2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein BB2007
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
4NB8A 1VLAA 5IP7I 4NBGA 4A3KI 1X3WA 3CQZI 3D6WA 4NBDA 2R92I 1ML8A 1TWFI 3PO3I 3S15I 2DE6A 2JA8I 2DE5A 3H3VJ 3S2HI 1USPB 3S1MI 3HOYI 2JS4A 1YUAA 3GTQI 5FLMI 4A3LI 3GKQA 4BXXI 4MH4A 3S14I 3GTOI 1X3ZA 4NBFA 1I6HI 2R93I 3U50C 3Q87A 2RBLA 4A3CI 3HOUI 3ESWA 3VB9A 4BBSI 2DE7A 3GTKI 2F4MA 4NBEA 3GTGI 2JR6A 1R9TI 3VMHA 1SFOI 5IP9I 2F4OA 1I50I 2P3YA 5CM2M 1PFTA 4A3EI 2E2HI 4X6AI 4NBHA 2NVQI 3H0GI 1Y1VS 2VUMI 3K7AI 4A93I 4Y52I 2K5RA 2AKLA 1USPA 2R7ZI 1TWHI 1DL6A 3S1QI 4NBBA 2NVYI 2JA7I 2B63I 3HOXI 3I07A 2YU9I 4BY1I 1QYPA 3GCFA 3GTMI 4NBCA 2NVTI 3GTJI 1TWCI 2E2JI 1K83I 4Y7NI 4A3FI 3I4MI 5C3EI 3RZOI 3I4NI 1RLYA 3PO3S 3S17I 1L1OC 3S16I 5C4XI 1ZB9A 3GTLI 2J6AA 1TFIA 5C44I 5C4JI 1WCMI 4BBRI 1NUIA 4NBAA 3HOVI 3S2DI 4A3GI 1Y1WI 1TWGI 2BJOA 2NVXI 4QTTA 4QTUA 2KPIA 3HOWI 4A3MI 4A3DI 3LUSA 4A3II 4BY7I 4XX2A 2E2II 4A3JI 3HOZI 1ZB8A 2JA5I 1RO4A 1I3QI 3VMIA 1LQLA 2JNYA 1Y1VI 3FKII 2JA6I 3M4OI 2HF1A 4A3BI 3GTPI 3PO2I 3M3YI 2PK7A 4NB9A 3VMGA 3S1RI 3EERA 3GTMS 3S1NI 1TWAI 1N2FA 4NOZA 1WW9A 3RZDI
chains in the Genus database with same CATH superfamily
2EGTA 3CC2Z 1VQ4Z 3I55Z 4MD9A 2R92I 3J7A4 3CMAZ 1M902 3H3VJ 3OW2Y 3S2HI 1USPB 3MZLB 3HOYI 2JS4A 3TDHB 1YUAA 1YI21 1JJ2Y 4A3LI 3GKQA 1VQ5Z 3FQQA 3GTOI 2M6NA 4RVGA 1YJN1 1M901 2R93I 1JJ2Z 3GTKI 5T64A 1R9TI 1Z01A 2F4OA 2YADA 1PFTA 4A3EI 4X6AI 2Q4ZA 3H0GI 1Y1VS 3K7AI 3NH8A 1S7MA 3FQMA 2OOXB 3F3FC 1RO0A 1NP6A 4BY1I 1YJWZ 2ZAEB 2GU2A 5IT9f 2E2JI 2AYDA 4A3FI 2IZ4A 1QVFY 3PO3S 3S17I 3CCM1 2O4HA 5C4XI 2KI7B 5A2Qf 1QVFZ 1WCMI 4BBRI 1Q7Y2 3CCQZ 3CD61 4A3GI 2VUGA 1TWGI 2BJOA 2NVXI 1KD12 1Q822 3HOWI 3G71Z 1N8R2 4A3JI 3G6EZ 3JAMb 3NDJA 2JA5I 2QR1B 1VQ7Z 3CCV1 1KD11 2I3CA 1Q821 3VMIA 1N8R1 3CC41 1LQLA 2P28A 1Y1VI 1RNIA 2QRCB 2JA6I 3M4OI 2VPXA 1VQPZ 4A3BI 2OTL1 2OOYB 1YIJZ 1WZNA 3S1NI 3CCRZ 2K3RA 3MONA 2M48A 1WW9A 3NDIA 3RZDI 3G4SZ 4RVDA 1M1K1 4A3KI 4NFRA 1ML8A 3PO3I 1VQLZ 2DE5A 5A2Qb 1KRLA 3I551 1YITZ 2JIMA 3D2LA 4MH4A 2QEXZ 1X3ZA 4NBFA 1I6HI 1S72Z 2QA41 4DQYB 3P5JB 3U50C 2RBLA 1RO2A 4MONA 1FDIA 3CCUZ 3VTNA 1SFOI 2OTJZ 2E9HA 