4Y52I

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I02
1ZB9A 4A3II 4NBHA 4A3DI 2P3YA 2DE7A 3D6WA 4NBBA 2JA5I 3S1QI 5C44I 3GTGI 5FLMI 3GCFA 3I4MI 4NB9A 2R7ZI 3FKII 1VLAA 1RLYA 4BBRI 3GTJI 3PO3S 4BY7I 1NUIA 4NBAA 3M4OI 2F4OA 2J6AA 1Y1WI 2JA8I 3S2DI 2BJOA 3GTQI 1N2FA 3CQZI 3S2HI 3HOXI 3S1RI 2NVYI 1TWFI 4MH4A 5C3EI 2E2JI 1PFTA 1TFIA 2YU9I 3GTPI 3HOUI 4X6AI 2JS4A 2R93I 3S16I 2F4MA 1TWGI 3ESWA 4A3GI 4QTTA 1I3QI 2K5RA 2NVXI 1X3ZA 4QTUA 1SFOI 4A93I 1X3WA 1WCMI 2RBLA 3S15I 3VMGA 2PK7A 2NVTI 4NBEA 4NBDA 1USPB 4A3EI 3S1NI 4A3FI 3S14I 1R9TI 4NB8A 1L1OC 4NBFA 5C4JI 1ZB8A 1RO4A 3S1MI 4A3CI 2KPIA 4BY1I 3U50C 1YUAA 3H3VJ 1LQLA 2HF1A 1TWHI 3HOVI 4Y52I 3S17I 2E2HI 1Y1VS 1Y1VI 5CM2M 3Q87A 3EERA 3VMHA 3I07A 3GTKI 4BBSI 2JA6I 1WW9A 3GKQA 2R92I 3HOWI 5IP9I 1USPA 3VB9A 4A3LI 2JR6A 4NOZA 4A3KI 1I50I 2E2II 5C4XI 1I6HI 3HOZI 3RZOI 1K83I 1QYPA 2NVQI 3RZDI 3HOYI 4BXXI 4NBGA 3K7AI 3M3YI 4A3BI 1TWAI 1TWCI 3GTOI 4A3MI 4Y7NI 2DE6A 1ML8A 5IP7I 4A3JI 3VMIA 4XX2A 1DL6A 3GTLI 2AKLA 2JNYA 3PO3I 2VUMI 2JA7I 3H0GI 3GTMS 3PO2I 4NBCA 3GTMI 3I4NI 2B63I 2DE5A 3LUSA
chains in the Genus database with same CATH superfamily
4NBHA 2P3YA 1VQ91 4NBBA 3CXCZ 3I561 3S1QI 3GTGI 5T6BA 3G6E1 1KRLA 3G71Z 1RLYA 1NUIA 4NBAA 1QVGY 3M4OI 2F4OA 2J6AA 1YHQZ 3NDJA 3S2HI 2NVYI 1TWFI 2YU9I 4NH1C 3CCE1 3S16I 2F4MA 1TWGI 5FLXb 3JAMf 4QTTA 1I3QI 2JUBA 1VQ7Z 4QTUA 1VQK1 2O4HA 1AA6A 2R6MA 3CD61 2RBLA 3VMGA 2NVTI 4RVGA 4NBEA 1USPB 1K9M2 4A3EI 3CC7Z 1YJ91 1K9M1 1FDOA 3S14I 1R9TI 1K8A2 1L1OC 4NBFA 2V3VA 1K8A1 4E2ZA 3CC41 3CXCY 4A3CI 1KQSZ 2KPIA 2B63I 2GTIA 2HF1A 2VPWA 3G4S1 3J81b 2HU9A 1Q822 2W04A 2Y0SA 1Q821 2W03A 2LIYA 1WJ2A 2PMZA 3CCEZ 3HOWI 5IP9I 4TNUA 2GU2A 2OTJ1 1YJNZ 3HKZA 5FLXf 4BXXI 3CCLZ 1YJ9Z 3M3YI 2KI7B 3CMA1 1VQ81 3GTOI 4E33A 2DE6A 1P9NA 4MD7A 3TDHB 4XX2A 3VMIA 3NFZA 2E9HA 1RQFA 4MXUA 1QVGZ 3H0GI 3CC2Z 3G711 3GTMI 3G4SZ 3I4NI 3F3FC 2QRDB 4AYBA 2DE5A 2EGTA 3LUSA 1WZNA 1ZB9A 1RO2A 4A3II 2DE7A 1KQSY 2QRCB 1YIJ1 2JIOA 2Q4ZA 4DGLA 1YHQ1 3JAMb 3CCUZ 1JWHC 3OW2Y 4BBRI 3GTJI 3CPWZ 1YUKA 3S2DI 4DK1A 1NJI2 2JIRA 3GTQI 1N2FA 3CQZI 1NJI1 1VQ8Z 3HOXI 1YI2Z 1VQ71 3GTPI 2JS4A 3IX0A 1W2BZ 3F3PC 3ESWA 3CC71 