2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein BB2007
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
1I3QI 1LQLA 3GTMS 1ZB9A 1X3WA 3VB9A 1TWHI 2NVXI 3S1NI 1USPA 3D6WA 3VMIA 3ESWA 1I6HI 5C44I 3H3VJ 3FKII 4QTUA 4QTTA 2E2JI 2JS4A 2RBLA 1WW9A 5IP7I 4A3MI 4NBDA 3HOYI 1TWGI 1USPB 2DE7A 4A3DI 2JR6A 1YUAA 3I07A 4NBFA 2E2II 5C4XI 3K7AI 4A3GI 3M4OI 4NBEA 2JA5I 2R92I 2KPIA 4NOZA 2E2HI 3GTLI 3I4MI 2DE6A 3EERA 4XX2A 3PO3I 4A3II 3S16I 3S2DI 1ML8A 1R9TI 1TWCI 3GKQA 2JNYA 4NBBA 4A93I 4Y52I 4BY7I 5C3EI 1ZB8A 4A3EI 2AKLA 4BY1I 4A3BI 1X3ZA 3GTOI 3GTJI 3GTQI 2VUMI 4NBHA 1WCMI 3PO2I 3GTKI 2B63I 2NVQI 3S17I 3U50C 2JA6I 5IP9I 2PK7A 1DL6A 3S15I 3HOWI 1TFIA 1Y1VI 2NVYI 1RLYA 3LUSA 4MH4A 1L1OC 2R7ZI 3S1MI 3H0GI 3VMHA 4NBGA 1I50I 1Y1WI 1TWFI 3RZDI 3VMGA 3S14I 1RO4A 4A3CI 2J6AA 4BBRI 4X6AI 2R93I 3RZOI 1QYPA 2DE5A 4A3JI 2YU9I 5C4JI 2JA7I 2NVTI 1VLAA 3I4NI 1PFTA 4A3KI 3GTMI 4NBAA 1Y1VS 2K5RA 4A3FI 3HOUI 3GCFA 3PO3S 4BBSI 4BXXI 1SFOI 3Q87A 5CM2M 3S1RI 3S1QI 1TWAI 4NB9A 2JA8I 4Y7NI 4NBCA 3HOXI 2F4OA 3GTGI 1K83I 3CQZI 3GTPI 3M3YI 4NB8A 2F4MA 1NUIA 5FLMI 1N2FA 2HF1A 3HOVI 4A3LI 3S2HI 3HOZI 2BJOA 2P3YA
chains in the Genus database with same CATH superfamily
2QA41 1JWHC 1NP6A 3G4S1 3CD61 3VB9A 3CC41 2NVXI 3S1NI 2VPZA 3CC7Z 3CCMZ 1YI2Z 5IP7I 3F3PC 3CME1 3HOYI 1TWGI 1USPB 1WZNA 2JR6A 1YUAA 5C4XI 2QRDB 2W04A 1W2BY 2KPIA 3I4MI 1VQ81 1QVFZ 3EERA 3MZLB 4XX2A 1VQM1 2OOYB 2WAQA 1ML8A 1R9TI 4E30A 5C3EI 4A3EI 1VQL1 2OZKA 1X3ZA 3CCVZ 3GTQI 3I56Z 3D2LA 3GTKI 2B63I 4NH1C 3U50C 4MONA 3S15I 3HOWI 2P28A 2NVYI 1RLYA 3LUSA 2E9HA 2H85A 4RVDA 3P5JB 3VMHA 5T64A 3CCEZ 1M1K2 5FLXf 1VQ91 1VQ4Z 4NBGA 1TWFI 2I3CA 3CC71 5AN9F 1SIWA 4X6AI 4RV9A 3NDJA 2R93I 3IR7A 5T67A 1Z03A 5C4JI 2JA7I 2NVTI 3CMA1 1QVGZ 1ZH1A 1N8R1 2O53A 2QRCB 1Y1VS 1YJWZ 1K9M1 1JJ2Z 2LFUA 4E2YA 4MRIA 3GCFA 1YHQZ 3CCU1 3BG0B 4E33A 1Q862 1VQN1 1P9NA 1YUKA 4MD7A 1K8A1 2V8JA 1TWAI 2JA8I 1YIT1 1VQ71 1RO0A 3GTGI 3GTPI 2VPYA 2W03A 4MD8A 2JIMA 5FLMI 3FQQA 1YJN1 3T4NB 1WIIA 2VF1A 2R6MA 2BJOA 3CCQZ 3CCR1 3JAMf 1LQLA 3GTMS 1S72Z 2OTLZ 3G711 1KC81 3F3FC 3J80b 4TNUA 3D6WA 3ESWA 1I6HI 5D1OA 2RHBA 4QTUA 4QTTA 2WB1A 1VQ51 3CCJ1 1M901 1WW9A 