2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein BB2007
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
1N2FA 2HF1A 2J6AA 4NBFA 1Y1VI 1SFOI 1WW9A 4A3DI 3S15I 3HOUI 1Y1VS 4NBBA 2R93I 3M4OI 4A3LI 3H0GI 4NOZA 4NBEA 3S1RI 2R92I 3HOXI 3RZDI 1R9TI 3HOWI 1RO4A 4BXXI 2NVXI 3S1QI 2RBLA 2JA6I 3GTPI 1PFTA 5FLMI 3S1MI 4A3II 4A93I 1WCMI 2NVQI 4NBDA 5IP7I 4A3KI 3PO2I 5C3EI 2E2HI 4BY1I 3GTJI 2DE5A 3GTLI 1ZB9A 3FKII 5IP9I 2E2JI 1X3ZA 3Q87A 2NVTI 3GKQA 3LUSA 2JNYA 3RZOI 1USPB 4NBGA 3ESWA 2F4MA 1I50I 2E2II 3D6WA 2JA8I 4NBHA 4X6AI 4A3CI 3I4MI 1L1OC 4BY7I 4XX2A 1I3QI 1TWFI 1RLYA 1NUIA 1X3WA 1DL6A 2DE6A 3GTQI 3U50C 3GTMI 4A3EI 4A3MI 3S17I 4QTTA 2F4OA 3EERA 2B63I 3GTOI 3GTMS 3S2HI 1ML8A 3S16I 3VMGA 2VUMI 4NB8A 5C4XI 1ZB8A 3M3YI 1Y1WI 2JA7I 3HOVI 3I07A 2KPIA 3CQZI 5CM2M 4A3JI 1YUAA 3VB9A 1TWCI 4Y7NI 3VMIA 1I6HI 2JS4A 2DE7A 3I4NI 1TWHI 2K5RA 1QYPA 4A3GI 4Y52I 4BBSI 4QTUA 1K83I 5C4JI 3H3VJ 3GTGI 2PK7A 4NBAA 1TWAI 3K7AI 2R7ZI 1USPA 1TWGI 2P3YA 3S1NI 4NBCA 3HOZI 3VMHA 4MH4A 3PO3I 2BJOA 2YU9I 2JA5I 1TFIA 3PO3S 1LQLA 2JR6A 4NB9A 3S2DI 3GCFA 2NVYI 4A3BI 3HOYI 4BBRI 1VLAA 5C44I 3S14I 4A3FI 2AKLA 3GTKI
chains in the Genus database with same CATH superfamily
1N2FA 2EGTA 2J6AA 2JIRA 4A3DI 1YIT1 3S15I 1Y1VS 3M4OI 1VQ8Z 3CPWY 3NH4A 1RO2A 3S1RI 2WAQA 3HOXI 1RO4A 3CCJZ 3GTPI 5FLMI 4A93I 1W2BY 2NVQI 4NBDA 4RVGA 2KI7B 4RV9A 2HU9A 3CCUZ 1N8R2 1KQSY 2ZAEB 2DE5A 4MD8A 5IP9I 2E2JI 1X3ZA 3GKQA 3LUSA 1M1K1 4NBGA 1K731 2LIYA 4NBHA 2GTHA 1Z02A 1L1OC 4XX2A 1K9M1 1Q811 3TE5B 3IF8A 2V45A 3GTMI 3D9XA 3J81f 1Y8CA 2V8KA 1YIJ1 3CD61 2VPWA 3G711 4NB8A 1YJNZ 1Y1WI 2QKDA 5T6BA 1VQ4Z 3HOVI 3MZKB 1VQO1 2NAPA 2PMZA 5A2Qf 1YUAA 3VB9A 1YIJZ 3CD6Z 3I4NI 1W2BZ 4BBSI 3H3VJ 3OW2Z 2R7ZI 3JAMf 1NJI2 1VQM1 2JIQA 3I561 3PO3S 2JR6A 3NFZA 4NB9A 5AN9F 1Q821 3S2DI 4MONA 2K3RA 5A2Qb 3HOYI 3S14I 4RS4A 5FLXf 2AKLA 3G4SZ 1P9NA 1YJ9Z 1VQN1 1M902 2VPZA 4RVDA 2Y0SA 3JAMb 3CCR1 1Q7Y2 2JIMA 1WW9A 3IFUA 2OTL1 1YJW1 3H0GI 2GU2A 1VQNZ 2LFUA 4NBEA 4NOZA 2VPXA 3RZDI 2VF1A 1VQ6Z 2RBLA 1AA6A 4E32A 2IV2X 3CCRZ 4NH1C 3S1MI 5FLXb 3EEDA 2JMOA 4A3II 2OTLZ 1WCMI 3CCSZ 1YI21 1VQP1 3CCJ1 4DQYB 1ZB9A 3FKII 1QVFZ 3CC41 1KD11 2RT9A 