4Y52I

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I02
4BXXI 2NVTI 4NBHA 2DE5A 3K7AI 4A3JI 4QTUA 4NBBA 2VUMI 2DE6A 3S15I 1Y1WI 2JS4A 2E2II 4NB8A 4BY7I 1TWFI 2J6AA 2K5RA 1USPB 3PO3S 4A93I 1TWGI 1I6HI 5C3EI 2JA5I 2PK7A 2P3YA 2R7ZI 1I3QI 3HOWI 2E2JI 2AKLA 1TWAI 3S1NI 3HOVI 4A3MI 1TFIA 1TWHI 1R9TI 4A3BI 1K83I 3HOZI 2DE7A 3I4MI 3M4OI 4A3II 1X3ZA 1Y1VS 2NVXI 3I4NI 2JA6I 4BY1I 3GTPI 3GTOI 2JA8I 1ZB9A 2NVYI 3S2HI 1N2FA 2JR6A 4Y7NI 3HOUI 3PO2I 3HOXI 4NBGA 4NBDA 1RO4A 1NUIA 1PFTA 1WCMI 3S1MI 2NVQI 3GTGI 4A3EI 3U50C 4X6AI 3CQZI 2HF1A 1ZB8A 2YU9I 3GTLI 1SFOI 2F4MA 3GTMS 3VB9A 1I50I 4MH4A 2R92I 3GTKI 1QYPA 4BBSI 3LUSA 3RZOI 3RZDI 3M3YI 2JA7I 1X3WA 3PO3I 3H3VJ 1WW9A 4NBAA 1RLYA 2F4OA 2JNYA 4NBCA 3VMIA 1DL6A 3S1RI 3GCFA 3D6WA 3S17I 3GKQA 3I07A 4NBEA 5FLMI 4XX2A 5C4JI 3S2DI 1TWCI 1Y1VI 2KPIA 2R93I 4BBRI 3EERA 4A3KI 4A3DI 1VLAA 3HOYI 5CM2M 4A3CI 4Y52I 4A3GI 4A3FI 2B63I 1LQLA 1L1OC 3S1QI 1ML8A 3VMGA 5C44I 5IP7I 2BJOA 3H0GI 4NOZA 3Q87A 3S14I 1USPA 3S16I 3FKII 3VMHA 1YUAA 5IP9I 3GTJI 4QTTA 5C4XI 3GTMI 3GTQI 4NB9A 4A3LI 4NBFA 2E2HI 3ESWA 2RBLA
chains in the Genus database with same CATH superfamily
1VQN1 2WB1A 4A3JI 3MONA 3T4NB 2JS4A 4NB8A 2V8JA 1JWHC 2VPYA 2JIMA 2K5RA 1USPB 2OZKA 3PO3S 4A93I 3CCL1 1S72Z 3CME1 3CC2Z 2R7ZI 3IF8A 1I3QI 3HOWI 2E2JI 3BG1B 2YADA 2Q51A 2PM9A 1JJ2Y 2O53A 1QVGY 3J81b 1TWHI 4A3BI 1K83I 2DE7A 3I4MI 3M4OI 1X3ZA 2EGTA 3MZLB 4BY1I 1FDOA 3GTOI 3I551 1K731 3G6EZ 3S2HI 3IX0A 2JR6A 1VQ9Z 1ZH1A 4NBGA 1PFTA 2NVQI 1KC81 1ZB8A 2YU9I 3J7A4 3GTLI 1NP6A 2E7ZA 1SFOI 3GTMS 2IV2X 3VB9A 1I50I 2W04A 2R92I 1YJ91 3D2LA 2WAQA 4MONA 3RZOI 1KC82 2IZ4A 1YJN1 1X3WA 3PO3I 1VQ51 1RLYA 2JNYA 2QLVB 3D6WA 2QKDA 2QR1B 5FLMI 3CCUZ 4RV9A 1FDIA 1YHQ1 1K9M1 4AYBA 1M901 3CPWZ 5C4JI 3S2DI 1TWCI 3D9XA 2R93I 2QA41 1S7MA 4A3KI 2KI7B 3CCM1 1VQ6Z 5AN9F 4DQYB 4DK1A 2B63I 1VQMZ 1LQLA 2AYDA 4MD8A 1K9M2 3S1QI 3VMGA 5C44I 2GTIA 3H0GI 3Q87A 3S16I 1RO0A 3CCV1 5IP9I 4QTTA 3GTMI 2K3RA 2OTJZ 1Q821 4NBBA 2VUMI 2V8KA 2DE6A 5IT9b 2M48A 1VQPZ 4TNUA 2R6MA 3JAMf 1VQ81 2IZ3A 2VPWA 5FLXb 2QEX1 1S721 4HGZA 4MXUA 1RNIA 3CC21 2JIRA 2AKLA 3CCSZ 1TFIA 3CD6Z 1VQLZ 1R9TI 3HOZI 4RVDA 4A3II 2RT9A 