2VF1A 2P3YA 2NVQI 2VUMI 1VQOZ 1VQ9Z 4Y52I 1VQN1 1RQFA 1USPA 1DL6A 4E31A 4NBBA 4RVHA 2JA7I 3I07A 3CME1 3CXCY 3GCFA 1K9M2 3CXCZ 3I4MI 3JAMf 5D1OA 3I4NI 1RLYA 4HGYA 1JWHC 1L1OC 5T67A 4CL1A 1ZB9A 3EEDA 1K9M1 1K8A2 1VQ81 2J6AA 1YHQZ 3NFZA 5C44I 5C4JI 2RPRA 1VQMZ 1VQ61 4EWCA 1NUIA 4NBAA 1YJ91 2R6MA 2VPWA 4QTUA 2KPIA 1FDOA 1K8A1 4A3MI 4A3DI 4A3II 3CC71 2W04A 4XX2A 2Y0SA 5D1PA 3HOZI 1ZB8A 4E2YA 1NJI1 1RO4A 3F3PC 1YI2Z 1I3QI 4RS4A 2G2KA 2JNYA 2V45A 3FKII 1Q862 1VQK1 1X0TA 3PO2I 2PK7A 4MRIA 3VMGA 1ZH1A 3EERA 1Q861 1Z03A 1QXFA 3KIHA 3I561 3CPWY 4NOZA 1YIJ1 3D9XA 1WIIA 4NB8A 1P9NA 4NBGA 5FLXf 3CCR1 3CPWZ 3CQZI 3CCS1 4NBDA 2RHBA 1TWFI 3S15I 3G4S1 2O53A 2DE6A 1QVGZ 3GTQI 2VPYA 5FLMI 1KC82 3S14I 1M1K2 3Q87A 4A3CI 1YIT1 3HOUI 3ESWA 4BBSI 3CCL1 5LL6f 1YUKA 2QEX1 3CCMZ 2RIQA 1KC81 3VMHA 1SIWA 1Z02A 5CM2M 3BG1B 3CCE1 4A93I 3CD6Z 3CCU1 2RT9A 2JUBA 5T6BA 3CC21 1VQ41 3S1QI 3CMA1 1K731 2NVYI 1Q812 2JMOA 2OZKA 3KIFA 2LEXA 2V3VA 1QYPA 2HU9A 4E2XA 2NVTI 1VQ51 3CC4Z 1K83I 1Q811 4Y7NI 5C3EI 2Q51A 4DGLA 5FLXb 2JIPA 3S16I 2IV2X 4MD8A 3GTLI 1TFIA 3J81b 2W03A 2E7ZA 2PMZA 1W2BY 2IZ3A 4E30A 3CCJZ 2LIYA 3IR7A 1YJW1 2QRDB 2JIOA 1W2BZ 3IX0A 2QA4Z 2QKDA 3J80f 2HF1A 3GTPI 2GTHA 1WJ2A 4E32A 3OW2Z 4S1TA 4NB9A 2WAQA 4HGZA 4E2ZA 3S1RI 3GTMS 4TNUA 1NJI2 1TWAI 2JIRA 2V8JA 1N2FA 3IF8A 3CCQ1 1VQNZ 5D1OB 1VLAA 5IP7I 1X3WA 3D6WA 3G711 1YJNZ 2JA8I 3S1MI 3G6E1 3CMEZ 1VQ71 4BXXI 2JIQA 1VQP1 3VB9A 2H85A 2DE7A 2F4MA 4NBEA 3GTGI 2JR6A 3IFUA 5IP9I 1VQ8Z 4E33A 1I50I 1VQ6Z 2E2HI 4NBHA 1QVGY 1YJ9Z 1KQSY 2K5RA 4NH1C 2AKLA 2R7ZI 3J80b 1TWHI 3J81f 3NH5A 5AN9F 1KQSZ 2V8KA 3CC7Z 2GTIA 2B63I 4AYBA 1VQL1 3HOXI 2YU9I 3BG0B 3GTMI 4NBCA 2LFUA 3GTJI 1TWCI 1Q7Y1 1S721 4DK1A 1Q16A 3RZOI 1VQKZ 3QWUA 1K732 1Y8CA 1QF8A 3T4NB 2WB1A 2OTJ1 3MZKB 3I56Z 2VPZA 3NH4A 1VQO1 3HOVI 1VQ91 3S2DI 1Y1WI 4RV9A 2QREB 4HH4A 4QTTA 3CCSZ 3LUSA 3CCVZ 5IT9b 4E2WA 4BY7I 4MD7A 2E2II 2NAPA 2PM9A 4MXUA 4RVFA 2OTLZ 2QLVB 3CCJ1 3TE5B 3CCLZ 2V8IA 3HKZA 1AA6A 3M3YI 1YHQ1 1VQM1 3CCEZ
chains in the Genus database with same CATH topology