1RO2A 4A3MI 4NBDA 2JIRA 3VTNA 3I07A 2E2II 1YJ9Z 3K7AI 2R92I 1VQ61 2AYDA 2GU2A 2E2HI 2QR1B 3GTLI 3CCSZ 2DE6A 1VQPZ 3CPWZ 3S16I 2OTJ1 2IZ4A 1QF8A 4NBBA 4E31A 4DK1A 1VQKZ 3KIHA 5A2Qf 4BY7I 3TE5B 1ZB8A 2AKLA 4BY1I 1VQO1 1KD11 3CC2Z 3J81f 3PO2I 4HH4A 2NVQI 3S17I 4AYBA 2JA6I 2VPWA 5IP9I 2PK7A 1DL6A 3J7A4 4MH4A 1QVGY 1Q16A 2GTIA 5IT9f 1X0TA 1JJ2Y 2V8IA 2V3VA 3S14I 2J6AA 3G6EZ 4CL1A 3RZOI 2VPXA 2QKDA 3I4NI 1PFTA 4NBAA 2E7ZA 2K5RA 4A3FI 3HOUI 1N8R2 2JUBA 3CCS1 1K731 3PO3S 1K9M2 4BBSI 3Q87A 2QLVB 3S1QI 4E2WA 1S7MA 1Q7Y1 4NBCA 2F4OA 3CCM1 1YI21 1K83I 3CQZI 2QEXZ 5FLXb 3M3YI 3EEDA 1FDIA 4A3LI 3CC21 4RVHA 1I3QI 3OW2Z 3NDIA 3CXCZ 1TWHI 1USPA 1KC82 3CPWY 3H3VJ 1RQFA 4S1TA 2GTHA 2JS4A 5T6BA 1M902 1Q821 4A3DI 2IZ3A 3NH4A 2OOXB 4EWCA 4A3GI 3M4OI 4NBEA 2QA4Z 3CCV1 3QWUA 3TDHB 3G4SZ 3CD6Z 3I561 1Q811 3CC4Z 4RVFA 4A3II 3S2DI 4E2ZA 1NJI1 3GKQA 3CMEZ 3CCE1 2RT9A 3JAMb 1VQ41 2O4HA 3NH5A 1Y8CA 4DQYB 4A3BI 3GTOI 2ZAEB 2QEX1 3NH8A 1KD12 1VQMZ 1KRLA 2M6NA 1L1OC 2R7ZI 1YIJZ 1YJW1 2Y0SA 1I50I 1YHQ1 1Y1WI 3RZDI 2Q51A 1VQLZ 4RVGA 1AA6A 1RO4A 5LL6f 4A3CI 4BBRI 2PM9A 2YU9I 3MZKB 1VLAA 5A2Qb 1RNIA 2YADA 1VQ9Z 3I55Z 3CCQ1 4DGLA 3OW2Y 4BXXI 3J81b 1S721 2OTL1 3CXCY 1K732 3S1RI 1KQSZ 4HGYA 1Q7Y2 5IT9b 4NB8A 2F4MA 1NUIA 3CMAZ 2JMOA 3S2HI 2G2KA 3HOZI 4E2XA 1YJ91 2P3YA 3FQMA 3CCUZ 2VUGA 4NFRA 1VQNZ 1ZB9A 1X3WA 1YIJ1 5D1PA 1VQP1 2Q4ZA 5C44I 3FKII 2E2JI 1YITZ 1VQ7Z 2RBLA 2JIQA 4HGZA 1YJNZ 1WJ2A 1K8A2 1VQK1 5D1OB 2DE7A 2LEXA 4NBFA 3BG1B 1Q822 3CCRZ 2JA5I 4NOZA 3G71Z 2JIPA 3PO3I 1Q812 1TWCI 1VQ5Z 3I551 4RS4A 3CCJZ 2JNYA 4A93I 1NJI2 4Y52I 1W2BZ 2LIYA 2PMZA 3CCLZ 3IFUA 3GTJI 2VUMI 3G6E1 4NBHA 2EGTA 1WCMI 2M48A 1VQ6Z 3MONA 2QREB 1TFIA 1Y1VI 1M1K1 2OTJZ 3S1MI 3H0GI 1Z02A 2V45A 3VMGA 1VQOZ 2RIQA 2NAPA 2IV2X 3NFZA 1FDOA 1QXFA 2RPRA 1QYPA 1KQSY 2DE5A 3J80f 4A3JI 3IF8A 1VQ8Z 4MXUA 4A3KI 3KIFA 3GTMI 3HKZA 1Q861 1QVFY 1SFOI 5CM2M 2KI7B 2K3RA 2HU9A 4NB9A 4Y7NI 3IX0A 3HOXI 4MD9A 2JIOA 4E32A 1Z01A 1N2FA 2HF1A 3HOVI 3CCL1 2V8KA 3VMIA 3D9XA
chains in the Genus database with same CATH topology