1NJI1 3EEDA 2JA8I 1JJ2Z 2LIYA 4RS4A 1QVFY 5D1PA 3G6E1 1N2FA 1Z01A 4Y7NI 4NBDA 3J80f 1Q16A 1RO4A 1Q862 1WCMI 3S1MI 3U50C 1NJI2 2HF1A 3KIHA 2LEXA 1Z02A 4RVFA 4RVGA 2GU2A 3F3FC 2QRDB 2JIOA 3NFZA 3CC41 3CMAZ 4NH1C 2OTL1 1SIWA 1WW9A 2G2KA 2F4OA 4NBCA 3VMIA 1DL6A 3BG0B 2RIQA 3I07A 3I561 4RVHA 3G71Z 2V45A 2GTHA 1YITZ 4XX2A 5A2Qb 4E31A 2KPIA 3CC71 1Q811 4BBRI 2JIPA 4A3DI 3CCQ1 5T67A 1P9NA 1YJW1 4Y52I 2I3CA 3NH8A 1YI21 3J81f 1VQM1 1L1OC 4E2XA 5IP7I 1KQSZ 3CCLZ 1Q812 3CMEZ 3S14I 3CCJ1 1YUAA 2Q4ZA 2E2HI 4E32A 4BXXI 3CXCY 2NVTI 1VQ41 4NBHA 2DE5A 3K7AI 2RPRA 3CCR1 3I55Z 3S15I 1Y1WI 1QF8A 1VQP1 1TWFI 2J6AA 1TWGI 1I6HI 2M6NA 5C3EI 2JA5I 2P3YA 2VF1A 3FQMA 1QXFA 3S1NI 1KRLA 4A3MI 1VQOZ 3CD61 1YJ9Z 1Y8CA 2HU9A 2NVXI 3I4NI 1ZB9A 4NFRA 1W2BZ 2JIQA 3HOUI 4EWCA 3HOXI 1NUIA 3VTNA 1YHQZ 5T64A 3GTGI 4E2WA 4A3EI 4X6AI 3G4SZ 2QA4Z 1QVFZ 2F4MA 3CCMZ 1Q7Y1 4MH4A 3J80b 1VQKZ 4BBSI 1YIJZ 3LUSA 1VQ7Z 1Q861 2JA7I 1AA6A 3H3VJ 1K8A2 1QVGZ 1WIIA 1Q7Y2 5IT9f 3KIFA 2O4HA 3GKQA 1VQ91 3S17I 3CCVZ 1X0TA 3NDIA 4NBEA 3NDJA 1KD12 1YIT1 2ZAEB 3IFUA 3EERA 5FLXf 1M1K1 5CM2M 3HOYI 2Y0SA 4E33A 3TE5B 4A3FI 3OW2Y 2JUBA 1VQ8Z 3QWUA 2QEXZ 2BJOA 3CCEZ 2V8IA 1M1K2 2VPXA 3FKII 2OOXB 3VMHA 3TDHB 5C4XI 3CCU1 3GTQI 4S1TA 4A3LI 3ESWA 2RBLA 3NH5A 1VQNZ 4QTUA 3IR7A 4MD7A 2H85A 1VQ61 2E2II 2E9HA 3HKZA 4BY7I 3CXCZ 1YUKA 4CL1A 2PK7A 2V3VA 1N8R1 2VUGA 1K732 1TWAI 3HOVI 4E30A 3F3PC 5D1OA 2OTJ1 1VQO1 1Y1VS 3CC4Z 2JA6I 3GTPI 2OTLZ 1N8R2 5A2Qf 2JMOA 4MD9A 2NVYI 4E2ZA 3PO2I 4HGYA 3I56Z 2W03A 3P5JB 2QRCB 5D1OB 4E2YA 1WJ2A 3CQZI 2OOYB 3CC7Z 1KQSY 3G4S1 3CCQZ 2LFUA 1YJWZ 3CCS1 3JAMb 1VQL1 3GTKI 1QYPA 1VQK1 3RZDI 1YI2Z 1YJNZ 3M3YI 1YIJ1 1VQ71 1VQ5Z 1M902 3CPWY 4NBAA 5T6BA 2NAPA 3S1RI 3CCJZ 3GCFA 1WZNA 5LL6f 4DGLA 2VPZA 1K8A1 1VQ4Z 1Y1VI 3CCRZ 1VLAA 4A3CI 3MZKB 4A3GI 4HH4A 4MRIA 1ML8A 1KD11 3CMA1 1Q822 2RHBA 2QREB 3NH4A 1RO2A 4NOZA 1Z03A 3CCE1 1RQFA 3OW2Z 3GTJI 2PMZA 4NB9A 4NBFA 2P28A 1USPA 3G711 1W2BY 3FQQA
chains in the Genus database with same CATH topology
