2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0434 protein BB2007
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
3VMHA 1R9TI 3I4MI 3PO3S 4A3MI 4NBAA 2DE7A 4BXXI 3HOXI 3S17I 4A3CI 2DE6A 3VMIA 2DE5A 1TWAI 5C4XI 2JA8I 4NBCA 2KPIA 4A3II 4X6AI 1RO4A 1RLYA 3RZOI 2JR6A 1I3QI 3GTMS 4NBEA 4A3BI 2R92I 3CQZI 3H0GI 3S16I 2VUMI 1Y1VI 2JA7I 4MH4A 2E2JI 4A93I 1ZB8A 3GKQA 5IP9I 3U50C 4BY1I 4NBGA 4A3LI 1DL6A 2JA5I 4A3KI 1YUAA 4NOZA 4NB8A 3Q87A 3GTJI 4NBHA 1VLAA 2B63I 1QYPA 4BBRI 3S15I 3GTLI 2R93I 3LUSA 4XX2A 5C3EI 1TWGI 3HOVI 4Y7NI 1X3WA 3VMGA 2F4OA 3GTPI 4A3JI 1TWCI 3S1NI 2F4MA 4BBSI 1WW9A 4NB9A 1LQLA 5C44I 4Y52I 1NUIA 5IP7I 3PO3I 3S1RI 5CM2M 5C4JI 4A3FI 2NVYI 3GTGI 2E2II 3GTQI 3M3YI 1ML8A 3S1MI 3S1QI 2J6AA 2AKLA 4NBBA 3RZDI 1TFIA 1TWFI 3PO2I 2JS4A 4A3GI 1ZB9A 3I4NI 4BY7I 2NVTI 2NVQI 3GTMI 3S2HI 3D6WA 3HOWI 1I6HI 1I50I 1Y1VS 4NBDA 1L1OC 2PK7A 3EERA 3HOUI 4NBFA 2R7ZI 2E2HI 1SFOI 1TWHI 5FLMI 3K7AI 3I07A 2YU9I 2JA6I 4A3DI 3HOYI 3GCFA 3H3VJ 1USPA 3GTKI 3S2DI 2P3YA 3FKII 2K5RA 1N2FA 3ESWA 1PFTA 3HOZI 1X3ZA 3S14I 2RBLA 4A3EI 1WCMI 2HF1A 3VB9A 2NVXI 1K83I 4QTTA 2JNYA 4QTUA 3GTOI 2BJOA 1Y1WI 1USPB 3M4OI
chains in the Genus database with same CATH superfamily
2Q51A 3VMHA 4MRIA 4RVFA 1VQP1 3CCE1 3IFUA 1W2BZ 2RIQA 3HOXI 3BG0B 1S72Z 2DE5A 1QF8A 5C4XI 2W04A 2KPIA 2VPWA 3IX0A 2JIPA 4X6AI 1RO4A 1RLYA 2VPYA 3CCUZ 4A3BI 3J81b 1QVFZ 5LL6f 3NDIA 1ZH1A 3CCMZ 1Q822 1ZB8A 2O4HA 4NBGA 3I561 3CXCY 1DL6A 2JA5I 4A3KI 2OTJ1 1Q811 3Q87A 3GTJI 3CMAZ 1VLAA 3QWUA 3CCRZ 1YJN1 2R93I 2JIMA 3JAMb 1TWGI 3HOVI 1VQ8Z 3J80b 1YHQ1 1QVGY 3VMGA 2F4OA 1K732 3GTPI 4A3JI 2JIOA 2G2KA 1LQLA 5C44I 4DK1A 4Y52I 3NDJA 1NUIA 5IP7I 5CM2M 3CC21 4A3FI 2OOYB 2GTHA 2M6NA 3M3YI 1ML8A 3S1MI 3S1QI 5AN9F 5FLXf 3RZDI 3IR7A 1Q862 2M48A 4MD9A 1ZB9A 1VQL1 3G71Z 2V8JA 1KD12 3CC4Z 2LFUA 4DQYB 3G6EZ 1K9M2 1JWHC 2PK7A 4NBFA 2VPXA 3MZLB 1VQ7Z 2QREB 3NFZA 1SFOI 3CPWY 1Y8CA 4HGZA 1KRLA 1N8R2 3OW2Y 2KI7B 2JA6I 3GTKI 1YIJ1 4RVHA 3J81f 3S2DI 3CCLZ 1N2FA 2QKDA 1P9NA 2RT9A 2I3CA 1M902 2JUBA 2BJOA 2NAPA 3G4S1 1R9TI 3CD61 3NH4A 2IZ3A 4NBAA 2V8IA 3KIHA 4BXXI 3CCQZ 3HKZA 1YJ9Z 2JMOA 3S17I 3VMIA 2VUGA 3CXCZ 1Q7Y2 1KC82 4A3II 3CMEZ 