2QA41 1JWHC 1NP6A 3G4S1 3CD61 3VB9A 3CC41 2NVXI 3S1NI 3CC7Z 3CCMZ 1YI2Z 5IP7I 3F3PC 3CME1 3HOYI 1TWGI 1USPB 2JR6A 1YUAA 5C4XI 2QRDB 2W04A 1W2BY 2KPIA 3I4MI 1VQ81 1QVFZ 3EERA 3MZLB 4XX2A 1VQM1 2OOYB 2WAQA 1ML8A 1R9TI 4E30A 5C3EI 4A3EI 1VQL1 2OZKA 1X3ZA 3CCVZ 3GTQI 3I56Z 3GTKI 2B63I 4NH1C 3U50C 4MONA 3S15I 3HOWI 2P28A 2NVYI 1RLYA 3LUSA 2E9HA 2H85A 4RVDA 3P5JB 3VMHA 5T64A 3CCEZ 1M1K2 5FLXf 1VQ91 1VQ4Z 4NBGA 1TWFI 2I3CA 3CC71 5AN9F 4X6AI 4RV9A 3NDJA 2R93I 5T67A 1Z03A 5C4JI 2JA7I 2NVTI 3CMA1 1QVGZ 1ZH1A 1N8R1 2O53A 2QRCB 1Y1VS 1YJWZ 1K9M1 1JJ2Z 2LFUA 4E2YA 4MRIA 3GCFA 1YHQZ 3CCU1 3BG0B 4E33A 1Q862 1VQN1 1P9NA 1YUKA 4MD7A 1K8A1 2V8JA 1TWAI 2JA8I 1YIT1 1VQ71 1RO0A 3GTGI 3GTPI 2W03A 4MD8A 5FLMI 3FQQA 1YJN1 3T4NB 1WIIA 2VF1A 2R6MA 2BJOA 3CCQZ 3CCR1 3JAMf 1LQLA 3GTMS 1S72Z 2OTLZ 3G711 1KC81 3F3FC 3J80b 4TNUA 3D6WA 3ESWA 1I6HI 5D1OA 2RHBA 4QTUA 4QTTA 2WB1A 1VQ51 3CCJ1 1M901 1WW9A 1RO2A 4A3MI 4NBDA 3VTNA 3I07A 2E2II 1YJ9Z 3K7AI 2R92I 1VQ61 2GU2A 2E2HI 3GTLI 2QR1B 3CCSZ 2DE6A 1VQPZ 3CPWZ 3S16I 2OTJ1 2IZ4A 1QF8A 4NBBA 4E31A 4DK1A 1VQKZ 3KIHA 5A2Qf 4BY7I 3TE5B 1ZB8A 2AKLA 4BY1I 1VQO1 1KD11 3CC2Z 3J81f 3PO2I 4HH4A 2NVQI 3S17I 4AYBA 2JA6I 5IP9I 2PK7A 1DL6A 3J7A4 4MH4A 1QVGY 2GTIA 5IT9f 1X0TA 1JJ2Y 2V8IA 3S14I 2J6AA 3G6EZ 4CL1A 3RZOI 2QKDA 3I4NI 1PFTA 4NBAA 2K5RA 4A3FI 3HOUI 1N8R2 2JUBA 3CCS1 1K731 3PO3S 1K9M2 4BBSI 3Q87A 2QLVB 3S1QI 4E2WA 1S7MA 1Q7Y1 4NBCA 2F4OA 3CCM1 1YI21 1K83I 3CQZI 2QEXZ 5FLXb 3M3YI 3EEDA 4A3LI 3CC21 4RVHA 1I3QI 3OW2Z 3NDIA 3CXCZ 1TWHI 1USPA 1KC82 3CPWY 3H3VJ 1RQFA 4S1TA 2GTHA 2JS4A 5T6BA 1M902 1Q821 4A3DI 2IZ3A 3NH4A 2OOXB 4EWCA 4A3GI 3M4OI 4NBEA 2QA4Z 3CCV1 3QWUA 3TDHB 3G4SZ 3CD6Z 3I561 1Q811 3CC4Z 4RVFA 4A3II 3S2DI 4E2ZA 1NJI1 3GKQA 3CMEZ 3CCE1 2RT9A 3JAMb 1VQ41 2O4HA 3NH5A 4DQYB 4A3BI 3GTOI 2ZAEB 2QEX1 3NH8A 1KD12 1VQMZ 1KRLA 2M6NA 1L1OC 2R7ZI 1YIJZ 1YJW1 2Y0SA 1I50I 1YHQ1 1Y1WI 3RZDI 2Q51A 1VQLZ 4RVGA 1RO4A 5LL6f 4A3CI 4BBRI 2PM9A 2YU9I 3MZKB 1VLAA 5A2Qb 1RNIA 2YADA 1VQ9Z 3I55Z 3CCQ1 4DGLA 3OW2Y 4BXXI 3J81b 1S721 2OTL1 3CXCY 1K732 3S1RI 1KQSZ 4HGYA 1Q7Y2 5IT9b 4NB8A 2F4MA 1NUIA 3CMAZ 2JMOA 3S2HI 2G2KA 3HOZI 4E2XA 1YJ91 2P3YA 3FQMA 3CCUZ 2VUGA 4NFRA 1VQNZ 1ZB9A 1X3WA 1YIJ1 5D1PA 1VQP1 2Q4ZA 5C44I 3FKII 2E2JI 1YITZ 1VQ7Z 2RBLA 4HGZA 1YJNZ 1K8A2 1VQK1 5D1OB 