1VQN1 2WB1A 4A3JI 3MONA 3T4NB 2JS4A 4NB8A 2V8JA 1JWHC 2K5RA 1USPB 2OZKA 3PO3S 4A93I 3CCL1 1S72Z 3CME1 3CC2Z 2R7ZI 3IF8A 1I3QI 3HOWI 2E2JI 3BG1B 2YADA 2Q51A 2PM9A 1JJ2Y 2O53A 1QVGY 3J81b 1TWHI 4A3BI 1K83I 2DE7A 3I4MI 3M4OI 1X3ZA 2EGTA 3MZLB 4BY1I 3GTOI 3I551 1K731 3G6EZ 3S2HI 3IX0A 2JR6A 1VQ9Z 1ZH1A 4NBGA 1PFTA 2NVQI 1KC81 1ZB8A 2YU9I 3J7A4 3GTLI 1NP6A 1SFOI 3GTMS 3VB9A 1I50I 2W04A 2R92I 1YJ91 2WAQA 4MONA 3RZOI 1KC82 2IZ4A 1YJN1 1X3WA 3PO3I 1VQ51 1RLYA 2JNYA 2QLVB 3D6WA 2QKDA 2QR1B 5FLMI 3CCUZ 4RV9A 1YHQ1 1K9M1 4AYBA 1M901 3CPWZ 5C4JI 3S2DI 1TWCI 3D9XA 2R93I 2QA41 1S7MA 4A3KI 2KI7B 3CCM1 1VQ6Z 5AN9F 4DQYB 4DK1A 2B63I 1VQMZ 1LQLA 4MD8A 1K9M2 3S1QI 3VMGA 5C44I 2GTIA 3H0GI 3Q87A 3S16I 1RO0A 3CCV1 5IP9I 4QTTA 3GTMI 2K3RA 2OTJZ 1Q821 4NBBA 2VUMI 2V8KA 2DE6A 5IT9b 2M48A 1VQPZ 4TNUA 2R6MA 3JAMf 1VQ81 2IZ3A 5FLXb 2QEX1 1S721 4HGZA 4MXUA 1RNIA 3CC21 2AKLA 3CCSZ 1TFIA 3CD6Z 1VQLZ 1R9TI 3HOZI 4RVDA 4A3II 2RT9A 1NJI1 3EEDA 2JA8I 1JJ2Z 2LIYA 4RS4A 1QVFY 5D1PA 3G6E1 1N2FA 1Z01A 4Y7NI 4NBDA 3J80f 1RO4A 1Q862 1WCMI 3S1MI 3U50C 1NJI2 2HF1A 3KIHA 1Z02A 4RVFA 4RVGA 2GU2A 3F3FC 2QRDB 3NFZA 3CC41 3CMAZ 4NH1C 2OTL1 1WW9A 2G2KA 2F4OA 4NBCA 3VMIA 1DL6A 3BG0B 2RIQA 3I07A 3I561 4RVHA 3G71Z 1YITZ 2GTHA 4XX2A 5A2Qb 4E31A 2KPIA 3CC71 1Q811 4BBRI 4A3DI 3CCQ1 5T67A 1P9NA 1YJW1 4Y52I 2I3CA 3NH8A 1YI21 3J81f 1VQM1 1L1OC 4E2XA 5IP7I 1KQSZ 3CCLZ 1Q812 3CMEZ 3S14I 3CCJ1 1YUAA 2Q4ZA 2E2HI 4E32A 4BXXI 3CXCY 2NVTI 1VQ41 4NBHA 2DE5A 3K7AI 2RPRA 3CCR1 3I55Z 3S15I 1Y1WI 1QF8A 1VQP1 1TWFI 2J6AA 1TWGI 1I6HI 2M6NA 5C3EI 2JA5I 2P3YA 2VF1A 3FQMA 3S1NI 1KRLA 4A3MI 1VQOZ 3CD61 1YJ9Z 2HU9A 2NVXI 3I4NI 1ZB9A 4NFRA 1W2BZ 3HOUI 4EWCA 3HOXI 1NUIA 3VTNA 1YHQZ 5T64A 3GTGI 4E2WA 4A3EI 4X6AI 3G4SZ 2QA4Z 1QVFZ 2F4MA 3CCMZ 1Q7Y1 4MH4A 3J80b 1VQKZ 4BBSI 1YIJZ 3LUSA 1VQ7Z 1Q861 2JA7I 3H3VJ 1K8A2 1QVGZ 1WIIA 1Q7Y2 5IT9f 3KIFA 2O4HA 3GKQA 1VQ91 3S17I 3CCVZ 1X0TA 3NDIA 4NBEA 3NDJA 1KD12 1YIT1 2ZAEB 3IFUA 3EERA 5FLXf 1M1K1 5CM2M 3HOYI 2Y0SA 4E33A 3TE5B 4A3FI 3OW2Y 2JUBA 1VQ8Z 3QWUA 2QEXZ 2BJOA 3CCEZ 2V8IA 1M1K2 3FKII 2OOXB 3VMHA 3TDHB 5C4XI 3CCU1 3GTQI 4S1TA 4A3LI 3ESWA 2RBLA 3NH5A 1VQNZ 4QTUA 4MD7A 2H85A 1VQ61 2E2II 2E9HA 3HKZA 4BY7I 3CXCZ 1YUKA 4CL1A 2PK7A 1N8R1 2VUGA 1K732 1TWAI 3HOVI 4E30A 3F3PC 5D1OA 2OTJ1 1VQO1 1Y1VS 3CC4Z 2JA6I 3GTPI 2OTLZ 1N8R2 5A2Qf 2JMOA 