1VQ41 2P28A 1X0TA 2JR6A 1I3QI 4NBEA 2QEXZ 3CQZI 2R92I 2JA7I 4MH4A 5D1OA 4A93I 2K3RA 3GKQA 3MZKB 2OTLZ 5IP9I 1QVGZ 3CCJ1 2QA4Z 2VF1A 3EEDA 1YUAA 4NOZA 1K8A2 1FDOA 4NBHA 1VQN1 2B63I 2E7ZA 5T67A 1YIT1 2GU2A 3S15I 1VQ6Z 5D1OB 4RVDA 4Y7NI 1X3WA 3D9XA 4CL1A 3TE5B 1VQMZ 4E32A 1NP6A 3PO3I 1VQO1 5C4JI 3I551 4MD7A 4DGLA 1VQ5Z 1VQK1 3CPWZ 2GTIA 3OW2Z 1TFIA 1TWFI 3PO2I 4A3GI 3I4NI 4BY7I 2NVTI 4TNUA 1VQPZ 4RVGA 3HOWI 1I6HI 3FQMA 1I50I 3CCV1 2V8KA 3EERA 3HOUI 1FDIA 3CC71 4E2ZA 1YI2Z 3H3VJ 4RS4A 1Z01A 1VQ91 1YUKA 3HOZI 1YJW1 3P5JB 3S14I 4MD8A 1M1K1 1WCMI 3I56Z 5T6BA 4QTTA 2OZKA 2OTJZ 3PO3S 1WJ2A 3CCS1 4A3MI 1YJNZ 5D1PA 2DE6A 2QRDB 1TWAI 1Z02A 1YHQZ 4NBCA 2AYDA 4HGYA 1RO2A 2PMZA 1Q7Y1 3S16I 3CC2Z 1KQSY 2V3VA 3U50C 4BY1I 4AYBA 4A3LI 2Y0SA 4E2WA 3IF8A 1YI21 3JAMf 1VQLZ 3J80f 1QYPA 1Q16A 4BBRI 3GTLI 4XX2A 2IZ4A 5C3EI 1S721 3VTNA 2H85A 1S7MA 4E2XA 2LEXA 3KIFA 2F4MA 2QRCB 3S1NI 1WW9A 4NB9A 4BBSI 4RV9A 1NJI2 1YIJZ 3CCU1 4MONA 2YADA 1WIIA 2W03A 2JIQA 4EWCA 3CCM1 3GTGI 1Q821 2EGTA 2J6AA 2AKLA 2V45A 4E33A 3G4SZ 3CMA1 3BG1B 2Q4ZA 3CCR1 3CD6Z 5IT9b 1SIWA 2NVQI 3GTMI 3S2HI 4NBDA 2E2HI 1VQ81 1TWHI 3K7AI 1K731 2R6MA 1VQ4Z 2YU9I 3HOYI 3GCFA 4HH4A 2WAQA 4E30A 2P3YA 2RHBA 3FKII 1JJ2Y 2K5RA 1AA6A 2OOXB 3F3PC 1X3ZA 2E9HA 2HF1A 3VB9A 3CCJZ 1K83I 3CCEZ 3GTOI 4QTUA 5A2Qb 3NH5A 2ZAEB 1Q861 3M4OI 3I4MI 3G711 1VQNZ 1YITZ 2DE7A 3CC41 1KQSZ 1KD11 3G6E1 2RPRA 1K9M1 4A3CI 1VQ71 1RQFA 2JA8I 1Z03A 3MONA 1N8R1 3RZOI 1VQOZ 3GTMS 3H0GI 2PM9A 3I55Z 3CCL1 1W2BY 2VUMI 1Y1VI 1Q812 1RO0A 1VQKZ 2E2JI 4E31A 2QLVB 1M901 3FQQA 5T64A 4NB8A 2O53A 5IT9f 3TDHB 4NFRA 3CCQ1 3CCVZ 2IV2X 1QVFY 1YJ91 3LUSA 2LIYA 3CC7Z 1QXFA 3CME1 1KC81 1TWCI 4NH1C 3S1RI 2QEX1 1VQ9Z 2QR1B 2HU9A 2NVYI 1YJWZ 2OTL1 2E2II 3GTQI 2JIRA 4MXUA 1NJI1 1M1K2 2QA41 4NBBA 5A2Qf 1WZNA 3D2LA 3NH8A 2JS4A 1K8A1 3CCSZ 1JJ2Z 3D6WA 1VQ61 1Y1VS 1L1OC 2R7ZI 5FLMI 1VQM1 3I07A 4A3DI 1USPA 4E2YA 2WB1A 1RNIA 1VQ51 3ESWA 1PFTA 3J7A4 3T4NB 2RBLA 2VPZA 4A3EI 2NVXI 2JNYA 3F3FC 4S1TA 5FLXb 1Y1WI 1USPB
chains in the Genus database with same CATH topology