2RPRA 2V3VA 3TDHB 1YI2Z 1I50I 2JA8I 1RNIA 1VQPZ 3CCU1 5IT9f 2WB1A 1I3QI 2M6NA 5D1OB 1NUIA 3CC4Z 1KRLA 2OOXB 3GTQI 3U50C 2E9HA 4A3EI 3EERA 3GTOI 1ML8A 2IZ4A 3VMGA 4E2XA 4MRIA 5C4XI 1ZB8A 1Q16A 1FDOA 4TNUA 3NDJA 5IT9b 2PM9A 1QF8A 3CQZI 4A3JI 4E2YA 3VMIA 1WZNA 3NH5A 2O4HA 3CXCY 4RVFA 1QYPA 4Y52I 1YJN1 4MXUA 1K732 2PK7A 1VQ41 2W03A 1Z03A 1K9M2 1Q812 1S721 1Z01A 3VMHA 1VQL1 3FQQA 2RIQA 4E31A 3CPWZ 3QWUA 3GCFA 4E33A 4A3BI 3KIHA 4BBRI 1VLAA 1S72Z 5C44I 4MD7A 1VQ5Z 1VQ7Z 3F3FC 1YHQZ 2Q51A 1VQLZ 2IZ3A 3GTKI 3FQMA 3J81b 2HF1A 4NBFA 3BG1B 1Y1VI 1KQSZ 3HOUI 4NBBA 2R93I 1KC81 3G4S1 1YJ91 2I3CA 4S1TA 3HOWI 1NJI1 4BXXI 1SIWA 2NVXI 3VTNA 3S1QI 1FDIA 4HH4A 2M48A 4DGLA 3CXCZ 3CC7Z 1QVGY 1RQFA 3PO2I 3MZLB 1Q822 2OOYB 5T67A 4BY1I 3GTJI 1VQ61 2VPYA 1VQKZ 3Q87A 4E2ZA 3CCS1 1USPB 3ESWA 2YADA 2E2II 3D6WA 4AYBA 4X6AI 3P5JB 1WIIA 1RLYA 2QA4Z 3CC2Z 4EWCA 1DL6A 5D1PA 2P28A 3CMEZ 4A3MI 3S17I 1Q861 2LEXA 3GTMS 4E30A 3S2HI 2QRDB 3CCMZ 1K8A1 3M3YI 2JA7I 3I07A 3CMAZ 2KPIA 3CCLZ 2E7ZA 5CM2M 1TWCI 2Q4ZA 2K5RA 2QR1B 1KD12 1JWHC 2W04A 3G6EZ 4QTUA 1K83I 3IX0A 2JIPA 5C4JI 3GTGI 2JIOA 4NBAA 1TWAI 2QEXZ 3HKZA 2OTJ1 2VUGA 3HOZI 3CCQZ 1S7MA 2GTIA 3PO3I 3CCE1 2BJOA 2QRCB 2H85A 2JA5I 5D1OA 1LQLA 2NVYI 1N8R1 2OTJZ 2R6MA 3NH8A 5T64A 1YITZ 3CCEZ 3OW2Y 1M1K2 2G2KA 1JJ2Y 1SFOI 3I551 3IR7A 3F3PC 1VQ51 1VQ71 1YHQ1 4A3LI 4NFRA 3KIFA 2RHBA 2R92I 1R9TI 2JA6I 1PFTA 3I55Z 1QXFA 5IP7I 4A3KI 5C3EI 2E2HI 3J7A4 3GTLI 1NP6A 1ZH1A 1VQ91 2V8IA 2NVTI 3RZOI 2JNYA 3CC71 2F4MA 3BG0B 2QREB 4A3CI 3I4MI 4BY7I 1TWFI 2AYDA 4DK1A 3G71Z 1VQK1 1VQ9Z 1X3WA 1KC82 2DE6A 1YUKA 4MD9A 1RO0A 2V8JA 4QTTA 2F4OA 1VQOZ 2B63I 1JJ2Z 1QVFY 3S16I 2VUMI 2JUBA 1X0TA 3NDIA 4RVHA 2QA41 4HGYA 4CL1A 3CC21 3MONA 4HGZA 3J80f 3CME1 1M901 2O53A 1VQMZ 1I6HI 4Y7NI 1Q7Y1 2JS4A 2DE7A 1TWHI 3I56Z 4A3GI 3CCM1 4E2WA 5LL6f 3K7AI 3CMA1 1USPA 1TWGI 2P3YA 3CCL1 3S1NI 4NBCA 3D2LA 4MH4A 2YU9I 3G6E1 1TFIA 3J80b 3CCV1 1WJ2A 2OZKA 1Q862 2QEX1 2QLVB 3CCQ1 1YJWZ 4A3FI 3T4NB 1K8A2 1VQ81 3CCVZ 1QVGZ
chains in the Genus database with same CATH topology