4MD9A 2NVYI 4E2ZA 3PO2I 4HGYA 3I56Z 2W03A 3P5JB 2QRCB 5D1OB 4E2YA 3CQZI 2OOYB 3CC7Z 1KQSY 3G4S1 3CCQZ 2LFUA 1YJWZ 3CCS1 3JAMb 1VQL1 3GTKI 1QYPA 1VQK1 3RZDI 1YI2Z 1YJNZ 3M3YI 1YIJ1 1VQ71 1VQ5Z 1M902 3CPWY 4NBAA 5T6BA 3S1RI 3CCJZ 3GCFA 5LL6f 4DGLA 1K8A1 1VQ4Z 1Y1VI 3CCRZ 1VLAA 4A3CI 3MZKB 4A3GI 4HH4A 4MRIA 1ML8A 1KD11 3CMA1 1Q822 2RHBA 2QREB 3NH4A 1RO2A 4NOZA 1Z03A 3CCE1 1RQFA 3OW2Z 3GTJI 2PMZA 4NB9A 4NBFA 2P28A 1USPA 3G711 1W2BY 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX I;  2NVT I;  4NBH A;  2DE5 A;  3K7A I;  4A3J I;  4QTU A;  4NBB A;  2VUM I;  2DE6 A;  3S15 I;  1Y1W I;  2JS4 A;  2E2I I;  4NB8 A;  4BY7 I;  1TWF I;  2J6A A;  2K5R A;  1USP B;  3PO3 S;  4A93 I;  1TWG I;  1I6H I;  5C3E I;  2JA5 I;  2PK7 A;  2P3Y A;  2R7Z I;  1I3Q I;  3HOW I;  2E2J I;  2AKL A;  1TWA I;  3S1N I;  3HOV I;  4A3M I;  1TFI A;  1TWH I;  1R9T I;  4A3B I;  1K83 I;  3HOZ I;  2DE7 A;  3I4M I;  3M4O I;  4A3I I;  1X3Z A;  1Y1V S;  2NVX I;  3I4N I;  2JA6 I;  4BY1 I;  3GTP I;  3GTO I;  2JA8 I;  1ZB9 A;  2NVY I;  3S2H I;  1N2F A;  2JR6 A;  4Y7N I;  3HOU I;  3PO2 I;  3HOX I;  4NBG A;  4NBD A;  1RO4 A;  1NUI A;  1PFT A;  1WCM I;  3S1M I;  2NVQ I;  3GTG I;  4A3E I;  3U50 C;  4X6A I;  3CQZ I;  2HF1 A;  1ZB8 A;  2YU9 I;  3GTL I;  1SFO I;  2F4M A;  3GTM S;  3VB9 A;  1I50 I;  4MH4 A;  2R92 I;  3GTK I;  1QYP A;  4BBS I;  3LUS A;  3RZO I;  3RZD I;  3M3Y I;  2JA7 I;  1X3W A;  3PO3 I;  3H3V J;  1WW9 A;  4NBA A;  1RLY A;  2F4O A;  2JNY A;  4NBC A;  3VMI A;  1DL6 A;  3S1R I;  3GCF A;  3D6W A;  3S17 I;  3GKQ A;  3I07 A;  4NBE A;  5FLM I;  4XX2 A;  5C4J I;  3S2D I;  1TWC I;  1Y1V I;  2KPI A;  2R93 I;  4BBR I;  3EER A;  4A3K I;  4A3D I;  1VLA A;  3HOY I;  5CM2 M;  4A3C I;  4Y52 I;  4A3G I;  4A3F I;  2B63 I;  1LQL A;  1L1O C;  3S1Q I;  1ML8 A;  3VMG A;  5C44 I;  5IP7 I;  2BJO A;  3H0G I;  4NOZ A;  3Q87 A;  3S14 I;  1USP A;  3S16 I;  3FKI I;  3VMH A;  1YUA A;  5IP9 I;  3GTJ I;  4QTT A;  5C4X I;  3GTM I;  3GTQ I;  4NB9 A;  4A3L I;  4NBF A;  2E2H I;  3ESW A;  2RBL A; 
#chains in the Genus database with same CATH topology