5T64A 2K5RA 1RO0A 1Z01A 2NVXI 1X3ZA 4A93I 1VQNZ 1X3WA 1WCMI 1VQ5Z 3S15I 1YIJZ 1K731 1VQMZ 3CCQZ 3S1MI 3NH5A 1VQOZ 2QEXZ 2IZ3A 2P28A 2RPRA 2YADA 3H3VJ 1LQLA 1Y8CA 1TWHI 3TE5B 2RIQA 3CPWY 1Y1VI 1YJN1 3EERA 3I07A 4BBSI 3CME1 3CCL1 4A3LI 2JR6A 1VQ4Z 1VQL1 2VUGA 4EWCA 5C4XI 1I6HI 3RZOI 1W2BY 3CC21 4NBGA 2JIPA 4A3BI 2V8KA 1TWAI 1TWCI 1Q812 1Q811 4A3MI 1ML8A 3OW2Z 5IP7I 4A3JI 3MZKB 3EEDA 2JA7I 5IT9b 3CCU1 2IZ4A 3D6WA 5C44I 1S7MA 1N8R2 1N8R1 5FLMI 3GCFA 2JIQA 3CMEZ 3I4MI 3NH4A 4NB9A 2R7ZI 1YI21 1VLAA 2O53A 3I55Z 1VQLZ 4RV9A 5AN9F 1Y1WI 2JA8I 2OTLZ 4MD8A 3S1RI 3BG1B 1M1K2 3CCRZ 1M1K1 1VQN1 2E2JI 1TFIA 1VQ51 3CCM1 1KC81 1VQM1 1SFOI 3IR7A 3CCQ1 4E2XA 3NDIA 1VQO1 2QEX1 1YITZ 3BG0B 4NBDA 4NFRA 2PM9A 2RT9A 3J80f 3S1NI 4RVFA 4NB8A 5IT9f 3CCV1 1VQPZ 5C4JI 2OZKA 3CCSZ 1RO4A 3QWUA 3FQMA 1VQ6Z 2K3RA 3U50C 1WIIA 2V45A 4CL1A 4MD9A 4E32A 1VQ41 1Z03A 1YJWZ 2QKDA 3IF8A 3MZLB 3KIHA 1QF8A 4E31A 3CCMZ 1WW9A 1K732 1KD12 4HGZA 1KD11 4RVDA 4RS4A 4NOZA 4A3KI 2AYDA 1I50I 2V8JA 2QR1B 3D2LA 2E2II 3CCJZ 1QYPA 1JJ2Z 2NVQI 3RZDI 2QA4Z 3MONA 4DQYB 5D1PA 2VPXA 4Y7NI 3CCVZ 1DL6A 1S72Z 2AKLA 2JNYA 2VPYA 5D1OA 2VUMI 2E7ZA 3GTMS 3PO2I 5A2Qb 2G2KA 1Z02A 2LFUA 4E30A 4RVHA 4A3DI 2RHBA 3I551 2JA5I 2QLVB 2OTL1 2LEXA 1FDIA 2JIMA 2VPZA 4E2YA 3FKII 3D9XA 3PO3S 3CCR1 4BY7I 1VQ9Z 3I56Z 2NAPA 1NP6A 2WB1A 5LL6f 3G6EZ 2BJOA 1Q862 2IV2X 3J80b 4S1TA 1Q861 3NH8A 3FQQA 1ZH1A 1X0TA 2OOYB 4MH4A 5C3EI 1PFTA 3HOUI 4X6AI 1YIT1 1QVFZ 1JJ2Y 2R93I 4A3GI 1VQP1 1RNIA 1SIWA 3CCS1 1VQ61 2V8IA 2PK7A 2ZAEB 3J7A4 5A2Qf 4A3FI 1VQKZ 1ZB8A 2VF1A 1QXFA 3KIFA 3CD6Z 3P5JB 1YJW1 1Q16A 3IFUA 4BY1I 1YUAA 1KC82 4MONA 3HOVI 4Y52I 3S17I 2E2HI 1Y1VS 5D1OB 2I3CA 3CC4Z 5CM2M 3Q87A 3VMHA 3CCJ1 2M48A 3GTKI 2JA6I 2QA41 1Q7Y2 2M6NA 3GKQA 2R92I 1Q7Y1 1USPA 3VB9A 4HGYA 1S721 1M902 1M901 3HOZI 1K83I 2Q51A 1QVFY 3HOYI 3J81f 3K7AI 4E2WA 3T4NB 2QREB 4HH4A 2OTJZ 3GTLI 3PO3I 5T67A 3VTNA 2WAQA 2H85A 3CMAZ 4MRIA 2GTHA 4NBCA 2OOXB 2JMOA
chains in the Genus database with same CATH topology