1N2FA 2EGTA 2J6AA 4A3DI 1YIT1 3S15I 1Y1VS 3M4OI 1VQ8Z 3CPWY 3NH4A 1RO2A 3S1RI 2WAQA 3HOXI 1RO4A 3CCJZ 3GTPI 5FLMI 4A93I 1W2BY 2NVQI 4NBDA 4RVGA 2KI7B 4RV9A 2HU9A 3CCUZ 1N8R2 1KQSY 2ZAEB 2DE5A 4MD8A 5IP9I 2E2JI 1X3ZA 3GKQA 3LUSA 1M1K1 4NBGA 1K731 2LIYA 4NBHA 2GTHA 1Z02A 1L1OC 4XX2A 1K9M1 1Q811 3TE5B 3IF8A 3GTMI 3D9XA 3J81f 2V8KA 1YIJ1 3CD61 3G711 4NB8A 1YJNZ 1Y1WI 2QKDA 5T6BA 1VQ4Z 3HOVI 3MZKB 1VQO1 2PMZA 5A2Qf 1YUAA 3VB9A 1YIJZ 3CD6Z 3I4NI 1W2BZ 4BBSI 3H3VJ 3OW2Z 2R7ZI 3JAMf 1NJI2 1VQM1 3I561 3PO3S 2JR6A 3NFZA 4NB9A 5AN9F 1Q821 3S2DI 4MONA 2K3RA 5A2Qb 3HOYI 3S14I 4RS4A 5FLXf 2AKLA 3G4SZ 1P9NA 1YJ9Z 1VQN1 1M902 4RVDA 2Y0SA 3JAMb 3CCR1 1Q7Y2 1WW9A 3IFUA 2OTL1 1YJW1 3H0GI 2GU2A 1VQNZ 2LFUA 4NBEA 4NOZA 3RZDI 2VF1A 1VQ6Z 2RBLA 3CCRZ 4E32A 4NH1C 3S1MI 5FLXb 3EEDA 2JMOA 4A3II 2OTLZ 1WCMI 3CCSZ 1YI21 1VQP1 3CCJ1 4DQYB 1ZB9A 3FKII 1QVFZ 3CC41 1KD11 2RT9A 2RPRA 3TDHB 1YI2Z 1I50I 2JA8I 1RNIA 1VQPZ 3CCU1 5IT9f 2WB1A 1I3QI 2M6NA 5D1OB 1NUIA 3CC4Z 1KRLA 2OOXB 3GTQI 3U50C 2E9HA 4A3EI 3EERA 3GTOI 1ML8A 2IZ4A 3VMGA 4E2XA 4MRIA 5C4XI 1ZB8A 4TNUA 3NDJA 5IT9b 2PM9A 1QF8A 3CQZI 4A3JI 4E2YA 3VMIA 3NH5A 2O4HA 3CXCY 4RVFA 1QYPA 4Y52I 1YJN1 4MXUA 1K732 2PK7A 1VQ41 2W03A 1Z03A 1K9M2 1Q812 1S721 1Z01A 3VMHA 1VQL1 3FQQA 2RIQA 4E31A 3CPWZ 3QWUA 3GCFA 4E33A 4A3BI 3KIHA 4BBRI 1VLAA 1S72Z 5C44I 4MD7A 1VQ5Z 1VQ7Z 3F3FC 1YHQZ 2Q51A 1VQLZ 2IZ3A 3GTKI 3FQMA 3J81b 2HF1A 4NBFA 3BG1B 1Y1VI 1KQSZ 3HOUI 4NBBA 2R93I 1KC81 3G4S1 1YJ91 2I3CA 4S1TA 3HOWI 1NJI1 4BXXI 2NVXI 3S1QI 3VTNA 4HH4A 2M48A 4DGLA 3CXCZ 3CC7Z 1QVGY 1RQFA 3PO2I 3MZLB 1Q822 2OOYB 5T67A 4BY1I 3GTJI 1VQ61 1VQKZ 3Q87A 4E2ZA 3CCS1 1USPB 3ESWA 2YADA 2E2II 3D6WA 4AYBA 4X6AI 3P5JB 1WIIA 1RLYA 2QA4Z 3CC2Z 4EWCA 1DL6A 5D1PA 2P28A 3CMEZ 4A3MI 3S17I 1Q861 3GTMS 4E30A 3S2HI 2QRDB 3CCMZ 1K8A1 3M3YI 2JA7I 3I07A 3CMAZ 2KPIA 3CCLZ 5CM2M 1TWCI 2Q4ZA 2K5RA 2QR1B 1KD12 1JWHC 2W04A 3G6EZ 4QTUA 1K83I 3IX0A 5C4JI 3GTGI 4NBAA 1TWAI 2QEXZ 3HKZA 2OTJ1 2VUGA 3HOZI 3CCQZ 1S7MA 2GTIA 3PO3I 3CCE1 2BJOA 2QRCB 2H85A 2JA5I 5D1OA 1LQLA 2NVYI 1N8R1 2OTJZ 2R6MA 3NH8A 5T64A 1YITZ 3CCEZ 3OW2Y 1M1K2 2G2KA 1JJ2Y 1SFOI 3I551 3F3PC 1VQ51 1VQ71 1YHQ1 4A3LI 4NFRA 3KIFA 2RHBA 2R92I 1R9TI 2JA6I 1PFTA 3I55Z 5IP7I 4A3KI 5C3EI 2E2HI 3J7A4 3GTLI 1NP6A 1ZH1A 1VQ91 2V8IA 2NVTI 3RZOI 2JNYA 