 1VQN 1;  2WB1 A;  4A3J I;  3MON A;  3T4N B;  2JS4 A;  4NB8 A;  2V8J A;  1JWH C;  2VPY A;  2JIM A;  2K5R A;  1USP B;  2OZK A;  3PO3 S;  4A93 I;  3CCL 1;  1S72 Z;  3CME 1;  3CC2 Z;  2R7Z I;  3IF8 A;  1I3Q I;  3HOW I;  2E2J I;  3BG1 B;  2YAD A;  2Q51 A;  2PM9 A;  1JJ2 Y;  2O53 A;  1QVG Y;  3J81 b;  1TWH I;  4A3B I;  1K83 I;  2DE7 A;  3I4M I;  3M4O I;  1X3Z A;  2EGT A;  3MZL B;  4BY1 I;  1FDO A;  3GTO I;  3I55 1;  1K73 1;  3G6E Z;  3S2H I;  3IX0 A;  2JR6 A;  1VQ9 Z;  1ZH1 A;  4NBG A;  1PFT A;  2NVQ I;  1KC8 1;  1ZB8 A;  2YU9 I;  3J7A 4;  3GTL I;  1NP6 A;  2E7Z A;  1SFO I;  3GTM S;  2IV2 X;  3VB9 A;  1I50 I;  2W04 A;  2R92 I;  1YJ9 1;  3D2L A;  2WAQ A;  4MON A;  3RZO I;  1KC8 2;  2IZ4 A;  1YJN 1;  1X3W A;  3PO3 I;  1VQ5 1;  1RLY A;  2JNY A;  2QLV B;  3D6W A;  2QKD A;  2QR1 B;  5FLM I;  3CCU Z;  4RV9 A;  1FDI A;  1YHQ 1;  1K9M 1;  4AYB A;  1M90 1;  3CPW Z;  5C4J I;  3S2D I;  1TWC I;  3D9X A;  2R93 I;  2QA4 1;  1S7M A;  4A3K I;  2KI7 B;  3CCM 1;  1VQ6 Z;  5AN9 F;  4DQY B;  4DK1 A;  2B63 I;  1VQM Z;  1LQL A;  2AYD A;  4MD8 A;  1K9M 2;  3S1Q I;  3VMG A;  5C44 I;  2GTI A;  3H0G I;  3Q87 A;  3S16 I;  1RO0 A;  3CCV 1;  5IP9 I;  4QTT A;  3GTM I;  2K3R A;  2OTJ Z;  1Q82 1;  4NBB A;  2VUM I;  2V8K A;  2DE6 A;  5IT9 b;  2M48 A;  1VQP Z;  4TNU A;  2R6M A;  3JAM f;  1VQ8 1;  2IZ3 A;  2VPW A;  5FLX b;  2QEX 1;  1S72 1;  4HGZ A;  4MXU A;  1RNI A;  3CC2 1;  2JIR A;  2AKL A;  3CCS Z;  1TFI A;  3CD6 Z;  1VQL Z;  1R9T I;  3HOZ I;  4RVD A;  4A3I I;  2RT9 A;  1NJI 1;  3EED A;  2JA8 I;  1JJ2 Z;  2LIY A;  4RS4 A;  1QVF Y;  5D1P A;  3G6E 1;  1N2F A;  1Z01 A;  4Y7N I;  4NBD A;  3J80 f;  1Q16 A;  1RO4 A;  1Q86 2;  1WCM I;  3S1M I;  3U50 C;  1NJI 2;  2HF1 A;  3KIH A;  2LEX A;  1Z02 A;  4RVF A;  4RVG A;  2GU2 A;  3F3F C;  2QRD B;  2JIO A;  3NFZ A;  3CC4 1;  3CMA Z;  4NH1 C;  2OTL 1;  1SIW A;  1WW9 A;  2G2K A;  2F4O A;  4NBC A;  3VMI A;  1DL6 A;  3BG0 B;  2RIQ A;  3I07 A;  3I56 1;  4RVH A;  3G71 Z;  2V45 A;  2GTH A;  1YIT Z;  4XX2 A;  5A2Q b;  4E31 A;  2KPI A;  3CC7 1;  1Q81 1;  4BBR I;  2JIP A;  4A3D I;  3CCQ 1;  5T67 A;  1P9N A;  1YJW 1;  4Y52 I;  2I3C A;  3NH8 A;  1YI2 1;  3J81 f;  1VQM 1;  1L1O C;  4E2X A;  5IP7 I;  1KQS Z;  3CCL