2Q51A 3VMHA 4MRIA 4RVFA 1VQP1 3CCE1 3IFUA 1W2BZ 2RIQA 3HOXI 3BG0B 1S72Z 2DE5A 1QF8A 5C4XI 2W04A 2KPIA 3IX0A 4X6AI 1RO4A 1RLYA 3CCUZ 4A3BI 3J81b 1QVFZ 5LL6f 3NDIA 1ZH1A 3CCMZ 1Q822 1ZB8A 2O4HA 4NBGA 3I561 3CXCY 1DL6A 2JA5I 4A3KI 2OTJ1 1Q811 3Q87A 3GTJI 3CMAZ 1VLAA 3QWUA 3CCRZ 1YJN1 2R93I 3JAMb 1TWGI 3HOVI 1VQ8Z 3J80b 1YHQ1 1QVGY 3VMGA 2F4OA 1K732 3GTPI 4A3JI 2G2KA 1LQLA 5C44I 4DK1A 4Y52I 3NDJA 1NUIA 5IP7I 5CM2M 3CC21 4A3FI 2OOYB 2GTHA 2M6NA 3M3YI 1ML8A 3S1MI 3S1QI 5AN9F 5FLXf 3RZDI 1Q862 2M48A 4MD9A 1ZB9A 1VQL1 3G71Z 2V8JA 1KD12 3CC4Z 2LFUA 4DQYB 3G6EZ 1K9M2 1JWHC 2PK7A 4NBFA 3MZLB 1VQ7Z 2QREB 3NFZA 1SFOI 3CPWY 4HGZA 1KRLA 1N8R2 3OW2Y 2KI7B 2JA6I 3GTKI 1YIJ1 4RVHA 3J81f 3S2DI 3CCLZ 1N2FA 2QKDA 1P9NA 2RT9A 2I3CA 1M902 2JUBA 2BJOA 3G4S1 1R9TI 3CD61 3NH4A 2IZ3A 4NBAA 2V8IA 3KIHA 4BXXI 3CCQZ 3HKZA 1YJ9Z 2JMOA 3S17I 3VMIA 2VUGA 3CXCZ 1Q7Y2 1KC82 4A3II 3CMEZ 1VQ41 2P28A 1X0TA 2JR6A 1I3QI 4NBEA 2QEXZ 3CQZI 2R92I 2JA7I 4MH4A 5D1OA 4A93I 2K3RA 3GKQA 3MZKB 2OTLZ 5IP9I 1QVGZ 3CCJ1 2QA4Z 2VF1A 3EEDA 1YUAA 4NOZA 1K8A2 4NBHA 1VQN1 2B63I 5T67A 1YIT1 2GU2A 3S15I 1VQ6Z 5D1OB 4RVDA 4Y7NI 1X3WA 3D9XA 4CL1A 3TE5B 1VQMZ 4E32A 1NP6A 3PO3I 1VQO1 5C4JI 3I551 4MD7A 4DGLA 1VQ5Z 1VQK1 3CPWZ 2GTIA 3OW2Z 1TFIA 1TWFI 3PO2I 4A3GI 3I4NI 4BY7I 2NVTI 4TNUA 1VQPZ 4RVGA 3HOWI 1I6HI 3FQMA 1I50I 3CCV1 2V8KA 3EERA 3HOUI 3CC71 4E2ZA 1YI2Z 3H3VJ 4RS4A 1Z01A 1VQ91 1YUKA 3HOZI 1YJW1 3P5JB 3S14I 4MD8A 1M1K1 1WCMI 3I56Z 5T6BA 4QTTA 2OZKA 2OTJZ 3PO3S 3CCS1 4A3MI 1YJNZ 5D1PA 2DE6A 2QRDB 1TWAI 1Z02A 1YHQZ 4NBCA 4HGYA 1RO2A 2PMZA 1Q7Y1 3S16I 3CC2Z 1KQSY 3U50C 4BY1I 4AYBA 4A3LI 2Y0SA 4E2WA 3IF8A 1YI21 3JAMf 1VQLZ 3J80f 1QYPA 4BBRI 3GTLI 4XX2A 2IZ4A 5C3EI 1S721 3VTNA 2H85A 1S7MA 4E2XA 3KIFA 2F4MA 2QRCB 3S1NI 1WW9A 4NB9A 4BBSI 4RV9A 1NJI2 1YIJZ 3CCU1 4MONA 2YADA 1WIIA 2W03A 4EWCA 3CCM1 3GTGI 1Q821 2EGTA 2J6AA 2AKLA 4E33A 3G4SZ 3CMA1 3BG1B 2Q4ZA 3CCR1 3CD6Z 5IT9b 2NVQI 3GTMI 3S2HI 4NBDA 2E2HI 1VQ81 1TWHI 3K7AI 1K731 2R6MA 1VQ4Z 2YU9I 3HOYI 3GCFA 4HH4A 2WAQA 4E30A 2P3YA 2RHBA 3FKII 1JJ2Y 2K5RA 2OOXB 3F3PC 1X3ZA 2E9HA 2HF1A 3VB9A 3CCJZ 1K83I 3CCEZ 3GTOI 4QTUA 5A2Qb 3NH5A 2ZAEB 1Q861 3M4OI 3I4MI 3G711 1VQNZ 1YITZ 2DE7A 3CC41 1KQSZ 1KD11 3G6E1 2RPRA 1K9M1 4A3CI 1VQ71 1RQFA 2JA8I 1Z03A 3MONA 1N8R1 3RZOI 1VQOZ 3GTMS 3H0GI 