3CC71 2F4MA 3BG0B 2QREB 4A3CI 3I4MI 4BY7I 1TWFI 4DK1A 3G71Z 1VQK1 1VQ9Z 1X3WA 1KC82 2DE6A 1YUKA 4MD9A 1RO0A 2V8JA 4QTTA 2F4OA 1VQOZ 2B63I 1JJ2Z 1QVFY 3S16I 2VUMI 2JUBA 1X0TA 3NDIA 4RVHA 2QA41 4HGYA 4CL1A 3CC21 3MONA 4HGZA 3J80f 3CME1 1M901 2O53A 1VQMZ 1I6HI 4Y7NI 1Q7Y1 2JS4A 2DE7A 1TWHI 3I56Z 4A3GI 3CCM1 4E2WA 5LL6f 3K7AI 3CMA1 1USPA 1TWGI 2P3YA 3CCL1 3S1NI 4NBCA 4MH4A 2YU9I 3G6E1 1TFIA 3J80b 3CCV1 2OZKA 1Q862 2QEX1 2QLVB 3CCQ1 1YJWZ 4A3FI 3T4NB 1K8A2 1VQ81 3CCVZ 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  2HF1 A;  2J6A A;  4NBF A;  1Y1V I;  1SFO I;  1WW9 A;  4A3D I;  3S15 I;  3HOU I;  1Y1V S;  4NBB A;  2R93 I;  3M4O I;  4A3L I;  3H0G I;  4NOZ A;  4NBE A;  3S1R I;  2R92 I;  3HOX I;  3RZD I;  1R9T I;  3HOW I;  1RO4 A;  4BXX I;  2NVX I;  3S1Q I;  2RBL A;  2JA6 I;  3GTP I;  1PFT A;  5FLM I;  3S1M I;  4A3I I;  4A93 I;  1WCM I;  2NVQ I;  4NBD A;  5IP7 I;  4A3K I;  3PO2 I;  5C3E I;  2E2H I;  4BY1 I;  3GTJ I;  2DE5 A;  3GTL I;  1ZB9 A;  3FKI I;  5IP9 I;  2E2J I;  1X3Z A;  3Q87 A;  2NVT I;  3GKQ A;  3LUS A;  2JNY A;  3RZO I;  1USP B;  4NBG A;  3ESW A;  2F4M A;  1I50 I;  2E2I I;  3D6W A;  2JA8 I;  4NBH A;  4X6A I;  4A3C I;  3I4M I;  1L1O C;  4BY7 I;  4XX2 A;  1I3Q I;  1TWF I;  1RLY A;  1NUI A;  1X3W A;  1DL6 A;  2DE6 A;  3GTQ I;  3U50 C;  3GTM I;  4A3E I;  4A3M I;  3S17 I;  4QTT A;  2F4O A;  3EER A;  2B63 I;  3GTO I;  3GTM S;  3S2H I;  1ML8 A;  3S16 I;  3VMG A;  2VUM I;  4NB8 A;  5C4X I;  1ZB8 A;  3M3Y I;  1Y1W I;  2JA7 I;  3HOV I;  3I07 A;  2KPI A;  3CQZ I;  5CM2 M;  4A3J I;  1YUA A;  3VB9 A;  1TWC I;  4Y7N I;  3VMI A;  1I6H I;  2JS4 A;  2DE7 A;  3I4N I;  1TWH I;  2K5R A;  1QYP A;  4A3G I;  4Y52 I;  4BBS I;  4QTU A;  1K83 I;  5C4J I;  3H3V J;  3GTG I;  2PK7 A;  4NBA A;  1TWA I;  3K7A I;  2R7Z I;  1USP A;  1TWG I;  2P3Y A;  3S1N I;  4NBC A;  3HOZ I;  3VMH A;  4MH4 A;  3PO3 I;  2BJO A;  2YU9 I;  2JA5 I;  1TFI A;  3PO3 S;  1LQL A;  2JR6 A;  4NB9 A;  3S2D I;  3GCF A;  2NVY I;  4A3B I;  3HOY I;  4BBR I;  1VLA A;  5C44 I;  3S14 I;  4A3F I;  2AKL A;  3GTK I; 
#chains in the Genus database with same CATH topology