2EGTA 3CC2Z 1VQ4Z 3I55Z 4MD9A 2R92I 3J7A4 3CMAZ 1M902 3H3VJ 3OW2Y 3S2HI 1USPB 3MZLB 3HOYI 2JS4A 3TDHB 1YUAA 1YI21 1JJ2Y 4A3LI 3GKQA 1VQ5Z 3FQQA 3GTOI 2M6NA 4RVGA 1YJN1 1M901 2R93I 1JJ2Z 3GTKI 5T64A 1R9TI 1Z01A 2F4OA 2YADA 1PFTA 4A3EI 4X6AI 2Q4ZA 3H0GI 1Y1VS 3K7AI 3NH8A 1S7MA 3FQMA 2OOXB 3F3FC 1RO0A 1NP6A 4BY1I 1YJWZ 2ZAEB 2GU2A 5IT9f 2E2JI 4A3FI 2IZ4A 1QVFY 3PO3S 3S17I 3CCM1 2O4HA 5C4XI 2KI7B 5A2Qf 1QVFZ 1WCMI 4BBRI 1Q7Y2 3CCQZ 3CD61 4A3GI 2VUGA 1TWGI 2BJOA 2NVXI 1KD12 1Q822 3HOWI 3G71Z 1N8R2 4A3JI 3G6EZ 3JAMb 3NDJA 2JA5I 2QR1B 1VQ7Z 3CCV1 1KD11 2I3CA 1Q821 3VMIA 1N8R1 3CC41 1LQLA 2P28A 1Y1VI 1RNIA 2QRCB 2JA6I 3M4OI 1VQPZ 4A3BI 2OTL1 2OOYB 1YIJZ 3S1NI 3CCRZ 2K3RA 3MONA 2M48A 1WW9A 3NDIA 3RZDI 3G4SZ 4RVDA 1M1K1 4A3KI 4NFRA 1ML8A 3PO3I 1VQLZ 2DE5A 5A2Qb 1KRLA 3I551 1YITZ 4MH4A 2QEXZ 1X3ZA 4NBFA 1I6HI 1S72Z 2QA41 4DQYB 3P5JB 3U50C 2RBLA 1RO2A 4MONA 3CCUZ 3VTNA 1SFOI 2OTJZ 2E9HA 2VF1A 2P3YA 2NVQI 2VUMI 1VQOZ 1VQ9Z 4Y52I 1VQN1 1RQFA 1USPA 1DL6A 4E31A 4NBBA 4RVHA 2JA7I 3I07A 3CME1 3CXCY 3GCFA 1K9M2 3CXCZ 3I4MI 3JAMf 5D1OA 3I4NI 1RLYA 4HGYA 1JWHC 1L1OC 5T67A 4CL1A 1ZB9A 3EEDA 1K9M1 1K8A2 1VQ81 2J6AA 1YHQZ 3NFZA 5C44I 5C4JI 2RPRA 1VQMZ 1VQ61 4EWCA 1NUIA 4NBAA 1YJ91 2R6MA 4QTUA 2KPIA 1K8A1 4A3MI 4A3DI 4A3II 3CC71 2W04A 4XX2A 2Y0SA 5D1PA 3HOZI 1ZB8A 4E2YA 1NJI1 1RO4A 3F3PC 1YI2Z 1I3QI 4RS4A 2G2KA 2JNYA 3FKII 1Q862 1VQK1 1X0TA 3PO2I 2PK7A 4MRIA 3VMGA 1ZH1A 3EERA 1Q861 1Z03A 3KIHA 3I561 3CPWY 4NOZA 1YIJ1 3D9XA 1WIIA 4NB8A 1P9NA 4NBGA 5FLXf 3CCR1 3CPWZ 3CQZI 3CCS1 4NBDA 2RHBA 1TWFI 3S15I 3G4S1 2O53A 2DE6A 1QVGZ 3GTQI 5FLMI 1KC82 3S14I 1M1K2 3Q87A 4A3CI 1YIT1 3HOUI 3ESWA 4BBSI 3CCL1 5LL6f 1YUKA 2QEX1 3CCMZ 2RIQA 1KC81 3VMHA 1Z02A 5CM2M 3BG1B 3CCE1 4A93I 3CD6Z 3CCU1 2RT9A 2JUBA 5T6BA 3CC21 1VQ41 3S1QI 3CMA1 1K731 2NVYI 1Q812 2JMOA 2OZKA 3KIFA 1QYPA 2HU9A 4E2XA 2NVTI 1VQ51 3CC4Z 1K83I 1Q811 4Y7NI 5C3EI 2Q51A 4DGLA 5FLXb 3S16I 4MD8A 3GTLI 1TFIA 3J81b 2W03A 2PMZA 1W2BY 2IZ3A 4E30A 3CCJZ 2LIYA 1YJW1 2QRDB 1W2BZ 3IX0A 2QKDA 2QA4Z 3J80f 2HF1A 3GTPI 2GTHA 4E32A 3OW2Z 4S1TA 4NB9A 2WAQA 4HGZA 4E2ZA 3S1RI 3GTMS 4TNUA 1NJI2 1TWAI 2V8JA 1N2FA 3IF8A 3CCQ1 1VQNZ 5D1OB 1VLAA 5IP7I 1X3WA 3D6WA 3G711 1YJNZ 2JA8I 3S1MI 3G6E1 3CMEZ 1VQ71 4BXXI 1VQP1 3VB9A 2H85A 2DE7A 2F4MA 4NBEA 3GTGI 2JR6A 3IFUA 5IP9I 