2PM9A 3I55Z 3CCL1 1W2BY 2VUMI 1Y1VI 1Q812 1RO0A 1VQKZ 2E2JI 4E31A 2QLVB 1M901 3FQQA 5T64A 4NB8A 2O53A 5IT9f 3TDHB 4NFRA 3CCQ1 3CCVZ 1QVFY 1YJ91 3LUSA 2LIYA 3CC7Z 3CME1 1KC81 1TWCI 4NH1C 3S1RI 2QEX1 1VQ9Z 2QR1B 2HU9A 2NVYI 1YJWZ 2OTL1 2E2II 3GTQI 4MXUA 1NJI1 1M1K2 2QA41 4NBBA 5A2Qf 3NH8A 2JS4A 1K8A1 3CCSZ 1JJ2Z 3D6WA 1VQ61 1Y1VS 1L1OC 2R7ZI 5FLMI 1VQM1 3I07A 4A3DI 1USPA 4E2YA 2WB1A 1RNIA 1VQ51 3ESWA 1PFTA 3J7A4 3T4NB 2RBLA 4A3EI 2NVXI 2JNYA 3F3FC 4S1TA 5FLXb 1Y1WI 1USPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH A;  1R9T I;  3I4M I;  3PO3 S;  4A3M I;  4NBA A;  2DE7 A;  4BXX I;  3HOX I;  3S17 I;  4A3C I;  2DE6 A;  3VMI A;  2DE5 A;  1TWA I;  5C4X I;  2JA8 I;  4NBC A;  2KPI A;  4A3I I;  4X6A I;  1RO4 A;  1RLY A;  3RZO I;  2JR6 A;  1I3Q I;  3GTM S;  4NBE A;  4A3B I;  2R92 I;  3CQZ I;  3H0G I;  3S16 I;  2VUM I;  1Y1V I;  2JA7 I;  4MH4 A;  2E2J I;  4A93 I;  1ZB8 A;  3GKQ A;  5IP9 I;  3U50 C;  4BY1 I;  4NBG A;  4A3L I;  1DL6 A;  2JA5 I;  4A3K I;  1YUA A;  4NOZ A;  4NB8 A;  3Q87 A;  3GTJ I;  4NBH A;  1VLA A;  2B63 I;  1QYP A;  4BBR I;  3S15 I;  3GTL I;  2R93 I;  3LUS A;  4XX2 A;  5C3E I;  1TWG I;  3HOV I;  4Y7N I;  1X3W A;  3VMG A;  2F4O A;  3GTP I;  4A3J I;  1TWC I;  3S1N I;  2F4M A;  4BBS I;  1WW9 A;  4NB9 A;  1LQL A;  5C44 I;  4Y52 I;  1NUI A;  5IP7 I;  3PO3 I;  3S1R I;  5CM2 M;  5C4J I;  4A3F I;  2NVY I;  3GTG I;  2E2I I;  3GTQ I;  3M3Y I;  1ML8 A;  3S1M I;  3S1Q I;  2J6A A;  2AKL A;  4NBB A;  3RZD I;  1TFI A;  1TWF I;  3PO2 I;  2JS4 A;  4A3G I;  1ZB9 A;  3I4N I;  4BY7 I;  2NVT I;  2NVQ I;  3GTM I;  3S2H I;  3D6W A;  3HOW I;  1I6H I;  1I50 I;  1Y1V S;  4NBD A;  1L1O C;  2PK7 A;  3EER A;  3HOU I;  4NBF A;  2R7Z I;  2E2H I;  1SFO I;  1TWH I;  5FLM I;  3K7A I;  3I07 A;  2YU9 I;  2JA6 I;  4A3D I;  3HOY I;  3GCF A;  3H3V J;  1USP A;  3GTK I;  3S2D I;  2P3Y A;  3FKI I;  2K5R A;  1N2F A;  3ESW A;  1PFT A;  3HOZ I;  1X3Z A;  3S14 I;  2RBL A;  4A3E I;  1WCM I;  2HF1 A;  3VB9 A;  2NVX I;  1K83 I;  4QTT A;  2JNY A;  4QTU A;  3GTO I;  2BJO A;  1Y1W I;  1USP B;  3M4O I; 
#chains in the Genus database with same CATH topology