4NBHA 2P3YA 1VQ91 4NBBA 3CXCZ 3I561 3S1QI 3GTGI 5T6BA 3G6E1 1KRLA 3G71Z 1RLYA 1NUIA 4NBAA 1QVGY 3M4OI 2F4OA 2J6AA 1YHQZ 3NDJA 3S2HI 2NVYI 1TWFI 2YU9I 4NH1C 3CCE1 3S16I 2F4MA 1TWGI 5FLXb 3JAMf 4QTTA 1I3QI 2JUBA 1VQ7Z 4QTUA 1VQK1 2O4HA 2R6MA 3CD61 2RBLA 3VMGA 2NVTI 4RVGA 4NBEA 1USPB 1K9M2 4A3EI 3CC7Z 1YJ91 1K9M1 3S14I 1R9TI 1K8A2 1L1OC 4NBFA 1K8A1 4E2ZA 3CC41 3CXCY 4A3CI 1KQSZ 2KPIA 2B63I 2GTIA 2HF1A 3G4S1 3J81b 2HU9A 1Q822 2W04A 2Y0SA 1Q821 2W03A 2LIYA 2PMZA 3CCEZ 3HOWI 5IP9I 4TNUA 2GU2A 2OTJ1 1YJNZ 3HKZA 5FLXf 4BXXI 3CCLZ 1YJ9Z 3M3YI 2KI7B 3CMA1 1VQ81 3GTOI 4E33A 2DE6A 1P9NA 4MD7A 3TDHB 4XX2A 3VMIA 3NFZA 2E9HA 1RQFA 4MXUA 1QVGZ 3H0GI 3CC2Z 3G711 3GTMI 3G4SZ 3I4NI 3F3FC 2QRDB 4AYBA 2DE5A 2EGTA 3LUSA 1ZB9A 1RO2A 4A3II 2DE7A 1KQSY 2QRCB 1YIJ1 2Q4ZA 4DGLA 1YHQ1 3JAMb 3CCUZ 1JWHC 3OW2Y 4BBRI 3GTJI 3CPWZ 1YUKA 3S2DI 4DK1A 1NJI2 3GTQI 1N2FA 3CQZI 1NJI1 1VQ8Z 3HOXI 1YI2Z 1VQ71 3GTPI 2JS4A 3IX0A 1W2BZ 3F3PC 3ESWA 3CC71 5T64A 2K5RA 1RO0A 1Z01A 2NVXI 1X3ZA 4A93I 1VQNZ 1X3WA 1WCMI 1VQ5Z 3S15I 1YIJZ 1K731 1VQMZ 3CCQZ 3S1MI 3NH5A 1VQOZ 2QEXZ 2IZ3A 2P28A 2RPRA 2YADA 3H3VJ 1LQLA 1TWHI 3TE5B 2RIQA 3CPWY 1Y1VI 1YJN1 3EERA 3I07A 4BBSI 3CME1 3CCL1 4A3LI 2JR6A 1VQ4Z 1VQL1 2VUGA 4EWCA 5C4XI 1I6HI 3RZOI 1W2BY 3CC21 4NBGA 4A3BI 2V8KA 1TWAI 1TWCI 1Q812 1Q811 4A3MI 1ML8A 3OW2Z 5IP7I 4A3JI 3MZKB 3EEDA 2JA7I 5IT9b 3CCU1 2IZ4A 3D6WA 5C44I 1S7MA 1N8R2 1N8R1 5FLMI 3GCFA 3CMEZ 3I4MI 3NH4A 4NB9A 2R7ZI 1YI21 1VLAA 2O53A 3I55Z 1VQLZ 4RV9A 5AN9F 1Y1WI 2JA8I 2OTLZ 4MD8A 3S1RI 3BG1B 1M1K2 3CCRZ 1M1K1 1VQN1 2E2JI 1TFIA 1VQ51 3CCM1 1KC81 1VQM1 1SFOI 3CCQ1 4E2XA 3NDIA 1VQO1 2QEX1 1YITZ 3BG0B 4NBDA 4NFRA 2PM9A 2RT9A 3J80f 3S1NI 4RVFA 4NB8A 5IT9f 3CCV1 1VQPZ 5C4JI 2OZKA 3CCSZ 1RO4A 3QWUA 3FQMA 1VQ6Z 2K3RA 3U50C 1WIIA 4CL1A 4MD9A 4E32A 1VQ41 1Z03A 1YJWZ 2QKDA 3IF8A 3MZLB 3KIHA 1QF8A 4E31A 3CCMZ 1WW9A 1K732 1KD12 4HGZA 1KD11 4RVDA 4RS4A 4NOZA 4A3KI 1I50I 2V8JA 2QR1B 2E2II 3CCJZ 1QYPA 1JJ2Z 2NVQI 3RZDI 2QA4Z 3MONA 4DQYB 5D1PA 3CCVZ 4Y7NI 1DL6A 1S72Z 2AKLA 2JNYA 5D1OA 2VUMI 3GTMS 3PO2I 5A2Qb 2G2KA 1Z02A 2LFUA 4E30A 4RVHA 4A3DI 2RHBA 3I551 2JA5I 2QLVB 2OTL1 4E2YA 3FKII 3D9XA 3PO3S 3CCR1 4BY7I 1VQ9Z 3I56Z 1NP6A 2WB1A 5LL6f 3G6EZ 2BJOA 1Q862 3J80b 4S1TA 1Q861 3NH8A 3FQQA 1ZH1A 1X0TA 2OOYB 4MH4A 5C3EI 1PFTA 3HOUI 4X6AI 1YIT1 1QVFZ 1JJ2Y 2R93I 4A3GI 