Z;  1Q81 2;  3CME Z;  3S14 I;  3CCJ 1;  1YUA A;  2Q4Z A;  2E2H I;  4E32 A;  4BXX I;  3CXC Y;  2NVT I;  1VQ4 1;  4NBH A;  2DE5 A;  3K7A I;  2RPR A;  3CCR 1;  3I55 Z;  3S15 I;  1Y1W I;  1QF8 A;  1VQP 1;  1TWF I;  2J6A A;  1TWG I;  1I6H I;  2M6N A;  5C3E I;  2JA5 I;  2P3Y A;  2VF1 A;  3FQM A;  1QXF A;  3S1N I;  1KRL A;  4A3M I;  1VQO Z;  3CD6 1;  1YJ9 Z;  1Y8C A;  2HU9 A;  2NVX I;  3I4N I;  1ZB9 A;  4NFR A;  1W2B Z;  2JIQ A;  3HOU I;  4EWC A;  3HOX I;  1NUI A;  3VTN A;  1YHQ Z;  5T64 A;  3GTG I;  4E2W A;  4A3E I;  4X6A I;  3G4S Z;  2QA4 Z;  1QVF Z;  2F4M A;  3CCM Z;  1Q7Y 1;  4MH4 A;  3J80 b;  1VQK Z;  4BBS I;  1YIJ Z;  3LUS A;  1VQ7 Z;  1Q86 1;  2JA7 I;  1AA6 A;  3H3V J;  1K8A 2;  1QVG Z;  1WII A;  1Q7Y 2;  5IT9 f;  3KIF A;  2O4H A;  3GKQ A;  1VQ9 1;  3S17 I;  3CCV Z;  1X0T A;  3NDI A;  4NBE A;  3NDJ A;  1KD1 2;  1YIT 1;  2ZAE B;  3IFU A;  3EER A;  5FLX f;  1M1K 1;  5CM2 M;  3HOY I;  2Y0S A;  4E33 A;  3TE5 B;  4A3F I;  3OW2 Y;  2JUB A;  1VQ8 Z;  3QWU A;  2QEX Z;  2BJO A;  3CCE Z;  2V8I A;  1M1K 2;  2VPX A;  3FKI I;  2OOX B;  3VMH A;  3TDH B;  5C4X I;  3CCU 1;  3GTQ I;  4S1T A;  4A3L I;  3ESW A;  2RBL A;  3NH5 A;  1VQN Z;  4QTU A;  3IR7 A;  4MD7 A;  2H85 A;  1VQ6 1;  2E2I I;  2E9H A;  3HKZ A;  4BY7 I;  3CXC Z;  1YUK A;  4CL1 A;  2PK7 A;  2V3V A;  1N8R 1;  2VUG A;  1K73 2;  1TWA I;  3HOV I;  4E30 A;  3F3P C;  5D1O A;  2OTJ 1;  1VQO 1;  1Y1V S;  3CC4 Z;  2JA6 I;  3GTP I;  2OTL Z;  1N8R 2;  5A2Q f;  2JMO A;  4MD9 A;  2NVY I;  4E2Z A;  3PO2 I;  4HGY A;  3I56 Z;  2W03 A;  3P5J B;  2QRC B;  5D1O B;  4E2Y A;  1WJ2 A;  3CQZ I;  2OOY B;  3CC7 Z;  1KQS Y;  3G4S 1;  3CCQ Z;  2LFU A;  1YJW Z;  3CCS 1;  3JAM b;  1VQL 1;  3GTK I;  1QYP A;  1VQK 1;  3RZD I;  1YI2 Z;  1YJN Z;  3M3Y I;  1YIJ 1;  1VQ7 1;  1VQ5 Z;  1M90 2;  3CPW Y;  4NBA A;  5T6B A;  2NAP A;  3S1R I;  3CCJ Z;  3GCF A;  1WZN A;  5LL6 f;  4DGL A;  2VPZ A;  1K8A 1;  1VQ4 Z;  1Y1V I;  3CCR Z;  1VLA A;  4A3C I;  3MZK B;  4A3G I;  4HH4 A;  4MRI A;  1ML8 A;  1KD1 1;  3CMA 1;  1Q82 2;  2RHB A;  2QRE B;  3NH4 A;  1RO2 A;  4NOZ A;  1Z03 A;  3CCE 1;  1RQF A;  3OW2 Z;  3GTJ I;  2PMZ A;  4NB9 A;  4NBF A;  2P28 A;  1USP A;  3G71 1;  1W2B Y;  3FQQ A; 