 2Q51 A;  3VMH A;  4MRI A;  4RVF A;  1VQP 1;  3CCE 1;  3IFU A;  1W2B Z;  2RIQ A;  3HOX I;  3BG0 B;  1S72 Z;  2DE5 A;  1QF8 A;  5C4X I;  2W04 A;  2KPI A;  2VPW A;  3IX0 A;  2JIP A;  4X6A I;  1RO4 A;  1RLY A;  2VPY A;  3CCU Z;  4A3B I;  3J81 b;  1QVF Z;  5LL6 f;  3NDI A;  1ZH1 A;  3CCM Z;  1Q82 2;  1ZB8 A;  2O4H A;  4NBG A;  3I56 1;  3CXC Y;  1DL6 A;  2JA5 I;  4A3K I;  2OTJ 1;  1Q81 1;  3Q87 A;  3GTJ I;  3CMA Z;  1VLA A;  3QWU A;  3CCR Z;  1YJN 1;  2R93 I;  2JIM A;  3JAM b;  1TWG I;  3HOV I;  1VQ8 Z;  3J80 b;  1YHQ 1;  1QVG Y;  3VMG A;  2F4O A;  1K73 2;  3GTP I;  4A3J I;  2JIO A;  2G2K A;  1LQL A;  5C44 I;  4DK1 A;  4Y52 I;  3NDJ A;  1NUI A;  5IP7 I;  5CM2 M;  3CC2 1;  4A3F I;  2OOY B;  2GTH A;  2M6N A;  3M3Y I;  1ML8 A;  3S1M I;  3S1Q I;  5AN9 F;  5FLX f;  3RZD I;  3IR7 A;  1Q86 2;  2M48 A;  4MD9 A;  1ZB9 A;  1VQL 1;  3G71 Z;  2V8J A;  1KD1 2;  3CC4 Z;  2LFU A;  4DQY B;  3G6E Z;  1K9M 2;  1JWH C;  2PK7 A;  4NBF A;  2VPX A;  3MZL B;  1VQ7 Z;  2QRE B;  3NFZ A;  1SFO I;  3CPW Y;  1Y8C A;  4HGZ A;  1KRL A;  1N8R 2;  3OW2 Y;  2KI7 B;  2JA6 I;  3GTK I;  1YIJ 1;  4RVH A;  3J81 f;  3S2D I;  3CCL Z;  1N2F A;  2QKD A;  1P9N A;  2RT9 A;  2I3C A;  1M90 2;  2JUB A;  2BJO A;  2NAP A;  3G4S 1;  1R9T I;  3CD6 1;  3NH4 A;  2IZ3 A;  4NBA A;  2V8I A;  3KIH A;  4BXX I;  3CCQ Z;  3HKZ A;  1YJ9 Z;  2JMO A;  3S17 I;  3VMI A;  2VUG A;  3CXC Z;  1Q7Y 2;  1KC8 2;  4A3I I;  3CME Z;  1VQ4 1;  2P28 A;  1X0T A;  2JR6 A;  1I3Q I;  4NBE A;  2QEX Z;  3CQZ I;  2R92 I;  2JA7 I;  4MH4 A;  5D1O A;  4A93 I;  2K3R A;  3GKQ A;  3MZK B;  2OTL Z;  5IP9 I;  1QVG Z;  3CCJ 1;  2QA4 Z;  2VF1 A;  3EED A;  1YUA A;  4NOZ A;  1K8A 2;  1FDO A;  4NBH A;  1VQN 1;  2B63 I;  2E7Z A;  5T67 A;  1YIT 1;  2GU2 A;  3S15 I;  1VQ6 Z;  5D1O B;  4RVD A;  4Y7N I;  1X3W A;  3D9X A;  4CL1 A;  3TE5 B;  1VQM Z;  4E32 A;  1NP6 A;  3PO3 I;  1VQO 1;  5C4J I;  3I55 1;  4MD7 A;  4DGL A;  1VQ5 Z;  1VQK 1;  3CPW Z;  2GTI A;  3OW2 Z;  1TFI A;  1TWF I;  3PO2 I;  4A3G I;  3I4N I;  4BY7 I;  2NVT I;  4TNU A;  1VQP Z;  4RVG A;  3HOW I;  1I6H I;  3FQM A;  1I50 I;  3CCV 1;  2V8K A;  3EER A;  3HOU I;  1FDI A;  3CC7 1;  4E2Z A;  1YI2 Z;  3H3V J;  4RS4 A;  1Z01 A;  1VQ9 