 1N2F A;  2EGT A;  2J6A A;  2JIR A;  4A3D I;  1YIT 1;  3S15 I;  1Y1V S;  3M4O I;  1VQ8 Z;  3CPW Y;  3NH4 A;  1RO2 A;  3S1R I;  2WAQ A;  3HOX I;  1RO4 A;  3CCJ Z;  3GTP I;  5FLM I;  4A93 I;  1W2B Y;  2NVQ I;  4NBD A;  4RVG A;  2KI7 B;  4RV9 A;  2HU9 A;  3CCU Z;  1N8R 2;  1KQS Y;  2ZAE B;  2DE5 A;  4MD8 A;  5IP9 I;  2E2J I;  1X3Z A;  3GKQ A;  3LUS A;  1M1K 1;  4NBG A;  1K73 1;  2LIY A;  4NBH A;  2GTH A;  1Z02 A;  1L1O C;  4XX2 A;  1K9M 1;  1Q81 1;  3TE5 B;  3IF8 A;  2V45 A;  3GTM I;  3D9X A;  3J81 f;  1Y8C A;  2V8K A;  1YIJ 1;  3CD6 1;  2VPW A;  3G71 1;  4NB8 A;  1YJN Z;  1Y1W I;  2QKD A;  5T6B A;  1VQ4 Z;  3HOV I;  3MZK B;  1VQO 1;  2NAP A;  2PMZ A;  5A2Q f;  1YUA A;  3VB9 A;  1YIJ Z;  3CD6 Z;  3I4N I;  1W2B Z;  4BBS I;  3H3V J;  3OW2 Z;  2R7Z I;  3JAM f;  1NJI 2;  1VQM 1;  2JIQ A;  3I56 1;  3PO3 S;  2JR6 A;  3NFZ A;  4NB9 A;  5AN9 F;  1Q82 1;  3S2D I;  4MON A;  2K3R A;  5A2Q b;  3HOY I;  3S14 I;  4RS4 A;  5FLX f;  2AKL A;  3G4S Z;  1P9N A;  1YJ9 Z;  1VQN 1;  1M90 2;  2VPZ A;  4RVD A;  2Y0S A;  3JAM b;  3CCR 1;  1Q7Y 2;  2JIM A;  1WW9 A;  3IFU A;  2OTL 1;  1YJW 1;  3H0G I;  2GU2 A;  1VQN Z;  2LFU A;  4NBE A;  4NOZ A;  2VPX A;  3RZD I;  2VF1 A;  1VQ6 Z;  2RBL A;  1AA6 A;  4E32 A;  2IV2 X;  3CCR Z;  4NH1 C;  3S1M I;  5FLX b;  3EED A;  2JMO A;  4A3I I;  2OTL Z;  1WCM I;  3CCS Z;  1YI2 1;  1VQP 1;  3CCJ 1;  4DQY B;  1ZB9 A;  3FKI I;  1QVF Z;  3CC4 1;  1KD1 1;  2RT9 A;  2RPR A;  2V3V A;  3TDH B;  1YI2 Z;  1I50 I;  2JA8 I;  1RNI A;  1VQP Z;  3CCU 1;  5IT9 f;  2WB1 A;  1I3Q I;  2M6N A;  5D1O B;  1NUI A;  3CC4 Z;  1KRL A;  2OOX B;  3GTQ I;  3U50 C;  2E9H A;  4A3E I;  3EER A;  3GTO I;  1ML8 A;  2IZ4 A;  3VMG A;  4E2X A;  4MRI A;  5C4X I;  1ZB8 A;  1Q16 A;  1FDO A;  4TNU A;  3NDJ A;  5IT9 b;  2PM9 A;  1QF8 A;  3CQZ I;  4A3J I;  4E2Y A;  3VMI A;  1WZN A;  3NH5 A;  2O4H A;  3CXC Y;  4RVF A;  1QYP A;  4Y52 I;  1YJN 1;  4MXU A;  1K73 2;  2PK7 A;  1VQ4 1;  2W03 A;  1Z03 A;  1K9M 2;  1Q81 2;  1S72 1;  1Z01 A;  3VMH A;  1VQL 1;  3FQQ A;  2RIQ A;  4E31 A;  3CPW Z;  3QWU A;  3GCF A;  4E33 A;  4A3B I;  3KIH A;  4BBR I;  1VLA A;  1S72 Z;  5C44 I;  4MD7 A;  1VQ5 Z;  1VQ7 Z;  3F3F C;  1YHQ Z;  2Q51 A;  1VQL