2DE7A 4NBFA 3BG1B 1Q822 3CCRZ 2JA5I 4NOZA 3G71Z 3PO3I 1Q812 1TWCI 1VQ5Z 3I551 4RS4A 3CCJZ 2JNYA 4A93I 1NJI2 4Y52I 1W2BZ 2LIYA 2PMZA 3CCLZ 3IFUA 3GTJI 2VUMI 3G6E1 4NBHA 2EGTA 1WCMI 2M48A 1VQ6Z 3MONA 2QREB 1TFIA 1Y1VI 1M1K1 2OTJZ 3S1MI 3H0GI 1Z02A 3VMGA 1VQOZ 2RIQA 3NFZA 2RPRA 1QYPA 1KQSY 2DE5A 3J80f 4A3JI 3IF8A 1VQ8Z 4MXUA 4A3KI 3KIFA 3GTMI 3HKZA 1Q861 1QVFY 1SFOI 5CM2M 2KI7B 2K3RA 2HU9A 4NB9A 4Y7NI 3IX0A 3HOXI 4MD9A 4E32A 1Z01A 1N2FA 2HF1A 3HOVI 3CCL1 2V8KA 3VMIA 3D9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q I;  1LQL A;  3GTM S;  1ZB9 A;  1X3W A;  3VB9 A;  1TWH I;  2NVX I;  3S1N I;  1USP A;  3D6W A;  3VMI A;  3ESW A;  1I6H I;  5C44 I;  3H3V J;  3FKI I;  4QTU A;  4QTT A;  2E2J I;  2JS4 A;  2RBL A;  1WW9 A;  5IP7 I;  4A3M I;  4NBD A;  3HOY I;  1TWG I;  1USP B;  2DE7 A;  4A3D I;  2JR6 A;  1YUA A;  3I07 A;  4NBF A;  2E2I I;  5C4X I;  3K7A I;  4A3G I;  3M4O I;  4NBE A;  2JA5 I;  2R92 I;  2KPI A;  4NOZ A;  2E2H I;  3GTL I;  3I4M I;  2DE6 A;  3EER A;  4XX2 A;  3PO3 I;  4A3I I;  3S16 I;  3S2D I;  1ML8 A;  1R9T I;  1TWC I;  3GKQ A;  2JNY A;  4NBB A;  4A93 I;  4Y52 I;  4BY7 I;  5C3E I;  1ZB8 A;  4A3E I;  2AKL A;  4BY1 I;  4A3B I;  1X3Z A;  3GTO I;  3GTJ I;  3GTQ I;  2VUM I;  4NBH A;  1WCM I;  3PO2 I;  3GTK I;  2B63 I;  2NVQ I;  3S17 I;  3U50 C;  2JA6 I;  5IP9 I;  2PK7 A;  1DL6 A;  3S15 I;  3HOW I;  1TFI A;  1Y1V I;  2NVY I;  1RLY A;  3LUS A;  4MH4 A;  1L1O C;  2R7Z I;  3S1M I;  3H0G I;  3VMH A;  4NBG A;  1I50 I;  1Y1W I;  1TWF I;  3RZD I;  3VMG A;  3S14 I;  1RO4 A;  4A3C I;  2J6A A;  4BBR I;  4X6A I;  2R93 I;  3RZO I;  1QYP A;  2DE5 A;  4A3J I;  2YU9 I;  5C4J I;  2JA7 I;  2NVT I;  1VLA A;  3I4N I;  1PFT A;  4A3K I;  3GTM I;  4NBA A;  1Y1V S;  2K5R A;  4A3F I;  3HOU I;  3GCF A;  3PO3 S;  4BBS I;  4BXX I;  1SFO I;  3Q87 A;  5CM2 M;  3S1R I;  3S1Q I;  1TWA I;  4NB9 A;  2JA8 I;  4Y7N I;  4NBC A;  3HOX I;  2F4O A;  3GTG I;  1K83 I;  3CQZ I;  3GTP I;  3M3Y I;  4NB8 A;  2F4M A;  1NUI A;  5FLM I;  1N2F A;  2HF1 A;  3HOV I;  4A3L I;  3S2H I;  3HOZ I;  2BJO A;  2P3Y A; 
#chains in the Genus database with same CATH topology