1VQP1 1RNIA 3CCS1 1VQ61 2V8IA 2PK7A 2ZAEB 3J7A4 5A2Qf 4A3FI 1VQKZ 1ZB8A 2VF1A 3KIFA 3CD6Z 3P5JB 1YJW1 3IFUA 4BY1I 1YUAA 1KC82 4MONA 3HOVI 4Y52I 3S17I 2E2HI 1Y1VS 5D1OB 2I3CA 3CC4Z 5CM2M 3Q87A 3VMHA 3CCJ1 2M48A 3GTKI 2JA6I 2QA41 1Q7Y2 2M6NA 3GKQA 2R92I 1Q7Y1 1USPA 3VB9A 4HGYA 1S721 1M902 1M901 3HOZI 1K83I 2Q51A 1QVFY 3HOYI 3J81f 3K7AI 4E2WA 3T4NB 2QREB 4HH4A 2OTJZ 3GTLI 3PO3I 5T67A 3VTNA 2WAQA 2H85A 3CMAZ 4MRIA 2GTHA 4NBCA 2OOXB 2JMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB9 A;  4A3I I;  4NBH A;  4A3D I;  2P3Y A;  2DE7 A;  3D6W A;  4NBB A;  2JA5 I;  3S1Q I;  5C44 I;  3GTG I;  5FLM I;  3GCF A;  3I4M I;  4NB9 A;  2R7Z I;  3FKI I;  1VLA A;  1RLY A;  4BBR I;  3GTJ I;  3PO3 S;  4BY7 I;  1NUI A;  4NBA A;  3M4O I;  2F4O A;  2J6A A;  1Y1W I;  2JA8 I;  3S2D I;  2BJO A;  3GTQ I;  1N2F A;  3CQZ I;  3S2H I;  3HOX I;  3S1R I;  2NVY I;  1TWF I;  4MH4 A;  5C3E I;  2E2J I;  1PFT A;  1TFI A;  2YU9 I;  3GTP I;  3HOU I;  4X6A I;  2JS4 A;  2R93 I;  3S16 I;  2F4M A;  1TWG I;  3ESW A;  4A3G I;  4QTT A;  1I3Q I;  2K5R A;  2NVX I;  1X3Z A;  4QTU A;  1SFO I;  4A93 I;  1X3W A;  1WCM I;  2RBL A;  3S15 I;  3VMG A;  2PK7 A;  2NVT I;  4NBE A;  4NBD A;  1USP B;  4A3E I;  3S1N I;  4A3F I;  3S14 I;  1R9T I;  4NB8 A;  1L1O C;  4NBF A;  5C4J I;  1ZB8 A;  1RO4 A;  3S1M I;  4A3C I;  2KPI A;  4BY1 I;  3U50 C;  1YUA A;  3H3V J;  1LQL A;  2HF1 A;  1TWH I;  3HOV I;  4Y52 I;  3S17 I;  2E2H I;  1Y1V S;  1Y1V I;  5CM2 M;  3Q87 A;  3EER A;  3VMH A;  3I07 A;  3GTK I;  4BBS I;  2JA6 I;  1WW9 A;  3GKQ A;  2R92 I;  3HOW I;  5IP9 I;  1USP A;  3VB9 A;  4A3L I;  2JR6 A;  4NOZ A;  4A3K I;  1I50 I;  2E2I I;  5C4X I;  1I6H I;  3HOZ I;  3RZO I;  1K83 I;  1QYP A;  2NVQ I;  3RZD I;  3HOY I;  4BXX I;  4NBG A;  3K7A I;  3M3Y I;  4A3B I;  1TWA I;  1TWC I;  3GTO I;  4A3M I;  4Y7N I;  2DE6 A;  1ML8 A;  5IP7 I;  4A3J I;  3VMI A;  4XX2 A;  1DL6 A;  3GTL I;  2AKL A;  2JNY A;  3PO3 I;  2VUM I;  2JA7 I;  3H0G I;  3GTM S;  3PO2 I;  4NBC A;  3GTM I;  3I4N I;  2B63 I;  2DE5 A;  3LUS A; 
#chains in the Genus database with same CATH topology