Z;  2IZ3 A;  3GTK I;  3FQM A;  3J81 b;  2HF1 A;  4NBF A;  3BG1 B;  1Y1V I;  1KQS Z;  3HOU I;  4NBB A;  2R93 I;  1KC8 1;  3G4S 1;  1YJ9 1;  2I3C A;  4S1T A;  3HOW I;  1NJI 1;  4BXX I;  1SIW A;  2NVX I;  3VTN A;  3S1Q I;  1FDI A;  4HH4 A;  2M48 A;  4DGL A;  3CXC Z;  3CC7 Z;  1QVG Y;  1RQF A;  3PO2 I;  3MZL B;  1Q82 2;  2OOY B;  5T67 A;  4BY1 I;  3GTJ I;  1VQ6 1;  2VPY A;  1VQK Z;  3Q87 A;  4E2Z A;  3CCS 1;  1USP B;  3ESW A;  2YAD A;  2E2I I;  3D6W A;  4AYB A;  4X6A I;  3P5J B;  1WII A;  1RLY A;  2QA4 Z;  3CC2 Z;  4EWC A;  1DL6 A;  5D1P A;  2P28 A;  3CME Z;  4A3M I;  3S17 I;  1Q86 1;  2LEX A;  3GTM S;  4E30 A;  3S2H I;  2QRD B;  3CCM Z;  1K8A 1;  3M3Y I;  2JA7 I;  3I07 A;  3CMA Z;  2KPI A;  3CCL Z;  2E7Z A;  5CM2 M;  1TWC I;  2Q4Z A;  2K5R A;  2QR1 B;  1KD1 2;  1JWH C;  2W04 A;  3G6E Z;  4QTU A;  1K83 I;  3IX0 A;  2JIP A;  5C4J I;  3GTG I;  2JIO A;  4NBA A;  1TWA I;  2QEX Z;  3HKZ A;  2OTJ 1;  2VUG A;  3HOZ I;  3CCQ Z;  1S7M A;  2GTI A;  3PO3 I;  3CCE 1;  2BJO A;  2QRC B;  2H85 A;  2JA5 I;  5D1O A;  1LQL A;  2NVY I;  1N8R 1;  2OTJ Z;  2R6M A;  3NH8 A;  5T64 A;  1YIT Z;  3CCE Z;  3OW2 Y;  1M1K 2;  2G2K A;  1JJ2 Y;  1SFO I;  3I55 1;  3IR7 A;  3F3P C;  1VQ5 1;  1VQ7 1;  1YHQ 1;  4A3L I;  4NFR A;  3KIF A;  2RHB A;  2R92 I;  1R9T I;  2JA6 I;  1PFT A;  3I55 Z;  1QXF A;  5IP7 I;  4A3K I;  5C3E I;  2E2H I;  3J7A 4;  3GTL I;  1NP6 A;  1ZH1 A;  1VQ9 1;  2V8I A;  2NVT I;  3RZO I;  2JNY A;  3CC7 1;  2F4M A;  3BG0 B;  2QRE B;  4A3C I;  3I4M I;  4BY7 I;  1TWF I;  2AYD A;  4DK1 A;  3G71 Z;  1VQK 1;  1VQ9 Z;  1X3W A;  1KC8 2;  2DE6 A;  1YUK A;  4MD9 A;  1RO0 A;  2V8J A;  4QTT A;  2F4O A;  1VQO Z;  2B63 I;  1JJ2 Z;  1QVF Y;  3S16 I;  2VUM I;  2JUB A;  1X0T A;  3NDI A;  4RVH A;  2QA4 1;  4HGY A;  4CL1 A;  3CC2 1;  3MON A;  4HGZ A;  3J80 f;  3CME 1;  1M90 1;  2O53 A;  1VQM Z;  1I6H I;  4Y7N I;  1Q7Y 1;  2JS4 A;  2DE7 A;  1TWH I;  3I56 Z;  4A3G I;  3CCM 1;  4E2W A;  5LL6 f;  3K7A I;  3CMA 1;  1USP A;  1TWG I;  2P3Y A;  3CCL 1;  3S1N I;  4NBC A;  3D2L A;  4MH4 A;  2YU9 I;  3G6E 1;  1TFI A;  3J80 b;  3CCV 1;  1WJ2 A;  2OZK A;  1Q86 2;  2QEX 1;  2QLV B;  3CCQ 1;  1YJW Z;  4A3F I;  3T4N B;  1K8A 2;  1VQ8 1;  3CCV Z;  1QVG Z; 