1;  1YUK A;  3HOZ I;  1YJW 1;  3P5J B;  3S14 I;  4MD8 A;  1M1K 1;  1WCM I;  3I56 Z;  5T6B A;  4QTT A;  2OZK A;  2OTJ Z;  3PO3 S;  1WJ2 A;  3CCS 1;  4A3M I;  1YJN Z;  5D1P A;  2DE6 A;  2QRD B;  1TWA I;  1Z02 A;  1YHQ Z;  4NBC A;  2AYD A;  4HGY A;  1RO2 A;  2PMZ A;  1Q7Y 1;  3S16 I;  3CC2 Z;  1KQS Y;  2V3V A;  3U50 C;  4BY1 I;  4AYB A;  4A3L I;  2Y0S A;  4E2W A;  3IF8 A;  1YI2 1;  3JAM f;  1VQL Z;  3J80 f;  1QYP A;  1Q16 A;  4BBR I;  3GTL I;  4XX2 A;  2IZ4 A;  5C3E I;  1S72 1;  3VTN A;  2H85 A;  1S7M A;  4E2X A;  2LEX A;  3KIF A;  2F4M A;  2QRC B;  3S1N I;  1WW9 A;  4NB9 A;  4BBS I;  4RV9 A;  1NJI 2;  1YIJ Z;  3CCU 1;  4MON A;  2YAD A;  1WII A;  2W03 A;  2JIQ A;  4EWC A;  3CCM 1;  3GTG I;  1Q82 1;  2EGT A;  2J6A A;  2AKL A;  2V45 A;  4E33 A;  3G4S Z;  3CMA 1;  3BG1 B;  2Q4Z A;  3CCR 1;  3CD6 Z;  5IT9 b;  1SIW A;  2NVQ I;  3GTM I;  3S2H I;  4NBD A;  2E2H I;  1VQ8 1;  1TWH I;  3K7A I;  1K73 1;  2R6M A;  1VQ4 Z;  2YU9 I;  3HOY I;  3GCF A;  4HH4 A;  2WAQ A;  4E30 A;  2P3Y A;  2RHB A;  3FKI I;  1JJ2 Y;  2K5R A;  1AA6 A;  2OOX B;  3F3P C;  1X3Z A;  2E9H A;  2HF1 A;  3VB9 A;  3CCJ Z;  1K83 I;  3CCE Z;  3GTO I;  4QTU A;  5A2Q b;  3NH5 A;  2ZAE B;  1Q86 1;  3M4O I;  3I4M I;  3G71 1;  1VQN Z;  1YIT Z;  2DE7 A;  3CC4 1;  1KQS Z;  1KD1 1;  3G6E 1;  2RPR A;  1K9M 1;  4A3C I;  1VQ7 1;  1RQF A;  2JA8 I;  1Z03 A;  3MON A;  1N8R 1;  3RZO I;  1VQO Z;  3GTM S;  3H0G I;  2PM9 A;  3I55 Z;  3CCL 1;  1W2B Y;  2VUM I;  1Y1V I;  1Q81 2;  1RO0 A;  1VQK Z;  2E2J I;  4E31 A;  2QLV B;  1M90 1;  3FQQ A;  5T64 A;  4NB8 A;  2O53 A;  5IT9 f;  3TDH B;  4NFR A;  3CCQ 1;  3CCV Z;  2IV2 X;  1QVF Y;  1YJ9 1;  3LUS A;  2LIY A;  3CC7 Z;  1QXF A;  3CME 1;  1KC8 1;  1TWC I;  4NH1 C;  3S1R I;  2QEX 1;  1VQ9 Z;  2QR1 B;  2HU9 A;  2NVY I;  1YJW Z;  2OTL 1;  2E2I I;  3GTQ I;  2JIR A;  4MXU A;  1NJI 1;  1M1K 2;  2QA4 1;  4NBB A;  5A2Q f;  1WZN A;  3D2L A;  3NH8 A;  2JS4 A;  1K8A 1;  3CCS Z;  1JJ2 Z;  3D6W A;  1VQ6 1;  1Y1V S;  1L1O C;  2R7Z I;  5FLM I;  1VQM 1;  3I07 A;  4A3D I;  1USP A;  4E2Y A;  2WB1 A;  1RNI A;  1VQ5 1;  3ESW A;  1PFT A;  3J7A 4;  3T4N B;  2RBL A;  2VPZ A;  4A3E I;  2NVX I;  2JNY A;  3F3F C;  4S1T A;  5FLX b;  1Y1W I;  1USP B; 
