;  1SFO I;  3M3Y I;  3J80 b;  2K3R A;  2R93 I;  1I6H I;  3HOU I;  1WCM I;  3S1M I;  3GTQ I;  1Q7Y 2;  2NVT I;  3EED A;  2JS4 A;  1Y1V S;  2IZ4 A;  1KQS Y;  1NJI 2;  3CCE Z;  2RT9 A;  2QEX Z;  2E2I I;  3GTM S;  4A3F I;  1NUI A;  2J6A A;  2PK7 A;  1W2B Z;  1ZB9 A;  5D1P A;  4E30 A;  1VQ5 Z;  4E2W A;  5D1O B;  1VQ8 1;  3CC4 1;  2O53 A;  1K8A 2;  3HOW I;  3CMA 1;  2HU9 A;  4RVF A;  2QKD A;  1VQ4 1;  3M4O I;  1WII A;  1K83 I;  2Q51 A;  1Y1V I;  3CC7 1;  1PFT A;  2G2K A;  5A2Q f;  2V8I A;  3GTP I;  3HOX I;  2OTJ 1;  3GTM I;  4HGZ A;  1QVG Y;  2IZ3 A;  1K73 1;  2R7Z I;  1RNI A;  3D9X A;  3P5J B;  3U50 C;  1KD1 1;  5IT9 b;  1X3W A;  1M90 2;  3S17 I;  3Q87 A;  1VQ9 Z;  1JJ2 Z;  1TWA I;  2WB1 A;  4A3C I;  5T6B A;  5IP7 I;  3H3V J;  1VQO 1;  3LUS A;  3CCV Z;  2VUM I;  1TWG I;  2VF1 A;  4CL1 A;  3KIF A;  4NOZ A;  1VQ9 1;  3PO2 I;  1N8R 1;  1N2F A;  2BJO A;  3I55 Z;  1Q7Y 1;  3S16 I;  4NBB A;  1NJI 1;  3CXC Y;  3CCQ Z;  2QR1 B;  4BBR I;  3J81 f;  1P9N A;  1YJW 1;  4E32 A;  3MZL B;  1YI2 1;  3IFU A;  1VQP Z;  3CCR 1;  3VMG A;  3NH4 A;  3VMH A;  2V8J A;  1Q86 2;  1KC8 2;  3CCQ 1;  3MON A;  1K8A 1;  1VLA A;  2RBL A;  3CCS 1;  3OW2 Z;  1VQ7 1;  1DL6 A;  1TWH I;  1YHQ Z;  2JA5 I;  1VQK Z;  3I4M I;  3J80 f;  1RQF A;  1QYP A;  2QRE B;  5LL6 f;  3G71 1;  2KPI A;  3CD6 Z;  2QA4 Z;  2R6M A;  3CCL 1;  3RZO I;  1YHQ 1;  1ZH1 A;  2H85 A;  1KQS Z;  4RVH A;  1Z01 A;  2WAQ A;  3FQM A;  3TDH B;  2K5R A;  2F4M A;  2P28 A;  4A3M I;  2Y0S A;  3T4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...