#chains in the Genus database with same CATH homology
 1N2F A;  2EGT A;  2J6A A;  4A3D I;  1YIT 1;  3S15 I;  1Y1V S;  3M4O I;  1VQ8 Z;  3CPW Y;  3NH4 A;  1RO2 A;  3S1R I;  2WAQ A;  3HOX I;  1RO4 A;  3CCJ Z;  3GTP I;  5FLM I;  4A93 I;  1W2B Y;  2NVQ I;  4NBD A;  4RVG A;  2KI7 B;  4RV9 A;  2HU9 A;  3CCU Z;  1N8R 2;  1KQS Y;  2ZAE B;  2DE5 A;  4MD8 A;  5IP9 I;  2E2J I;  1X3Z A;  3GKQ A;  3LUS A;  1M1K 1;  4NBG A;  1K73 1;  2LIY A;  4NBH A;  2GTH A;  1Z02 A;  1L1O C;  4XX2 A;  1K9M 1;  1Q81 1;  3TE5 B;  3IF8 A;  3GTM I;  3D9X A;  3J81 f;  2V8K A;  1YIJ 1;  3CD6 1;  3G71 1;  4NB8 A;  1YJN Z;  1Y1W I;  2QKD A;  5T6B A;  1VQ4 Z;  3HOV I;  3MZK B;  1VQO 1;  2PMZ A;  5A2Q f;  1YUA A;  3VB9 A;  1YIJ Z;  3CD6 Z;  3I4N I;  1W2B Z;  4BBS I;  3H3V J;  3OW2 Z;  2R7Z I;  3JAM f;  1NJI 2;  1VQM 1;  3I56 1;  3PO3 S;  2JR6 A;  3NFZ A;  4NB9 A;  5AN9 F;  1Q82 1;  3S2D I;  4MON A;  2K3R A;  5A2Q b;  3HOY I;  3S14 I;  4RS4 A;  5FLX f;  2AKL A;  3G4S Z;  1P9N A;  1YJ9 Z;  1VQN 1;  1M90 2;  4RVD A;  2Y0S A;  3JAM b;  3CCR 1;  1Q7Y 2;  1WW9 A;  3IFU A;  2OTL 1;  1YJW 1;  3H0G I;  2GU2 A;  1VQN Z;  2LFU A;  4NBE A;  4NOZ A;  3RZD I;  2VF1 A;  1VQ6 Z;  2RBL A;  3CCR Z;  4E32 A;  4NH1 C;  3S1M I;  5FLX b;  3EED A;  2JMO A;  4A3I I;  2OTL Z;  1WCM I;  3CCS Z;  1YI2 1;  1VQP 1;  3CCJ 1;  4DQY B;  1ZB9 A;  3FKI I;  1QVF Z;  3CC4 1;  1KD1 1;  2RT9 A;  2RPR A;  3TDH B;  1YI2 Z;  1I50 I;  2JA8 I;  1RNI A;  1VQP Z;  3CCU 1;  5IT9 f;  2WB1 A;  1I3Q I;  2M6N A;  5D1O B;  1NUI A;  3CC4 Z;  1KRL A;  2OOX B;  3GTQ I;  3U50 C;  2E9H A;  4A3E I;  3EER A;  3GTO I;  1ML8 A;  2IZ4 A;  3VMG A;  4E2X A;  4MRI A;  5C4X I;  1ZB8 A;  4TNU A;  3NDJ A;  5IT9 b;  2PM9 A;  1QF8 A;  3CQZ I;  4A3J I;  4E2Y A;  3VMI A;  3NH5 A;  2O4H A;  3CXC Y;  4RVF A;  1QYP A;  4Y52 I;  1YJN 1;  4MXU A;  1K73 2;  2PK7 A;  1VQ4 1;  2W03 A;  1Z03 A;  1K9M 2;  1Q81 2;  1S72 1;  1Z01 A;  3VMH A;  1VQL 1;  3FQQ A;  2RIQ A;  4E31 A;  3CPW Z;  3QWU A;  3GCF A;  4E33 A;  4A3B I;  3KIH A;  4BBR I;  1VLA A;  1S72 Z;  5C44 I;  4MD7 A;  1VQ5 Z;  1VQ7 Z;  3F3F C;  1YHQ Z;  2Q51 