 2QA4 1;  1JWH C;  1NP6 A;  3G4S 1;  3CD6 1;  3VB9 A;  3CC4 1;  2NVX I;  3S1N I;  2VPZ A;  3CC7 Z;  3CCM Z;  1YI2 Z;  5IP7 I;  3F3P C;  3CME 1;  3HOY I;  1TWG I;  1USP B;  1WZN A;  2JR6 A;  1YUA A;  5C4X I;  2QRD B;  2W04 A;  1W2B Y;  2KPI A;  3I4M I;  1VQ8 1;  1QVF Z;  3EER A;  3MZL B;  4XX2 A;  1VQM 1;  2OOY B;  2WAQ A;  1ML8 A;  1R9T I;  4E30 A;  5C3E I;  4A3E I;  1VQL 1;  2OZK A;  1X3Z A;  3CCV Z;  3GTQ I;  3I56 Z;  3D2L A;  3GTK I;  2B63 I;  4NH1 C;  3U50 C;  4MON A;  3S15 I;  3HOW I;  2P28 A;  2NVY I;  1RLY A;  3LUS A;  2E9H A;  2H85 A;  4RVD A;  3P5J B;  3VMH A;  5T64 A;  3CCE Z;  1M1K 2;  5FLX f;  1VQ9 1;  1VQ4 Z;  4NBG A;  1TWF I;  2I3C A;  3CC7 1;  5AN9 F;  1SIW A;  4X6A I;  4RV9 A;  3NDJ A;  2R93 I;  3IR7 A;  5T67 A;  1Z03 A;  5C4J I;  2JA7 I;  2NVT I;  3CMA 1;  1QVG Z;  1ZH1 A;  1N8R 1;  2O53 A;  2QRC B;  1Y1V S;  1YJW Z;  1K9M 1;  1JJ2 Z;  2LFU A;  4E2Y A;  4MRI A;  3GCF A;  1YHQ Z;  3CCU 1;  3BG0 B;  4E33 A;  1Q86 2;  1VQN 1;  1P9N A;  1YUK A;  4MD7 A;  1K8A 1;  2V8J A;  1TWA I;  2JA8 I;  1YIT 1;  1VQ7 1;  1RO0 A;  3GTG I;  3GTP I;  2VPY A;  2W03 A;  4MD8 A;  2JIM A;  5FLM I;  3FQQ A;  1YJN 1;  3T4N B;  1WII A;  2VF1 A;  2R6M A;  2BJO A;  3CCQ Z;  3CCR 1;  3JAM f;  1LQL A;  3GTM S;  1S72 Z;  2OTL Z;  3G71 1;  1KC8 1;  3F3F C;  3J80 b;  4TNU A;  3D6W A;  3ESW A;  1I6H I;  5D1O A;  2RHB A;  4QTU A;  4QTT A;  2WB1 A;  1VQ5 1;  3CCJ 1;  1M90 1;  1WW9 A;  1RO2 A;  4A3M I;  4NBD A;  2JIR A;  3VTN A;  3I07 A;  2E2I I;  1YJ9 Z;  3K7A I;  2R92 I;  1VQ6 1;  2AYD A;  2GU2 A;  2E2H I;  2QR1 B;  3GTL I;  3CCS Z;  2DE6 A;  1VQP Z;  3CPW Z;  3S16 I;  2OTJ 1;  2IZ4 A;  1QF8 A;  4NBB A;  4E31 A;  4DK1 A;  1VQK Z;  3KIH A;  5A2Q f;  4BY7 I;  3TE5 B;  1ZB8 A;  2AKL A;  4BY1 I;  1VQO 1;  1KD1 1;  3CC2 Z;  3J81 f;  3PO2 I;  4HH4 A;  2NVQ I;  3S17 I;  4AYB A;  2JA6 I;  2VPW A;  5IP9 I;  2PK7 A;  1DL6 A;  3J7A 4;  4MH4 A;  1QVG Y;  1Q16 A;  2GTI A;  5IT9 f;  1X0T A;  1JJ2 Y;  2V8I A;  2V3V A;  3S14 I;  2J6A A;  3G6E Z;  4CL1 A;  3RZO I;  2VPX A;  2QKD A;  3I4N I;  1PFT A;  4NBA A;  2E7Z A;  2K5R A;  4A3F I;  3HOU I;  1N8R 2;  2JUB A;  3CCS 1;  1K73 1;  3PO3 S;  1K9M 2;  4BBS I;  3Q87 A;  2QLV