1VQ8Z 4E33A 1I50I 1VQ6Z 2E2HI 4NBHA 1QVGY 1YJ9Z 1KQSY 2K5RA 4NH1C 2AKLA 2R7ZI 3J80b 1TWHI 3J81f 3NH5A 5AN9F 1KQSZ 2V8KA 3CC7Z 2GTIA 2B63I 4AYBA 1VQL1 3HOXI 2YU9I 3BG0B 3GTMI 4NBCA 2LFUA 3GTJI 1TWCI 1Q7Y1 1S721 4DK1A 3RZOI 1VQKZ 3QWUA 1K732 1QF8A 3T4NB 2WB1A 2OTJ1 3MZKB 3I56Z 3NH4A 1VQO1 3HOVI 1VQ91 3S2DI 1Y1WI 4RV9A 2QREB 4HH4A 4QTTA 3CCSZ 3LUSA 3CCVZ 5IT9b 4E2WA 4BY7I 4MD7A 2E2II 2PM9A 4MXUA 4RVFA 2OTLZ 2QLVB 3CCJ1 3TE5B 3CCLZ 2V8IA 3HKZA 3M3YI 1YHQ1 1VQM1 3CCEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB8 A;  1VLA A;  5IP7 I;  4NBG A;  4A3K I;  1X3W A;  3CQZ I;  3D6W A;  4NBD A;  2R92 I;  1ML8 A;  1TWF I;  3PO3 I;  3S15 I;  2DE6 A;  2JA8 I;  2DE5 A;  3H3V J;  3S2H I;  1USP B;  3S1M I;  3HOY I;  2JS4 A;  1YUA A;  3GTQ I;  5FLM I;  4A3L I;  3GKQ A;  4BXX I;  4MH4 A;  3S14 I;  3GTO I;  1X3Z A;  4NBF A;  1I6H I;  2R93 I;  3U50 C;  3Q87 A;  2RBL A;  4A3C I;  3HOU I;  3ESW A;  3VB9 A;  4BBS I;  2DE7 A;  3GTK I;  2F4M A;  4NBE A;  3GTG I;  2JR6 A;  1R9T I;  3VMH A;  1SFO I;  5IP9 I;  2F4O A;  1I50 I;  2P3Y A;  5CM2 M;  1PFT A;  4A3E I;  2E2H I;  4X6A I;  4NBH A;  2NVQ I;  3H0G I;  1Y1V S;  2VUM I;  3K7A I;  4A93 I;  4Y52 I;  2K5R A;  2AKL A;  1USP A;  2R7Z I;  1TWH I;  1DL6 A;  3S1Q I;  4NBB A;  2NVY I;  2JA7 I;  2B63 I;  3HOX I;  3I07 A;  2YU9 I;  4BY1 I;  1QYP A;  3GCF A;  3GTM I;  4NBC A;  2NVT I;  3GTJ I;  1TWC I;  2E2J I;  1K83 I;  4Y7N I;  4A3F I;  3I4M I;  5C3E I;  3RZO I;  3I4N I;  1RLY A;  3PO3 S;  3S17 I;  1L1O C;  3S16 I;  5C4X I;  1ZB9 A;  3GTL I;  2J6A A;  1TFI A;  5C44 I;  5C4J I;  1WCM I;  4BBR I;  1NUI A;  4NBA A;  3HOV I;  3S2D I;  4A3G I;  1Y1W I;  1TWG I;  2BJO A;  2NVX I;  4QTT A;  4QTU A;  2KPI A;  3HOW I;  4A3M I;  4A3D I;  3LUS A;  4A3I I;  4BY7 I;  4XX2 A;  2E2I I;  4A3J I;  3HOZ I;  1ZB8 A;  2JA5 I;  1RO4 A;  1I3Q I;  3VMI A;  1LQL A;  2JNY A;  1Y1V I;  3FKI I;  2JA6 I;  3M4O I;  2HF1 A;  4A3B I;  3GTP I;  3PO2 I;  3M3Y I;  2PK7 A;  4NB9 A;  3VMG A;  3S1R I;  3EER A;  3GTM S;  3S1N I;  1TWA I;  1N2F A;  4NOZ A;  1WW9 A;  3RZD I; 
#chains in the Genus database with same CATH topology
