2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
molecule keywords UPF0434 protein BB2007
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
1X3WA 3HOZI 1Y1VI 3S14I 2VUMI 3GKQA 2HF1A 3GTPI 3LUSA 4BY7I 3RZOI 3S2HI 1WCMI 2F4OA 4NBGA 3U50C 4X6AI 4A3EI 3VB9A 5C4XI 5FLMI 3GTKI 3HOUI 4BXXI 1Y1VS 3VMIA 2B63I 4A3KI 3HOWI 3S1MI 2K5RA 3GTQI 3HOVI 4A3FI 4XX2A 3Q87A 1ML8A 2JNYA 4A3GI 3H3VJ 1WW9A 3I4MI 1TFIA 1PFTA 2P3YA 1TWCI 3VMGA 1L1OC 2AKLA 4BBSI 3ESWA 3FKII 4NB8A 4A3CI 3I4NI 4Y7NI 3S1RI 3GTJI 4QTTA 3EERA 3I07A 3H0GI 5CM2M 5IP7I 3GTLI 4A3LI 2DE6A 1USPB 2JS4A 4QTUA 1R9TI 3M3YI 1Y1WI 2JA5I 1X3ZA 1VLAA 1RLYA 4NBBA 3RZDI 4NB9A 3GTOI 3M4OI 3S17I 1N2FA 4BBRI 2JA6I 4NBAA 2KPIA 3S1NI 3PO3I 2R93I 2JA8I 2NVYI 3GTMS 1I6HI 2RBLA 4A93I 1K83I 4A3DI 5C4JI 2E2II 2NVXI 5IP9I 3S2DI 1YUAA 2R7ZI 4NBFA 4NBHA 2E2JI 4NOZA 2DE7A 4MH4A 2PK7A 3GCFA 4NBEA 1I50I 2F4MA 3CQZI 2NVQI 1ZB8A 4A3MI 3HOYI 3GTMI 5C44I 1TWHI 3VMHA 1ZB9A 2DE5A 1NUIA 3PO2I 1TWFI 3S16I 2JA7I 2JR6A 3GTGI 1QYPA 4A3BI 3PO3S 1USPA 2BJOA 4NBCA 2NVTI 3S15I 1RO4A 3HOXI 4A3II 3D6WA 1TWGI 4Y52I 4BY1I 5C3EI 3K7AI 2YU9I 3S1QI 1SFOI 4A3JI 2R92I 1DL6A 2J6AA 2E2HI 1I3QI 1TWAI 1LQLA 4NBDA
chains in the Genus database with same CATH superfamily
4E2XA 4DK1A 1WIIA 1Y1VI 3CCE1 3GKQA 3LUSA 3CCSZ 2E7ZA 3EEDA 1FDIA 1VQ91 4S1TA 2VPXA 3U50C 3VB9A 5C4XI 5FLMI 2P28A 1Q861 3S1MI 2K5RA 2JIRA 2LIYA 3TDHB 3Q87A 2GU2A 2WAQA 4E2YA 3G6EZ 1K8A2 2OTLZ 1W2BZ 1TWCI 3I561 1YJ9Z 2OTJ1 4RS4A 1VQN1 3CCR1 1Q822 1YJW1 3BG0B 4DQYB 1X0TA 3GTJI 2VUGA 2I3CA 5IP7I 1VQ71 1USPB 1YITZ 1NJI1 2JS4A 1R9TI 3JAMb 5A2Qf 2V8JA 1RLYA 1WJ2A 3CD61 4BBRI 2QEX1 3S1NI 2R93I 3CCJZ 2IZ4A 2JA8I 1VQMZ 4A93I 4A3DI 3NFZA 2V8IA 2E2II 2NVXI 1JWHC 4E2ZA 4HH4A 4MH4A 1FDOA 2F4MA 3CQZI 5AN9F 3GTMI 5C44I 2QEXZ 2KI7B 2OOYB 3G711 2Y0SA 2NVTI 3CCVZ 3HOXI 3JAMf 4A3II 1RNIA 1K9M1 2W03A 2YU9I 1VQ5Z 1YJWZ 1TWAI 1X3WA 3IR7A 3S14I 3CME1 3I56Z 1YJ91 1N8R2 4E2WA 4MD9A 1Q821 2F4OA 4X6AI 3F3FC 3HOUI 3CC2Z 1YJN1 3VMIA 2B63I 3HOWI 3GTQI 2HU9A 3IF8A 3P5JB 4A3GI 1VQLZ 3HKZA 1PFTA 2QR1B 1WZNA 2IZ3A 2JIMA 2P3YA 2OOXB 1QF8A 5IT9f 1L1OC 4MRIA 5T64A 3CC71 1Q7Y1 1VQ41 1VQO1 1RO0A 1NP6A 3ESWA 3FKII 3CCUZ 3S1RI 1VQ61 1YIJ1 3I07A 1QXFA 2QLVB 3NDIA 1KD12 3MZLB 2QA41 3CXCZ 1VQ7Z 3MONA 1VQPZ 5A2Qb 1K732 3S17I 3GTOI 1Q812 1N2FA 2H85A 2OZKA 1M1K2 