#chains in the Genus database with same CATH homology
 2Q51 A;  3VMH A;  4MRI A;  4RVF A;  1VQP 1;  3CCE 1;  3IFU A;  1W2B Z;  2RIQ A;  3HOX I;  3BG0 B;  1S72 Z;  2DE5 A;  1QF8 A;  5C4X I;  2W04 A;  2KPI A;  3IX0 A;  4X6A I;  1RO4 A;  1RLY A;  3CCU Z;  4A3B I;  3J81 b;  1QVF Z;  5LL6 f;  3NDI A;  1ZH1 A;  3CCM Z;  1Q82 2;  1ZB8 A;  2O4H A;  4NBG A;  3I56 1;  3CXC Y;  1DL6 A;  2JA5 I;  4A3K I;  2OTJ 1;  1Q81 1;  3Q87 A;  3GTJ I;  3CMA Z;  1VLA A;  3QWU A;  3CCR Z;  1YJN 1;  2R93 I;  3JAM b;  1TWG I;  3HOV I;  1VQ8 Z;  3J80 b;  1YHQ 1;  1QVG Y;  3VMG A;  2F4O A;  1K73 2;  3GTP I;  4A3J I;  2G2K A;  1LQL A;  5C44 I;  4DK1 A;  4Y52 I;  3NDJ A;  1NUI A;  5IP7 I;  5CM2 M;  3CC2 1;  4A3F I;  2OOY B;  2GTH A;  2M6N A;  3M3Y I;  1ML8 A;  3S1M I;  3S1Q I;  5AN9 F;  5FLX f;  3RZD I;  1Q86 2;  2M48 A;  4MD9 A;  1ZB9 A;  1VQL 1;  3G71 Z;  2V8J A;  1KD1 2;  3CC4 Z;  2LFU A;  4DQY B;  3G6E Z;  1K9M 2;  1JWH C;  2PK7 A;  4NBF A;  3MZL B;  1VQ7 Z;  2QRE B;  3NFZ A;  1SFO I;  3CPW Y;  4HGZ A;  1KRL A;  1N8R 2;  3OW2 Y;  2KI7 B;  2JA6 I;  3GTK I;  1YIJ 1;  4RVH A;  3J81 f;  3S2D I;  3CCL Z;  1N2F A;  2QKD A;  1P9N A;  2RT9 A;  2I3C A;  1M90 2;  2JUB A;  2BJO A;  3G4S 1;  1R9T I;  3CD6 1;  3NH4 A;  2IZ3 A;  4NBA A;  2V8I A;  3KIH A;  4BXX I;  3CCQ Z;  3HKZ A;  1YJ9 Z;  2JMO A;  3S17 I;  3VMI A;  2VUG A;  3CXC Z;  1Q7Y 2;  1KC8 2;  4A3I I;  3CME Z;  1VQ4 1;  2P28 A;  1X0T A;  2JR6 A;  1I3Q I;  4NBE A;  2QEX Z;  3CQZ I;  2R92 I;  2JA7 I;  4MH4 A;  5D1O A;  4A93 I;  2K3R A;  3GKQ A;  3MZK B;  2OTL Z;  5IP9 I;  1QVG Z;  3CCJ 1;  2QA4 Z;  2VF1 A;  3EED A;  1YUA A;  4NOZ A;  1K8A 2;  4NBH A;  1VQN 1;  2B63 I;  5T67 A;  1YIT 1;  2GU2 A;  3S15 I;  1VQ6 Z;  5D1O B;  4RVD A;  4Y7N I;  1X3W A;  3D9X A;  4CL1 A;  3TE5 B;  1VQM Z;  4E32 A;  1NP6 A;  3PO3 I;  1VQO 1;  5C4J I;  3I55 1;  4MD7 A;  4DGL A;  1VQ5 Z;  1VQK 1;  3CPW Z;  2GTI A;  3OW2 Z;  1TFI A;  1TWF I;  3PO2 I;  4A3G I;  3I4N I;  4BY7 I;  2NVT I;  4TNU A;  1VQP Z;  4RVG A;  3HOW I;  1I6H I;  3FQM A;  1I50 I;  3CCV 1;  2V8K A;  3EER A;  3HOU I;  3CC7 1;  4E2Z A;  1YI2 Z;  