 2EGT A;  3CC2 Z;  1VQ4 Z;  3I55 Z;  4MD9 A;  2R92 I;  3J7A 4;  3CMA Z;  1M90 2;  3H3V J;  3OW2 Y;  3S2H I;  1USP B;  3MZL B;  3HOY I;  2JS4 A;  3TDH B;  1YUA A;  1YI2 1;  1JJ2 Y;  4A3L I;  3GKQ A;  1VQ5 Z;  3FQQ A;  3GTO I;  2M6N A;  4RVG A;  1YJN 1;  1M90 1;  2R93 I;  1JJ2 Z;  3GTK I;  5T64 A;  1R9T I;  1Z01 A;  2F4O A;  2YAD A;  1PFT A;  4A3E I;  4X6A I;  2Q4Z A;  3H0G I;  1Y1V S;  3K7A I;  3NH8 A;  1S7M A;  3FQM A;  2OOX B;  3F3F C;  1RO0 A;  1NP6 A;  4BY1 I;  1YJW Z;  2ZAE B;  2GU2 A;  5IT9 f;  2E2J I;  2AYD A;  4A3F I;  2IZ4 A;  1QVF Y;  3PO3 S;  3S17 I;  3CCM 1;  2O4H A;  5C4X I;  2KI7 B;  5A2Q f;  1QVF Z;  1WCM I;  4BBR I;  1Q7Y 2;  3CCQ Z;  3CD6 1;  4A3G I;  2VUG A;  1TWG I;  2BJO A;  2NVX I;  1KD1 2;  1Q82 2;  3HOW I;  3G71 Z;  1N8R 2;  4A3J I;  3G6E Z;  3JAM b;  3NDJ A;  2JA5 I;  2QR1 B;  1VQ7 Z;  3CCV 1;  1KD1 1;  2I3C A;  1Q82 1;  3VMI A;  1N8R 1;  3CC4 1;  1LQL A;  2P28 A;  1Y1V I;  1RNI A;  2QRC B;  2JA6 I;  3M4O I;  2VPX A;  1VQP Z;  4A3B I;  2OTL 1;  2OOY B;  1YIJ Z;  1WZN A;  3S1N I;  3CCR Z;  2K3R A;  3MON A;  2M48 A;  1WW9 A;  3NDI A;  3RZD I;  3G4S Z;  4RVD A;  1M1K 1;  4A3K I;  4NFR A;  1ML8 A;  3PO3 I;  1VQL Z;  2DE5 A;  5A2Q b;  1KRL A;  3I55 1;  1YIT Z;  2JIM A;  3D2L A;  4MH4 A;  2QEX Z;  1X3Z A;  4NBF A;  1I6H I;  1S72 Z;  2QA4 1;  4DQY B;  3P5J B;  3U50 C;  2RBL A;  1RO2 A;  4MON A;  1FDI A;  3CCU Z;  3VTN A;  1SFO I;  2OTJ Z;  2E9H A;  2VF1 A;  2P3Y A;  2NVQ I;  2VUM I;  1VQO Z;  1VQ9 Z;  4Y52 I;  1VQN 1;  1RQF A;  1USP A;  1DL6 A;  4E31 A;  4NBB A;  4RVH A;  2JA7 I;  3I07 A;  3CME 1;  3CXC Y;  3GCF A;  1K9M 2;  3CXC Z;  3I4M I;  3JAM f;  5D1O A;  3I4N I;  1RLY A;  4HGY A;  1JWH C;  1L1O C;  5T67 A;  4CL1 A;  1ZB9 A;  3EED A;  1K9M 1;  1K8A 2;  1VQ8 1;  2J6A A;  1YHQ Z;  3NFZ A;  5C44 I;  5C4J I;  2RPR A;  1VQM Z;  1VQ6 1;  4EWC A;  1NUI A;  4NBA A;  1YJ9 1;  2R6M A;  2VPW A;  4QTU A;  2KPI A;  1FDO A;  1K8A 1;  4A3M I;  4A3D I;  4A3I I;  3CC7 1;  2W04 A;  4XX2 A;  2Y0S A;  5D1P A;  3HOZ I;  1ZB8 A;  4E2Y A;  1NJI 1;  1RO4 A;  3F3P C;  1YI2 Z;  1I3Q I;  4RS4 A;  2G2K A;  2JNY A;  2V45 A;  3FKI I;  1Q86 2;  1VQK 1;  1X0T A;  3PO2 I;  2PK7 A;  4MRI A;  3VMG