B;  3S1Q I;  4E2W A;  1S7M A;  1Q7Y 1;  4NBC A;  2F4O A;  3CCM 1;  1YI2 1;  1K83 I;  3CQZ I;  2QEX Z;  5FLX b;  3M3Y I;  3EED A;  1FDI A;  4A3L I;  3CC2 1;  4RVH A;  1I3Q I;  3OW2 Z;  3NDI A;  3CXC Z;  1TWH I;  1USP A;  1KC8 2;  3CPW Y;  3H3V J;  1RQF A;  4S1T A;  2GTH A;  2JS4 A;  5T6B A;  1M90 2;  1Q82 1;  4A3D I;  2IZ3 A;  3NH4 A;  2OOX B;  4EWC A;  4A3G I;  3M4O I;  4NBE A;  2QA4 Z;  3CCV 1;  3QWU A;  3TDH B;  3G4S Z;  3CD6 Z;  3I56 1;  1Q81 1;  3CC4 Z;  4RVF A;  4A3I I;  3S2D I;  4E2Z A;  1NJI 1;  3GKQ A;  3CME Z;  3CCE 1;  2RT9 A;  3JAM b;  1VQ4 1;  2O4H A;  3NH5 A;  1Y8C A;  4DQY B;  4A3B I;  3GTO I;  2ZAE B;  2QEX 1;  3NH8 A;  1KD1 2;  1VQM Z;  1KRL A;  2M6N A;  1L1O C;  2R7Z I;  1YIJ Z;  1YJW 1;  2Y0S A;  1I50 I;  1YHQ 1;  1Y1W I;  3RZD I;  2Q51 A;  1VQL Z;  4RVG A;  1AA6 A;  1RO4 A;  5LL6 f;  4A3C I;  4BBR I;  2PM9 A;  2YU9 I;  3MZK B;  1VLA A;  5A2Q b;  1RNI A;  2YAD A;  1VQ9 Z;  3I55 Z;  3CCQ 1;  4DGL A;  3OW2 Y;  4BXX I;  3J81 b;  1S72 1;  2OTL 1;  3CXC Y;  1K73 2;  3S1R I;  1KQS Z;  4HGY A;  1Q7Y 2;  5IT9 b;  4NB8 A;  2F4M A;  1NUI A;  3CMA Z;  2JMO A;  3S2H I;  2G2K A;  3HOZ I;  4E2X A;  1YJ9 1;  2P3Y A;  3FQM A;  3CCU Z;  2VUG A;  4NFR A;  1VQN Z;  1ZB9 A;  1X3W A;  1YIJ 1;  5D1P A;  1VQP 1;  2Q4Z A;  5C44 I;  3FKI I;  2E2J I;  1YIT Z;  1VQ7 Z;  2RBL A;  2JIQ A;  4HGZ A;  1YJN Z;  1WJ2 A;  1K8A 2;  1VQK 1;  5D1O B;  2DE7 A;  2LEX A;  4NBF A;  3BG1 B;  1Q82 2;  3CCR Z;  2JA5 I;  4NOZ A;  3G71 Z;  2JIP A;  3PO3 I;  1Q81 2;  1TWC I;  1VQ5 Z;  3I55 1;  4RS4 A;  3CCJ Z;  2JNY A;  4A93 I;  1NJI 2;  4Y52 I;  1W2B Z;  2LIY A;  2PMZ A;  3CCL Z;  3IFU A;  3GTJ I;  2VUM I;  3G6E 1;  4NBH A;  2EGT A;  1WCM I;  2M48 A;  1VQ6 Z;  3MON A;  2QRE B;  1TFI A;  1Y1V I;  1M1K 1;  2OTJ Z;  3S1M I;  3H0G I;  1Z02 A;  2V45 A;  3VMG A;  1VQO Z;  2RIQ A;  2NAP A;  2IV2 X;  3NFZ A;  1FDO A;  1QXF A;  2RPR A;  1QYP A;  1KQS Y;  2DE5 A;  3J80 f;  4A3J I;  3IF8 A;  1VQ8 Z;  4MXU A;  4A3K I;  3KIF A;  3GTM I;  3HKZ A;  1Q86 1;  1QVF Y;  1SFO I;  5CM2 M;  2KI7 B;  2K3R A;  2HU9 A;  4NB9 A;  4Y7N I;  3IX0 A;  3HOX I;  4MD9 A;  2JIO A;  4E32 A;  1Z01 A;  1N2F A;  2HF1 A;  3HOV I;  3CCL 1;  2V8K A;  3VMI A;  3D9X A; 