 4NBH A;  2P3Y A;  1VQ9 1;  4NBB A;  3CXC Z;  3I56 1;  3S1Q I;  3GTG I;  5T6B A;  3G6E 1;  1KRL A;  3G71 Z;  1RLY A;  1NUI A;  4NBA A;  1QVG Y;  3M4O I;  2F4O A;  2J6A A;  1YHQ Z;  3NDJ A;  3S2H I;  2NVY I;  1TWF I;  2YU9 I;  4NH1 C;  3CCE 1;  3S16 I;  2F4M A;  1TWG I;  5FLX b;  3JAM f;  4QTT A;  1I3Q I;  2JUB A;  1VQ7 Z;  4QTU A;  1VQK 1;  2O4H A;  1AA6 A;  2R6M A;  3CD6 1;  2RBL A;  3VMG A;  2NVT I;  4RVG A;  4NBE A;  1USP B;  1K9M 2;  4A3E I;  3CC7 Z;  1YJ9 1;  1K9M 1;  1FDO A;  3S14 I;  1R9T I;  1K8A 2;  1L1O C;  4NBF A;  2V3V A;  1K8A 1;  4E2Z A;  3CC4 1;  3CXC Y;  4A3C I;  1KQS Z;  2KPI A;  2B63 I;  2GTI A;  2HF1 A;  2VPW A;  3G4S 1;  3J81 b;  2HU9 A;  1Q82 2;  2W04 A;  2Y0S A;  1Q82 1;  2W03 A;  2LIY A;  1WJ2 A;  2PMZ A;  3CCE Z;  3HOW I;  5IP9 I;  4TNU A;  2GU2 A;  2OTJ 1;  1YJN Z;  3HKZ A;  5FLX f;  4BXX I;  3CCL Z;  1YJ9 Z;  3M3Y I;  2KI7 B;  3CMA 1;  1VQ8 1;  3GTO I;  4E33 A;  2DE6 A;  1P9N A;  4MD7 A;  3TDH B;  4XX2 A;  3VMI A;  3NFZ A;  2E9H A;  1RQF A;  4MXU A;  1QVG Z;  3H0G I;  3CC2 Z;  3G71 1;  3GTM I;  3G4S Z;  3I4N I;  3F3F C;  2QRD B;  4AYB A;  2DE5 A;  2EGT A;  3LUS A;  1WZN A;  1ZB9 A;  1RO2 A;  4A3I I;  2DE7 A;  1KQS Y;  2QRC B;  1YIJ 1;  2JIO A;  2Q4Z A;  4DGL A;  1YHQ 1;  3JAM b;  3CCU Z;  1JWH C;  3OW2 Y;  4BBR I;  3GTJ I;  3CPW Z;  1YUK A;  3S2D I;  4DK1 A;  1NJI 2;  2JIR A;  3GTQ I;  1N2F A;  3CQZ I;  1NJI 1;  1VQ8 Z;  3HOX I;  1YI2 Z;  1VQ7 1;  3GTP I;  2JS4 A;  3IX0 A;  1W2B Z;  3F3P C;  3ESW A;  3CC7 1;  5T64 A;  2K5R A;  1RO0 A;  1Z01 A;  2NVX I;  1X3Z A;  4A93 I;  1VQN Z;  1X3W A;  1WCM I;  1VQ5 Z;  3S15 I;  1YIJ Z;  1K73 1;  1VQM Z;  3CCQ Z;  3S1M I;  3NH5 A;  1VQO Z;  2QEX Z;  2IZ3 A;  2P28 A;  2RPR A;  2YAD A;  3H3V J;  1LQL A;  1Y8C A;  1TWH I;  3TE5 B;  2RIQ A;  3CPW Y;  1Y1V I;  1YJN 1;  3EER A;  3I07 A;  4BBS I;  3CME 1;  3CCL 1;  4A3L I;  2JR6 A;  1VQ4 Z;  1VQL 1;  2VUG A;  4EWC A;  5C4X I;  1I6H I;  3RZO I;  1W2B Y;  3CC2 1;  4NBG A;  2JIP A;  4A3B I;  2V8K A;  1TWA I;  1TWC I;  1Q81 2;  1Q81 1;  4A3M I;  1ML8 A;  3OW2 Z;  5IP7 I;  4A3J I;  3MZK B;  3EED A;  2JA7 I;  5IT9 b;  3CCU 1;  2IZ4 A;  3D6W A;  5C44 I;  1S7M A;  1N8R 2;  1N8R 1;  5FLM I;  3GCF A;  2JIQ A;  