A;  1ZH1 A;  3EER A;  1Q86 1;  1Z03 A;  1QXF A;  3KIH A;  3I56 1;  3CPW Y;  4NOZ A;  1YIJ 1;  3D9X A;  1WII A;  4NB8 A;  1P9N A;  4NBG A;  5FLX f;  3CCR 1;  3CPW Z;  3CQZ I;  3CCS 1;  4NBD A;  2RHB A;  1TWF I;  3S15 I;  3G4S 1;  2O53 A;  2DE6 A;  1QVG Z;  3GTQ I;  2VPY A;  5FLM I;  1KC8 2;  3S14 I;  1M1K 2;  3Q87 A;  4A3C I;  1YIT 1;  3HOU I;  3ESW A;  4BBS I;  3CCL 1;  5LL6 f;  1YUK A;  2QEX 1;  3CCM Z;  2RIQ A;  1KC8 1;  3VMH A;  1SIW A;  1Z02 A;  5CM2 M;  3BG1 B;  3CCE 1;  4A93 I;  3CD6 Z;  3CCU 1;  2RT9 A;  2JUB A;  5T6B A;  3CC2 1;  1VQ4 1;  3S1Q I;  3CMA 1;  1K73 1;  2NVY I;  1Q81 2;  2JMO A;  2OZK A;  3KIF A;  2LEX A;  2V3V A;  1QYP A;  2HU9 A;  4E2X A;  2NVT I;  1VQ5 1;  3CC4 Z;  1K83 I;  1Q81 1;  4Y7N I;  5C3E I;  2Q51 A;  4DGL A;  5FLX b;  2JIP A;  3S16 I;  2IV2 X;  4MD8 A;  3GTL I;  1TFI A;  3J81 b;  2W03 A;  2E7Z A;  2PMZ A;  1W2B Y;  2IZ3 A;  4E30 A;  3CCJ Z;  2LIY A;  3IR7 A;  1YJW 1;  2QRD B;  2JIO A;  1W2B Z;  3IX0 A;  2QA4 Z;  2QKD A;  3J80 f;  2HF1 A;  3GTP I;  2GTH A;  1WJ2 A;  4E32 A;  3OW2 Z;  4S1T A;  4NB9 A;  2WAQ A;  4HGZ A;  4E2Z A;  3S1R I;  3GTM S;  4TNU A;  1NJI 2;  1TWA I;  2JIR A;  2V8J A;  1N2F A;  3IF8 A;  3CCQ 1;  1VQN Z;  5D1O B;  1VLA A;  5IP7 I;  1X3W A;  3D6W A;  3G71 1;  1YJN Z;  2JA8 I;  3S1M I;  3G6E 1;  3CME Z;  1VQ7 1;  4BXX I;  2JIQ A;  1VQP 1;  3VB9 A;  2H85 A;  2DE7 A;  2F4M A;  4NBE A;  3GTG I;  2JR6 A;  3IFU A;  5IP9 I;  1VQ8 Z;  4E33 A;  1I50 I;  1VQ6 Z;  2E2H I;  4NBH A;  1QVG Y;  1YJ9 Z;  1KQS Y;  2K5R A;  4NH1 C;  2AKL A;  2R7Z I;  3J80 b;  1TWH I;  3J81 f;  3NH5 A;  5AN9 F;  1KQS Z;  2V8K A;  3CC7 Z;  2GTI A;  2B63 I;  4AYB A;  1VQL 1;  3HOX I;  2YU9 I;  3BG0 B;  3GTM I;  4NBC A;  2LFU A;  3GTJ I;  1TWC I;  1Q7Y 1;  1S72 1;  4DK1 A;  1Q16 A;  3RZO I;  1VQK Z;  3QWU A;  1K73 2;  1Y8C A;  1QF8 A;  3T4N B;  2WB1 A;  2OTJ 1;  3MZK B;  3I56 Z;  2VPZ A;  3NH4 A;  1VQO 1;  3HOV I;  1VQ9 1;  3S2D I;  1Y1W I;  4RV9 A;  2QRE B;  4HH4 A;  4QTT A;  3CCS Z;  3LUS A;  3CCV Z;  5IT9 b;  4E2W A;  4BY7 I;  4MD7 A;  2E2I I;  2NAP A;  2PM9 A;  4MXU A;  4RVF A;  2OTL Z;  2QLV B;  3CCJ 1;  3TE5 B;  3CCL Z;  2V8I A;  3HKZ A;  1AA6 A;  3M3Y I;  1YHQ 1;  1VQM 1;  3CCE Z; 