#chains in the Genus database with same CATH homology
 2QA4 1;  1JWH C;  1NP6 A;  3G4S 1;  3CD6 1;  3VB9 A;  3CC4 1;  2NVX I;  3S1N I;  3CC7 Z;  3CCM Z;  1YI2 Z;  5IP7 I;  3F3P C;  3CME 1;  3HOY I;  1TWG I;  1USP B;  2JR6 A;  1YUA A;  5C4X I;  2QRD B;  2W04 A;  1W2B Y;  2KPI A;  3I4M I;  1VQ8 1;  1QVF Z;  3EER A;  3MZL B;  4XX2 A;  1VQM 1;  2OOY B;  2WAQ A;  1ML8 A;  1R9T I;  4E30 A;  5C3E I;  4A3E I;  1VQL 1;  2OZK A;  1X3Z A;  3CCV Z;  3GTQ I;  3I56 Z;  3GTK I;  2B63 I;  4NH1 C;  3U50 C;  4MON A;  3S15 I;  3HOW I;  2P28 A;  2NVY I;  1RLY A;  3LUS A;  2E9H A;  2H85 A;  4RVD A;  3P5J B;  3VMH A;  5T64 A;  3CCE Z;  1M1K 2;  5FLX f;  1VQ9 1;  1VQ4 Z;  4NBG A;  1TWF I;  2I3C A;  3CC7 1;  5AN9 F;  4X6A I;  4RV9 A;  3NDJ A;  2R93 I;  5T67 A;  1Z03 A;  5C4J I;  2JA7 I;  2NVT I;  3CMA 1;  1QVG Z;  1ZH1 A;  1N8R 1;  2O53 A;  2QRC B;  1Y1V S;  1YJW Z;  1K9M 1;  1JJ2 Z;  2LFU A;  4E2Y A;  4MRI A;  3GCF A;  1YHQ Z;  3CCU 1;  3BG0 B;  4E33 A;  1Q86 2;  1VQN 1;  1P9N A;  1YUK A;  4MD7 A;  1K8A 1;  2V8J A;  1TWA I;  2JA8 I;  1YIT 1;  1VQ7 1;  1RO0 A;  3GTG I;  3GTP I;  2W03 A;  4MD8 A;  5FLM I;  3FQQ A;  1YJN 1;  3T4N B;  1WII A;  2VF1 A;  2R6M A;  2BJO A;  3CCQ Z;  3CCR 1;  3JAM f;  1LQL A;  3GTM S;  1S72 Z;  2OTL Z;  3G71 1;  1KC8 1;  3F3F C;  3J80 b;  4TNU A;  3D6W A;  3ESW A;  1I6H I;  5D1O A;  2RHB A;  4QTU A;  4QTT A;  2WB1 A;  1VQ5 1;  3CCJ 1;  1M90 1;  1WW9 A;  1RO2 A;  4A3M I;  4NBD A;  3VTN A;  3I07 A;  2E2I I;  1YJ9 Z;  3K7A I;  2R92 I;  1VQ6 1;  2GU2 A;  2E2H I;  3GTL I;  2QR1 B;  3CCS Z;  2DE6 A;  1VQP Z;  3CPW Z;  3S16 I;  2OTJ 1;  2IZ4 A;  1QF8 A;  4NBB A;  4E31 A;  4DK1 A;  1VQK Z;  3KIH A;  5A2Q f;  4BY7 I;  3TE5 B;  1ZB8 A;  2AKL A;  4BY1 I;  1VQO 1;  1KD1 1;  3CC2 Z;  3J81 f;  3PO2 I;  4HH4 A;  2NVQ I;  3S17 I;  4AYB A;  2JA6 I;  5IP9 I;  2PK7 A;  1DL6 A;  3J7A 4;  4MH4 A;  1QVG Y;  2GTI A;  5IT9 f;  1X0T A;  1JJ2 Y;  2V8I A;  3S14 I;  2J6A A;  3G6E Z;  4CL1 A;  3RZO I;  2QKD A;  3I4N I;  1PFT A;  4NBA A;  2K5R A;  4A3F I;  3HOU I;  1N8R 2;  2JUB A;  3CCS 1;  1K73 1;  3PO3 S;  1K9M 2;  4BBS I;  