3CME Z;  3I4M I;  3NH4 A;  4NB9 A;  2R7Z I;  1YI2 1;  1VLA A;  2O53 A;  3I55 Z;  1VQL Z;  4RV9 A;  5AN9 F;  1Y1W I;  2JA8 I;  2OTL Z;  4MD8 A;  3S1R I;  3BG1 B;  1M1K 2;  3CCR Z;  1M1K 1;  1VQN 1;  2E2J I;  1TFI A;  1VQ5 1;  3CCM 1;  1KC8 1;  1VQM 1;  1SFO I;  3IR7 A;  3CCQ 1;  4E2X A;  3NDI A;  1VQO 1;  2QEX 1;  1YIT Z;  3BG0 B;  4NBD A;  4NFR A;  2PM9 A;  2RT9 A;  3J80 f;  3S1N I;  4RVF A;  4NB8 A;  5IT9 f;  3CCV 1;  1VQP Z;  5C4J I;  2OZK A;  3CCS Z;  1RO4 A;  3QWU A;  3FQM A;  1VQ6 Z;  2K3R A;  3U50 C;  1WII A;  2V45 A;  4CL1 A;  4MD9 A;  4E32 A;  1VQ4 1;  1Z03 A;  1YJW Z;  2QKD A;  3IF8 A;  3MZL B;  3KIH A;  1QF8 A;  4E31 A;  3CCM Z;  1WW9 A;  1K73 2;  1KD1 2;  4HGZ A;  1KD1 1;  4RVD A;  4RS4 A;  4NOZ A;  4A3K I;  2AYD A;  1I50 I;  2V8J A;  2QR1 B;  3D2L A;  2E2I I;  3CCJ Z;  1QYP A;  1JJ2 Z;  2NVQ I;  3RZD I;  2QA4 Z;  3MON A;  4DQY B;  5D1P A;  2VPX A;  4Y7N I;  3CCV Z;  1DL6 A;  1S72 Z;  2AKL A;  2JNY A;  2VPY A;  5D1O A;  2VUM I;  2E7Z A;  3GTM S;  3PO2 I;  5A2Q b;  2G2K A;  1Z02 A;  2LFU A;  4E30 A;  4RVH A;  4A3D I;  2RHB A;  3I55 1;  2JA5 I;  2QLV B;  2OTL 1;  2LEX A;  1FDI A;  2JIM A;  2VPZ A;  4E2Y A;  3FKI I;  3D9X A;  3PO3 S;  3CCR 1;  4BY7 I;  1VQ9 Z;  3I56 Z;  2NAP A;  1NP6 A;  2WB1 A;  5LL6 f;  3G6E Z;  2BJO A;  1Q86 2;  2IV2 X;  3J80 b;  4S1T A;  1Q86 1;  3NH8 A;  3FQQ A;  1ZH1 A;  1X0T A;  2OOY B;  4MH4 A;  5C3E I;  1PFT A;  3HOU I;  4X6A I;  1YIT 1;  1QVF Z;  1JJ2 Y;  2R93 I;  4A3G I;  1VQP 1;  1RNI A;  1SIW A;  3CCS 1;  1VQ6 1;  2V8I A;  2PK7 A;  2ZAE B;  3J7A 4;  5A2Q f;  4A3F I;  1VQK Z;  1ZB8 A;  2VF1 A;  1QXF A;  3KIF A;  3CD6 Z;  3P5J B;  1YJW 1;  1Q16 A;  3IFU A;  4BY1 I;  1YUA A;  1KC8 2;  4MON A;  3HOV I;  4Y52 I;  3S17 I;  2E2H I;  1Y1V S;  5D1O B;  2I3C A;  3CC4 Z;  5CM2 M;  3Q87 A;  3VMH A;  3CCJ 1;  2M48 A;  3GTK I;  2JA6 I;  2QA4 1;  1Q7Y 2;  2M6N A;  3GKQ A;  2R92 I;  1Q7Y 1;  1USP A;  3VB9 A;  4HGY A;  1S72 1;  1M90 2;  1M90 1;  3HOZ I;  1K83 I;  2Q51 A;  1QVF Y;  3HOY I;  3J81 f;  3K7A I;  4E2W A;  3T4N B;  2QRE B;  4HH4 A;  2OTJ Z;  3GTL I;  3PO3 I;  5T67 A;  3VTN A;  2WAQ A;  2H85 A;  3CMA Z;  4MRI A;  2GTH A;  4NBC A;  2OOX B;  2JMO A; 