#chains in the Genus database with same CATH homology
 2EGT A;  3CC2 Z;  1VQ4 Z;  3I55 Z;  4MD9 A;  2R92 I;  3J7A 4;  3CMA Z;  1M90 2;  3H3V J;  3OW2 Y;  3S2H I;  1USP B;  3MZL B;  3HOY I;  2JS4 A;  3TDH B;  1YUA A;  1YI2 1;  1JJ2 Y;  4A3L I;  3GKQ A;  1VQ5 Z;  3FQQ A;  3GTO I;  2M6N A;  4RVG A;  1YJN 1;  1M90 1;  2R93 I;  1JJ2 Z;  3GTK I;  5T64 A;  1R9T I;  1Z01 A;  2F4O A;  2YAD A;  1PFT A;  4A3E I;  4X6A I;  2Q4Z A;  3H0G I;  1Y1V S;  3K7A I;  3NH8 A;  1S7M A;  3FQM A;  2OOX B;  3F3F C;  1RO0 A;  1NP6 A;  4BY1 I;  1YJW Z;  2ZAE B;  2GU2 A;  5IT9 f;  2E2J I;  4A3F I;  2IZ4 A;  1QVF Y;  3PO3 S;  3S17 I;  3CCM 1;  2O4H A;  5C4X I;  2KI7 B;  5A2Q f;  1QVF Z;  1WCM I;  4BBR I;  1Q7Y 2;  3CCQ Z;  3CD6 1;  4A3G I;  2VUG A;  1TWG I;  2BJO A;  2NVX I;  1KD1 2;  1Q82 2;  3HOW I;  3G71 Z;  1N8R 2;  4A3J I;  3G6E Z;  3JAM b;  3NDJ A;  2JA5 I;  2QR1 B;  1VQ7 Z;  3CCV 1;  1KD1 1;  2I3C A;  1Q82 1;  3VMI A;  1N8R 1;  3CC4 1;  1LQL A;  2P28 A;  1Y1V I;  1RNI A;  2QRC B;  2JA6 I;  3M4O I;  1VQP Z;  4A3B I;  2OTL 1;  2OOY B;  1YIJ Z;  3S1N I;  3CCR Z;  2K3R A;  3MON A;  2M48 A;  1WW9 A;  3NDI A;  3RZD I;  3G4S Z;  4RVD A;  1M1K 1;  4A3K I;  4NFR A;  1ML8 A;  3PO3 I;  1VQL Z;  2DE5 A;  5A2Q b;  1KRL A;  3I55 1;  1YIT Z;  4MH4 A;  2QEX Z;  1X3Z A;  4NBF A;  1I6H I;  1S72 Z;  2QA4 1;  4DQY B;  3P5J B;  3U50 C;  2RBL A;  1RO2 A;  4MON A;  3CCU Z;  3VTN A;  1SFO I;  2OTJ Z;  2E9H A;  2VF1 A;  2P3Y A;  2NVQ I;  2VUM I;  1VQO Z;  1VQ9 Z;  4Y52 I;  1VQN 1;  1RQF A;  1USP A;  1DL6 A;  4E31 A;  4NBB A;  4RVH A;  2JA7 I;  3I07 A;  3CME 1;  3CXC Y;  3GCF A;  1K9M 2;  3CXC Z;  3I4M I;  3JAM f;  5D1O A;  3I4N I;  1RLY A;  4HGY A;  1JWH C;  1L1O C;  5T67 A;  4CL1 A;  1ZB9 A;  3EED A;  1K9M 1;  1K8A 2;  1VQ8 1;  2J6A A;  1YHQ Z;  3NFZ A;  5C44 I;  5C4J I;  2RPR A;  1VQM Z;  1VQ6 1;  4EWC A;  1NUI A;  4NBA A;  1YJ9 1;  2R6M A;  4QTU A;  2KPI A;  1K8A 1;  4A3M I;  4A3D I;  4A3I I;  3CC7 1;  2W04 A;  4XX2 A;  2Y0S A;  5D1P A;  3HOZ I;  1ZB8 A;  4E2Y A;  1NJI 1;  1RO4 A;  3F3P C;  1YI2 Z;  1I3Q I;  4RS4 A;  2G2K A;  2JNY A;  3FKI I;  