3Q87 A;  2QLV B;  3S1Q I;  4E2W A;  1S7M A;  1Q7Y 1;  4NBC A;  2F4O A;  3CCM 1;  1YI2 1;  1K83 I;  3CQZ I;  2QEX Z;  5FLX b;  3M3Y I;  3EED A;  4A3L I;  3CC2 1;  4RVH A;  1I3Q I;  3OW2 Z;  3NDI A;  3CXC Z;  1TWH I;  1USP A;  1KC8 2;  3CPW Y;  3H3V J;  1RQF A;  4S1T A;  2GTH A;  2JS4 A;  5T6B A;  1M90 2;  1Q82 1;  4A3D I;  2IZ3 A;  3NH4 A;  2OOX B;  4EWC A;  4A3G I;  3M4O I;  4NBE A;  2QA4 Z;  3CCV 1;  3QWU A;  3TDH B;  3G4S Z;  3CD6 Z;  3I56 1;  1Q81 1;  3CC4 Z;  4RVF A;  4A3I I;  3S2D I;  4E2Z A;  1NJI 1;  3GKQ A;  3CME Z;  3CCE 1;  2RT9 A;  3JAM b;  1VQ4 1;  2O4H A;  3NH5 A;  4DQY B;  4A3B I;  3GTO I;  2ZAE B;  2QEX 1;  3NH8 A;  1KD1 2;  1VQM Z;  1KRL A;  2M6N A;  1L1O C;  2R7Z I;  1YIJ Z;  1YJW 1;  2Y0S A;  1I50 I;  1YHQ 1;  1Y1W I;  3RZD I;  2Q51 A;  1VQL Z;  4RVG A;  1RO4 A;  5LL6 f;  4A3C I;  4BBR I;  2PM9 A;  2YU9 I;  3MZK B;  1VLA A;  5A2Q b;  1RNI A;  2YAD A;  1VQ9 Z;  3I55 Z;  3CCQ 1;  4DGL A;  3OW2 Y;  4BXX I;  3J81 b;  1S72 1;  2OTL 1;  3CXC Y;  1K73 2;  3S1R I;  1KQS Z;  4HGY A;  1Q7Y 2;  5IT9 b;  4NB8 A;  2F4M A;  1NUI A;  3CMA Z;  2JMO A;  3S2H I;  2G2K A;  3HOZ I;  4E2X A;  1YJ9 1;  2P3Y A;  3FQM A;  3CCU Z;  2VUG A;  4NFR A;  1VQN Z;  1ZB9 A;  1X3W A;  1YIJ 1;  5D1P A;  1VQP 1;  2Q4Z A;  5C44 I;  3FKI I;  2E2J I;  1YIT Z;  1VQ7 Z;  2RBL A;  4HGZ A;  1YJN Z;  1K8A 2;  1VQK 1;  5D1O B;  2DE7 A;  4NBF A;  3BG1 B;  1Q82 2;  3CCR Z;  2JA5 I;  4NOZ A;  3G71 Z;  3PO3 I;  1Q81 2;  1TWC I;  1VQ5 Z;  3I55 1;  4RS4 A;  3CCJ Z;  2JNY A;  4A93 I;  1NJI 2;  4Y52 I;  1W2B Z;  2LIY A;  2PMZ A;  3CCL Z;  3IFU A;  3GTJ I;  2VUM I;  3G6E 1;  4NBH A;  2EGT A;  1WCM I;  2M48 A;  1VQ6 Z;  3MON A;  2QRE B;  1TFI A;  1Y1V I;  1M1K 1;  2OTJ Z;  3S1M I;  3H0G I;  1Z02 A;  3VMG A;  1VQO Z;  2RIQ A;  3NFZ A;  2RPR A;  1QYP A;  1KQS Y;  2DE5 A;  3J80 f;  4A3J I;  3IF8 A;  1VQ8 Z;  4MXU A;  4A3K I;  3KIF A;  3GTM I;  3HKZ A;  1Q86 1;  1QVF Y;  1SFO I;  5CM2 M;  2KI7 B;  2K3R A;  2HU9 A;  4NB9 A;  4Y7N I;  3IX0 A;  3HOX I;  4MD9 A;  4E32 A;  1Z01 A;  1N2F A;  2HF1 A;  3HOV I;  3CCL 1;  2V8K A;  3VMI A;  3D9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...