#chains in the Genus database with same CATH homology
 1VQN 1;  2WB1 A;  4A3J I;  3MON A;  3T4N B;  2JS4 A;  4NB8 A;  2V8J A;  1JWH C;  2K5R A;  1USP B;  2OZK A;  3PO3 S;  4A93 I;  3CCL 1;  1S72 Z;  3CME 1;  3CC2 Z;  2R7Z I;  3IF8 A;  1I3Q I;  3HOW I;  2E2J I;  3BG1 B;  2YAD A;  2Q51 A;  2PM9 A;  1JJ2 Y;  2O53 A;  1QVG Y;  3J81 b;  1TWH I;  4A3B I;  1K83 I;  2DE7 A;  3I4M I;  3M4O I;  1X3Z A;  2EGT A;  3MZL B;  4BY1 I;  3GTO I;  3I55 1;  1K73 1;  3G6E Z;  3S2H I;  3IX0 A;  2JR6 A;  1VQ9 Z;  1ZH1 A;  4NBG A;  1PFT A;  2NVQ I;  1KC8 1;  1ZB8 A;  2YU9 I;  3J7A 4;  3GTL I;  1NP6 A;  1SFO I;  3GTM S;  3VB9 A;  1I50 I;  2W04 A;  2R92 I;  1YJ9 1;  2WAQ A;  4MON A;  3RZO I;  1KC8 2;  2IZ4 A;  1YJN 1;  1X3W A;  3PO3 I;  1VQ5 1;  1RLY A;  2JNY A;  2QLV B;  3D6W A;  2QKD A;  2QR1 B;  5FLM I;  3CCU Z;  4RV9 A;  1YHQ 1;  1K9M 1;  4AYB A;  1M90 1;  3CPW Z;  5C4J I;  3S2D I;  1TWC I;  3D9X A;  2R93 I;  2QA4 1;  1S7M A;  4A3K I;  2KI7 B;  3CCM 1;  1VQ6 Z;  5AN9 F;  4DQY B;  4DK1 A;  2B63 I;  1VQM Z;  1LQL A;  4MD8 A;  1K9M 2;  3S1Q I;  3VMG A;  5C44 I;  2GTI A;  3H0G I;  3Q87 A;  3S16 I;  1RO0 A;  3CCV 1;  5IP9 I;  4QTT A;  3GTM I;  2K3R A;  2OTJ Z;  1Q82 1;  4NBB A;  2VUM I;  2V8K A;  2DE6 A;  5IT9 b;  2M48 A;  1VQP Z;  4TNU A;  2R6M A;  3JAM f;  1VQ8 1;  2IZ3 A;  5FLX b;  2QEX 1;  1S72 1;  4HGZ A;  4MXU A;  1RNI A;  3CC2 1;  2AKL A;  3CCS Z;  1TFI A;  3CD6 Z;  1VQL Z;  1R9T I;  3HOZ I;  4RVD A;  4A3I I;  2RT9 A;  1NJI 1;  3EED A;  2JA8 I;  1JJ2 Z;  2LIY A;  4RS4 A;  1QVF Y;  5D1P A;  3G6E 1;  1N2F A;  1Z01 A;  4Y7N I;  4NBD A;  3J80 f;  1RO4 A;  1Q86 2;  1WCM I;  3S1M I;  3U50 C;  1NJI 2;  2HF1 A;  3KIH A;  1Z02 A;  4RVF A;  4RVG A;  2GU2 A;  3F3F C;  2QRD B;  3NFZ A;  3CC4 1;  3CMA Z;  4NH1 C;  2OTL 1;  1WW9 A;  2G2K A;  2F4O A;  4NBC A;  3VMI A;  1DL6 A;  3BG0 B;  2RIQ A;  3I07 A;  3I56 1;  4RVH A;  3G71 Z;  1YIT Z;  2GTH A;  4XX2 A;  5A2Q b;  4E31 A;  2KPI A;  3CC7 1;  1Q81 1;  4BBR I;  4A3D I;  3CCQ 1;  5T67 A;  1P9N A;  1YJW 1;  4Y52 I;  2I3C A;  3NH8 A;  1YI2 1;  3J81 f;  1VQM 1;  1L1O C;  4E2X A;  5IP7 I;  