3H3V J;  4RS4 A;  1Z01 A;  1VQ9 1;  1YUK A;  3HOZ I;  1YJW 1;  3P5J B;  3S14 I;  4MD8 A;  1M1K 1;  1WCM I;  3I56 Z;  5T6B A;  4QTT A;  2OZK A;  2OTJ Z;  3PO3 S;  3CCS 1;  4A3M I;  1YJN Z;  5D1P A;  2DE6 A;  2QRD B;  1TWA I;  1Z02 A;  1YHQ Z;  4NBC A;  4HGY A;  1RO2 A;  2PMZ A;  1Q7Y 1;  3S16 I;  3CC2 Z;  1KQS Y;  3U50 C;  4BY1 I;  4AYB A;  4A3L I;  2Y0S A;  4E2W A;  3IF8 A;  1YI2 1;  3JAM f;  1VQL Z;  3J80 f;  1QYP A;  4BBR I;  3GTL I;  4XX2 A;  2IZ4 A;  5C3E I;  1S72 1;  3VTN A;  2H85 A;  1S7M A;  4E2X A;  3KIF A;  2F4M A;  2QRC B;  3S1N I;  1WW9 A;  4NB9 A;  4BBS I;  4RV9 A;  1NJI 2;  1YIJ Z;  3CCU 1;  4MON A;  2YAD A;  1WII A;  2W03 A;  4EWC A;  3CCM 1;  3GTG I;  1Q82 1;  2EGT A;  2J6A A;  2AKL A;  4E33 A;  3G4S Z;  3CMA 1;  3BG1 B;  2Q4Z A;  3CCR 1;  3CD6 Z;  5IT9 b;  2NVQ I;  3GTM I;  3S2H I;  4NBD A;  2E2H I;  1VQ8 1;  1TWH I;  3K7A I;  1K73 1;  2R6M A;  1VQ4 Z;  2YU9 I;  3HOY I;  3GCF A;  4HH4 A;  2WAQ A;  4E30 A;  2P3Y A;  2RHB A;  3FKI I;  1JJ2 Y;  2K5R A;  2OOX B;  3F3P C;  1X3Z A;  2E9H A;  2HF1 A;  3VB9 A;  3CCJ Z;  1K83 I;  3CCE Z;  3GTO I;  4QTU A;  5A2Q b;  3NH5 A;  2ZAE B;  1Q86 1;  3M4O I;  3I4M I;  3G71 1;  1VQN Z;  1YIT Z;  2DE7 A;  3CC4 1;  1KQS Z;  1KD1 1;  3G6E 1;  2RPR A;  1K9M 1;  4A3C I;  1VQ7 1;  1RQF A;  2JA8 I;  1Z03 A;  3MON A;  1N8R 1;  3RZO I;  1VQO Z;  3GTM S;  3H0G I;  2PM9 A;  3I55 Z;  3CCL 1;  1W2B Y;  2VUM I;  1Y1V I;  1Q81 2;  1RO0 A;  1VQK Z;  2E2J I;  4E31 A;  2QLV B;  1M90 1;  3FQQ A;  5T64 A;  4NB8 A;  2O53 A;  5IT9 f;  3TDH B;  4NFR A;  3CCQ 1;  3CCV Z;  1QVF Y;  1YJ9 1;  3LUS A;  2LIY A;  3CC7 Z;  3CME 1;  1KC8 1;  1TWC I;  4NH1 C;  3S1R I;  2QEX 1;  1VQ9 Z;  2QR1 B;  2HU9 A;  2NVY I;  1YJW Z;  2OTL 1;  2E2I I;  3GTQ I;  4MXU A;  1NJI 1;  1M1K 2;  2QA4 1;  4NBB A;  5A2Q f;  3NH8 A;  2JS4 A;  1K8A 1;  3CCS Z;  1JJ2 Z;  3D6W A;  1VQ6 1;  1Y1V S;  1L1O C;  2R7Z I;  5FLM I;  1VQM 1;  3I07 A;  4A3D I;  1USP A;  4E2Y A;  2WB1 A;  1RNI A;  1VQ5 1;  3ESW A;  1PFT A;  3J7A 4;  3T4N B;  2RBL A;  4A3E I;  2NVX I;  2JNY A;  3F3F C;  4S1T A;  5FLX b;  1Y1W I;  1USP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...