A;  1VQL Z;  2IZ3 A;  3GTK I;  3FQM A;  3J81 b;  2HF1 A;  4NBF A;  3BG1 B;  1Y1V I;  1KQS Z;  3HOU I;  4NBB A;  2R93 I;  1KC8 1;  3G4S 1;  1YJ9 1;  2I3C A;  4S1T A;  3HOW I;  1NJI 1;  4BXX I;  2NVX I;  3S1Q I;  3VTN A;  4HH4 A;  2M48 A;  4DGL A;  3CXC Z;  3CC7 Z;  1QVG Y;  1RQF A;  3PO2 I;  3MZL B;  1Q82 2;  2OOY B;  5T67 A;  4BY1 I;  3GTJ I;  1VQ6 1;  1VQK Z;  3Q87 A;  4E2Z A;  3CCS 1;  1USP B;  3ESW A;  2YAD A;  2E2I I;  3D6W A;  4AYB A;  4X6A I;  3P5J B;  1WII A;  1RLY A;  2QA4 Z;  3CC2 Z;  4EWC A;  1DL6 A;  5D1P A;  2P28 A;  3CME Z;  4A3M I;  3S17 I;  1Q86 1;  3GTM S;  4E30 A;  3S2H I;  2QRD B;  3CCM Z;  1K8A 1;  3M3Y I;  2JA7 I;  3I07 A;  3CMA Z;  2KPI A;  3CCL Z;  5CM2 M;  1TWC I;  2Q4Z A;  2K5R A;  2QR1 B;  1KD1 2;  1JWH C;  2W04 A;  3G6E Z;  4QTU A;  1K83 I;  3IX0 A;  5C4J I;  3GTG I;  4NBA A;  1TWA I;  2QEX Z;  3HKZ A;  2OTJ 1;  2VUG A;  3HOZ I;  3CCQ Z;  1S7M A;  2GTI A;  3PO3 I;  3CCE 1;  2BJO A;  2QRC B;  2H85 A;  2JA5 I;  5D1O A;  1LQL A;  2NVY I;  1N8R 1;  2OTJ Z;  2R6M A;  3NH8 A;  5T64 A;  1YIT Z;  3CCE Z;  3OW2 Y;  1M1K 2;  2G2K A;  1JJ2 Y;  1SFO I;  3I55 1;  3F3P C;  1VQ5 1;  1VQ7 1;  1YHQ 1;  4A3L I;  4NFR A;  3KIF A;  2RHB A;  2R92 I;  1R9T I;  2JA6 I;  1PFT A;  3I55 Z;  5IP7 I;  4A3K I;  5C3E I;  2E2H I;  3J7A 4;  3GTL I;  1NP6 A;  1ZH1 A;  1VQ9 1;  2V8I A;  2NVT I;  3RZO I;  2JNY A;  3CC7 1;  2F4M A;  3BG0 B;  2QRE B;  4A3C I;  3I4M I;  4BY7 I;  1TWF I;  4DK1 A;  3G71 Z;  1VQK 1;  1VQ9 Z;  1X3W A;  1KC8 2;  2DE6 A;  1YUK A;  4MD9 A;  1RO0 A;  2V8J A;  4QTT A;  2F4O A;  1VQO Z;  2B63 I;  1JJ2 Z;  1QVF Y;  3S16 I;  2VUM I;  2JUB A;  1X0T A;  3NDI A;  4RVH A;  2QA4 1;  4HGY A;  4CL1 A;  3CC2 1;  3MON A;  4HGZ A;  3J80 f;  3CME 1;  1M90 1;  2O53 A;  1VQM Z;  1I6H I;  4Y7N I;  1Q7Y 1;  2JS4 A;  2DE7 A;  1TWH I;  3I56 Z;  4A3G I;  3CCM 1;  4E2W A;  5LL6 f;  3K7A I;  3CMA 1;  1USP A;  1TWG I;  2P3Y A;  3CCL 1;  3S1N I;  4NBC A;  4MH4 A;  2YU9 I;  3G6E 1;  1TFI A;  3J80 b;  3CCV 1;  2OZK A;  1Q86 2;  2QEX 1;  2QLV B;  3CCQ 1;  1YJW Z;  4A3F I;  3T4N B;  1K8A 2;  1VQ8 1;  3CCV Z;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...