1Q86 2;  1VQK 1;  1X0T A;  3PO2 I;  2PK7 A;  4MRI A;  3VMG A;  1ZH1 A;  3EER A;  1Q86 1;  1Z03 A;  3KIH A;  3I56 1;  3CPW Y;  4NOZ A;  1YIJ 1;  3D9X A;  1WII A;  4NB8 A;  1P9N A;  4NBG A;  5FLX f;  3CCR 1;  3CPW Z;  3CQZ I;  3CCS 1;  4NBD A;  2RHB A;  1TWF I;  3S15 I;  3G4S 1;  2O53 A;  2DE6 A;  1QVG Z;  3GTQ I;  5FLM I;  1KC8 2;  3S14 I;  1M1K 2;  3Q87 A;  4A3C I;  1YIT 1;  3HOU I;  3ESW A;  4BBS I;  3CCL 1;  5LL6 f;  1YUK A;  2QEX 1;  3CCM Z;  2RIQ A;  1KC8 1;  3VMH A;  1Z02 A;  5CM2 M;  3BG1 B;  3CCE 1;  4A93 I;  3CD6 Z;  3CCU 1;  2RT9 A;  2JUB A;  5T6B A;  3CC2 1;  1VQ4 1;  3S1Q I;  3CMA 1;  1K73 1;  2NVY I;  1Q81 2;  2JMO A;  2OZK A;  3KIF A;  1QYP A;  2HU9 A;  4E2X A;  2NVT I;  1VQ5 1;  3CC4 Z;  1K83 I;  1Q81 1;  4Y7N I;  5C3E I;  2Q51 A;  4DGL A;  5FLX b;  3S16 I;  4MD8 A;  3GTL I;  1TFI A;  3J81 b;  2W03 A;  2PMZ A;  1W2B Y;  2IZ3 A;  4E30 A;  3CCJ Z;  2LIY A;  1YJW 1;  2QRD B;  1W2B Z;  3IX0 A;  2QKD A;  2QA4 Z;  3J80 f;  2HF1 A;  3GTP I;  2GTH A;  4E32 A;  3OW2 Z;  4S1T A;  4NB9 A;  2WAQ A;  4HGZ A;  4E2Z A;  3S1R I;  3GTM S;  4TNU A;  1NJI 2;  1TWA I;  2V8J A;  1N2F A;  3IF8 A;  3CCQ 1;  1VQN Z;  5D1O B;  1VLA A;  5IP7 I;  1X3W A;  3D6W A;  3G71 1;  1YJN Z;  2JA8 I;  3S1M I;  3G6E 1;  3CME Z;  1VQ7 1;  4BXX I;  1VQP 1;  3VB9 A;  2H85 A;  2DE7 A;  2F4M A;  4NBE A;  3GTG I;  2JR6 A;  3IFU A;  5IP9 I;  1VQ8 Z;  4E33 A;  1I50 I;  1VQ6 Z;  2E2H I;  4NBH A;  1QVG Y;  1YJ9 Z;  1KQS Y;  2K5R A;  4NH1 C;  2AKL A;  2R7Z I;  3J80 b;  1TWH I;  3J81 f;  3NH5 A;  5AN9 F;  1KQS Z;  2V8K A;  3CC7 Z;  2GTI A;  2B63 I;  4AYB A;  1VQL 1;  3HOX I;  2YU9 I;  3BG0 B;  3GTM I;  4NBC A;  2LFU A;  3GTJ I;  1TWC I;  1Q7Y 1;  1S72 1;  4DK1 A;  3RZO I;  1VQK Z;  3QWU A;  1K73 2;  1QF8 A;  3T4N B;  2WB1 A;  2OTJ 1;  3MZK B;  3I56 Z;  3NH4 A;  1VQO 1;  3HOV I;  1VQ9 1;  3S2D I;  1Y1W I;  4RV9 A;  2QRE B;  4HH4 A;  4QTT A;  3CCS Z;  3LUS A;  3CCV Z;  5IT9 b;  4E2W A;  4BY7 I;  4MD7 A;  2E2I I;  2PM9 A;  4MXU A;  4RVF A;  2OTL Z;  2QLV B;  3CCJ 1;  3TE5 B;  3CCL Z;  2V8I A;  3HKZ A;  3M3Y I;  1YHQ 1;  1VQM 1;  3CCE Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...