1KQS Z;  3CCL Z;  1Q81 2;  3CME Z;  3S14 I;  3CCJ 1;  1YUA A;  2Q4Z A;  2E2H I;  4E32 A;  4BXX I;  3CXC Y;  2NVT I;  1VQ4 1;  4NBH A;  2DE5 A;  3K7A I;  2RPR A;  3CCR 1;  3I55 Z;  3S15 I;  1Y1W I;  1QF8 A;  1VQP 1;  1TWF I;  2J6A A;  1TWG I;  1I6H I;  2M6N A;  5C3E I;  2JA5 I;  2P3Y A;  2VF1 A;  3FQM A;  3S1N I;  1KRL A;  4A3M I;  1VQO Z;  3CD6 1;  1YJ9 Z;  2HU9 A;  2NVX I;  3I4N I;  1ZB9 A;  4NFR A;  1W2B Z;  3HOU I;  4EWC A;  3HOX I;  1NUI A;  3VTN A;  1YHQ Z;  5T64 A;  3GTG I;  4E2W A;  4A3E I;  4X6A I;  3G4S Z;  2QA4 Z;  1QVF Z;  2F4M A;  3CCM Z;  1Q7Y 1;  4MH4 A;  3J80 b;  1VQK Z;  4BBS I;  1YIJ Z;  3LUS A;  1VQ7 Z;  1Q86 1;  2JA7 I;  3H3V J;  1K8A 2;  1QVG Z;  1WII A;  1Q7Y 2;  5IT9 f;  3KIF A;  2O4H A;  3GKQ A;  1VQ9 1;  3S17 I;  3CCV Z;  1X0T A;  3NDI A;  4NBE A;  3NDJ A;  1KD1 2;  1YIT 1;  2ZAE B;  3IFU A;  3EER A;  5FLX f;  1M1K 1;  5CM2 M;  3HOY I;  2Y0S A;  4E33 A;  3TE5 B;  4A3F I;  3OW2 Y;  2JUB A;  1VQ8 Z;  3QWU A;  2QEX Z;  2BJO A;  3CCE Z;  2V8I A;  1M1K 2;  3FKI I;  2OOX B;  3VMH A;  3TDH B;  5C4X I;  3CCU 1;  3GTQ I;  4S1T A;  4A3L I;  3ESW A;  2RBL A;  3NH5 A;  1VQN Z;  4QTU A;  4MD7 A;  2H85 A;  1VQ6 1;  2E2I I;  2E9H A;  3HKZ A;  4BY7 I;  3CXC Z;  1YUK A;  4CL1 A;  2PK7 A;  1N8R 1;  2VUG A;  1K73 2;  1TWA I;  3HOV I;  4E30 A;  3F3P C;  5D1O A;  2OTJ 1;  1VQO 1;  1Y1V S;  3CC4 Z;  2JA6 I;  3GTP I;  2OTL Z;  1N8R 2;  5A2Q f;  2JMO A;  4MD9 A;  2NVY I;  4E2Z A;  3PO2 I;  4HGY A;  3I56 Z;  2W03 A;  3P5J B;  2QRC B;  5D1O B;  4E2Y A;  3CQZ I;  2OOY B;  3CC7 Z;  1KQS Y;  3G4S 1;  3CCQ Z;  2LFU A;  1YJW Z;  3CCS 1;  3JAM b;  1VQL 1;  3GTK I;  1QYP A;  1VQK 1;  3RZD I;  1YI2 Z;  1YJN Z;  3M3Y I;  1YIJ 1;  1VQ7 1;  1VQ5 Z;  1M90 2;  3CPW Y;  4NBA A;  5T6B A;  3S1R I;  3CCJ Z;  3GCF A;  5LL6 f;  4DGL A;  1K8A 1;  1VQ4 Z;  1Y1V I;  3CCR Z;  1VLA A;  4A3C I;  3MZK B;  4A3G I;  4HH4 A;  4MRI A;  1ML8 A;  1KD1 1;  3CMA 1;  1Q82 2;  2RHB A;  2QRE B;  3NH4 A;  1RO2 A;  4NOZ A;  1Z03 A;  3CCE 1;  1RQF A;  3OW2 Z;  3GTJ I;  2PMZ A;  4NB9 A;  4NBF A;  2P28 A;  1USP A;  3G71 1;  1W2B Y;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...