#chains in the Genus database with same CATH homology
 4NBH A;  2P3Y A;  1VQ9 1;  4NBB A;  3CXC Z;  3I56 1;  3S1Q I;  3GTG I;  5T6B A;  3G6E 1;  1KRL A;  3G71 Z;  1RLY A;  1NUI A;  4NBA A;  1QVG Y;  3M4O I;  2F4O A;  2J6A A;  1YHQ Z;  3NDJ A;  3S2H I;  2NVY I;  1TWF I;  2YU9 I;  4NH1 C;  3CCE 1;  3S16 I;  2F4M A;  1TWG I;  5FLX b;  3JAM f;  4QTT A;  1I3Q I;  2JUB A;  1VQ7 Z;  4QTU A;  1VQK 1;  2O4H A;  2R6M A;  3CD6 1;  2RBL A;  3VMG A;  2NVT I;  4RVG A;  4NBE A;  1USP B;  1K9M 2;  4A3E I;  3CC7 Z;  1YJ9 1;  1K9M 1;  3S14 I;  1R9T I;  1K8A 2;  1L1O C;  4NBF A;  1K8A 1;  4E2Z A;  3CC4 1;  3CXC Y;  4A3C I;  1KQS Z;  2KPI A;  2B63 I;  2GTI A;  2HF1 A;  3G4S 1;  3J81 b;  2HU9 A;  1Q82 2;  2W04 A;  2Y0S A;  1Q82 1;  2W03 A;  2LIY A;  2PMZ A;  3CCE Z;  3HOW I;  5IP9 I;  4TNU A;  2GU2 A;  2OTJ 1;  1YJN Z;  3HKZ A;  5FLX f;  4BXX I;  3CCL Z;  1YJ9 Z;  3M3Y I;  2KI7 B;  3CMA 1;  1VQ8 1;  3GTO I;  4E33 A;  2DE6 A;  1P9N A;  4MD7 A;  3TDH B;  4XX2 A;  3VMI A;  3NFZ A;  2E9H A;  1RQF A;  4MXU A;  1QVG Z;  3H0G I;  3CC2 Z;  3G71 1;  3GTM I;  3G4S Z;  3I4N I;  3F3F C;  2QRD B;  4AYB A;  2DE5 A;  2EGT A;  3LUS A;  1ZB9 A;  1RO2 A;  4A3I I;  2DE7 A;  1KQS Y;  2QRC B;  1YIJ 1;  2Q4Z A;  4DGL A;  1YHQ 1;  3JAM b;  3CCU Z;  1JWH C;  3OW2 Y;  4BBR I;  3GTJ I;  3CPW Z;  1YUK A;  3S2D I;  4DK1 A;  1NJI 2;  3GTQ I;  1N2F A;  3CQZ I;  1NJI 1;  1VQ8 Z;  3HOX I;  1YI2 Z;  1VQ7 1;  3GTP I;  2JS4 A;  3IX0 A;  1W2B Z;  3F3P C;  3ESW A;  3CC7 1;  5T64 A;  2K5R A;  1RO0 A;  1Z01 A;  2NVX I;  1X3Z A;  4A93 I;  1VQN Z;  1X3W A;  1WCM I;  1VQ5 Z;  3S15 I;  1YIJ Z;  1K73 1;  1VQM Z;  3CCQ Z;  3S1M I;  3NH5 A;  1VQO Z;  2QEX Z;  2IZ3 A;  2P28 A;  2RPR A;  2YAD A;  3H3V J;  1LQL A;  1TWH I;  3TE5 B;  2RIQ A;  3CPW Y;  1Y1V I;  1YJN 1;  3EER A;  3I07 A;  4BBS I;  3CME 1;  3CCL 1;  4A3L I;  2JR6 A;  1VQ4 Z;  1VQL 1;  2VUG A;  4EWC A;  5C4X I;  1I6H I;  3RZO I;  1W2B Y;  3CC2 1;  4NBG A;  4A3B I;  2V8K A;  1TWA I;  1TWC I;  1Q81 2;  1Q81 1;  4A3M I;  1ML8 A;  3OW2 Z;  5IP7 I;  4A3J I;  3MZK B;  3EED A;  2JA7 I;  5IT9 b;  3CCU 1;  2IZ4 A;  3D6W A;  5C44 I;  1S7M A;  1N8R 2;  1N8R 1;  5FLM I;  3GCF A;  3CME Z;  3I4M I;  3NH4 A;  4NB9 A;  2R7Z I;  1YI2 1;  1VLA A;  2O53 A;  3I55 Z;  1VQL Z;  4RV9 A;  5AN9 F;  1Y1W I;  2JA8 I;  2OTL Z;  4MD8 A;  3S1R I;  3BG1 B;  1M1K 2;  3CCR Z;  1M1K 1;  1VQN 1;  2E2J I;  1TFI A;  1VQ5 1;  3CCM 1;  1KC8 1;  1VQM 1;  1SFO I;  3CCQ 1;  4E2X A;  3NDI A;  1VQO 1;  2QEX 1;  1YIT Z;  3BG0 B;  4NBD A;  4NFR A;  2PM9 A;  2RT9 A;  3J80 f;  3S1N I;  4RVF A;  4NB8 A;  5IT9 f;  3CCV 1;  1VQP Z;  5C4J I;  2OZK A;  3CCS Z;  1RO4 A;  3QWU A;  3FQM A;  1VQ6 Z;  2K3R A;  3U50 C;  1WII A;  4CL1 A;  4MD9 A;  4E32 A;  1VQ4 1;  1Z03 A;  1YJW Z;  2QKD A;  3IF8 A;  3MZL B;  3KIH A;  1QF8 A;  4E31 A;  3CCM Z;  1WW9 A;  1K73 2;  1KD1 2;  4HGZ A;  1KD1 1;  4RVD A;  4RS4 A;  4NOZ A;  4A3K I;  1I50 I;  2V8J A;  2QR1 B;  2E2I I;  3CCJ Z;  1QYP A;  1JJ2 Z;  2NVQ I;  3RZD I;  2QA4 Z;  3MON A;  4DQY B;  5D1P A;  3CCV Z;  4Y7N I;  1DL6 A;  1S72 Z;  2AKL A;  2JNY A;  5D1O A;  2VUM I;  3GTM S;  3PO2 I;  5A2Q b;  2G2K A;  1Z02 A;  2LFU A;  4E30 A;  4RVH A;  4A3D I;  2RHB A;  3I55 1;  2JA5 I;  2QLV B;  2OTL 1;  4E2Y A;  3FKI I;  3D9X A;  3PO3 S;  3CCR 1;  4BY7 I;  1VQ9 Z;  3I56 Z;  1NP6 A;  2WB1 A;  5LL6 f;  3G6E Z;  2BJO A;  1Q86 2;  3J80 b;  4S1T A;  1Q86 1;  3NH8 A;  3FQQ A;  1ZH1 A;  1X0T A;  2OOY B;  4MH4 A;  5C3E I;  1PFT A;  3HOU I;  4X6A I;  1YIT 1;  1QVF Z;  1JJ2 Y;  2R93 I;  4A3G I;  1VQP 1;  1RNI A;  3CCS 1;  1VQ6 1;  2V8I A;  2PK7 A;  2ZAE B;  3J7A 4;  5A2Q f;  4A3F I;  1VQK Z;  1ZB8 A;  2VF1 A;  3KIF A;  3CD6 Z;  3P5J B;  1YJW 1;  3IFU A;  4BY1 I;  1YUA A;  1KC8 2;  4MON A;  3HOV I;  4Y52 I;  3S17 I;  2E2H I;  1Y1V S;  5D1O B;  2I3C A;  3CC4 Z;  5CM2 M;  3Q87 A;  3VMH A;  3CCJ 1;  2M48 A;  3GTK I;  2JA6 I;  2QA4 1;  1Q7Y 2;  2M6N A;  3GKQ A;  2R92 I;  1Q7Y 1;  1USP A;  3VB9 A;  4HGY A;  1S72 1;  1M90 2;  1M90 1;  3HOZ I;  1K83 I;  2Q51 A;  1QVF Y;  3HOY I;  3J81 f;  3K7A I;  4E2W A;  3T4N B;  2QRE B;  4HH4 A;  2OTJ Z;  3GTL I;  3PO3 I;  5T67 A;  3VTN A;  2WAQ A;  2H85 A;  3CMA Z;  4MRI A;  2GTH A;  4NBC A;  2OOX B;  2JMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...