3IX0A 1NJI2 3PO3I 3GTMS 2VPYA 3S2DI 2LEXA 1YUKA 3G4SZ 2ZAEB 4HGYA 5T67A 2E2JI 2AYDA 2DE7A 3D2LA 2VPZA 1Q16A 5D1OA 3OW2Y 3VMHA 1N8R1 1YI21 3S16I 2OTJZ 3QWUA 2RPRA 1USPA 4NBCA 3CXCY 1YIT1 3NH4A 4BY1I 1Q862 1P9NA 3J81f 4HGZA 5C3EI 3CC41 4MD8A 4DGLA 4A3JI 3CPWY 2M48A 2V45A 3CPWZ 3CCJ1 2J6AA 1I3QI 1SIWA 1LQLA 3TE5B 3CCL1 3HOZI 3CD6Z 2VUMI 2HF1A 3KIHA 4RV9A 4E33A 1WCMI 4E32A 1YI2Z 4A3KI 1VQK1 2PM9A 4RVDA 3CCQZ 4A3FI 4XX2A 4E30A 1S7MA 3H3VJ 3J80f 1WW9A 2QKDA 3I4MI 2JIQA 3CCS1 3VMGA 4MONA 2RT9A 5IT9b 2JIOA 1K731 1VQKZ 3KIFA 3CCLZ 1VQOZ 1VQ8Z 4NB8A 3I4NI 4Y7NI 2LFUA 5CM2M 2DE6A 1S721 2NAPA 1Y1WI 4TNUA 3M4OI 1VLAA 1KRLA 3CCEZ 4NB9A 1AA6A 4NBAA 2KPIA 5FLXf 3CMAZ 1VQ81 2Q51A 2NVYI 1KC81 2RBLA 1I6HI 1S72Z 1K83I 5C4JI 1RO2A 5IP9I 1YUAA 2R7ZI 2O4HA 4NBFA 4RVGA 2QRCB 2PK7A 3GCFA 3CCU1 1Z02A 2NVQI 3OW2Z 2JIPA 4A3MI 3HOYI 2V8KA 1ZB9A 2E9HA 4NFRA 4MXUA 1TWFI 2EGTA 1YHQ1 2K3RA 4A3BI 2BJOA 2QA4Z 4RVHA 3S15I 1VQP1 1QVGZ 2QRDB 1ZH1A 3BG1B 3I55Z 3K7AI 4NH1C 2R92I 1Z03A 1DL6A 2E2HI 3CMA1 1VQNZ 3CC4Z 1VQ51 3GTPI 1Y8CA 2VF1A 1KC82 3G4S1 1VQ9Z 4BY7I 3RZOI 3F3PC 3D9XA 3CCV1 3S2HI 2GTIA 4NBGA 3NDJA 1VQ6Z 4A3EI 3GTKI 4BXXI 1Y1VS 3IFUA 2QREB 3MZKB 2JMOA 3HOVI 5FLXb 2IV2X 1M902 3J7A4 1ML8A 4EWCA 2JNYA 4AYBA 2JUBA 3FQMA 5LL6f 3J80b 1M1K1 1TFIA 5D1PA 1W2BY 2R6MA 2M6NA 1JJ2Y 1Q7Y2 3FQQA 2AKLA 4BBSI 2G2KA 1M901 3CCM1 3CCRZ 4A3CI 4MD7A 2O53A 4QTTA 3EERA 3H0GI 3GTLI 4A3LI 2W04A 4QTUA 3M3YI 2PMZA 2JA5I 4CL1A 2GTHA 1YIJZ 1X3ZA 1Z01A 4NBBA 3CMEZ 3RZDI 1Q811 2JA6I 2V3VA 1K9M2 2YADA 1KQSZ 1VQ4Z 4E31A 2Q4ZA 3I551 1VQM1 1QVFZ 2OTL1 1QVFY 4NBHA 4NOZA 3G71Z 4NBEA 1I50I 1KD11 1ZB8A 1YJNZ 1TWHI 2DE5A 1NUIA 3PO2I 1RQFA 2RHBA 3CC21 2JA7I 1K8A1 2JR6A 3GTGI 1QYPA 2VPWA 3NH8A 3PO3S 2WB1A 1RO4A 4RVFA 3D6WA 1QVGY 2RIQA 3G6E1 3NH5A 1TWGI 5T6BA 3J81b 1VQL1 4Y52I 3S1QI 1SFOI 1YHQZ 5D1OB 1JJ2Z 3CCQ1 3T4NB 3VTNA 3CC7Z 3CCMZ 4NBDA 1KQSY
chains in the Genus database with same CATH topology
4E2XA 4DK1A 1WIIA 1Y1VI 3CCE1 3GKQA 3LUSA 3CCSZ 3EEDA 1VQ91 4S1TA 3U50C 3VB9A 5C4XI 5FLMI 2P28A 1Q861 3S1MI 2K5RA 2LIYA 3TDHB 3Q87A 2GU2A 2WAQA 4E2YA 3G6EZ 1K8A2 2OTLZ 1W2BZ 1TWCI 3I561 1YJ9Z 2OTJ1 4RS4A 1VQN1 3CCR1 1Q822 1YJW1 3BG0B 4DQYB 1X0TA 3GTJI 2VUGA 2I3CA 5IP7I 1VQ71 1USPB 1YITZ 1NJI1 2JS4A 1R9TI 3JAMb 5A2Qf 2V8JA 1RLYA 3CD61 4BBRI 2QEX1 3S1NI 2R93I 3CCJZ 2IZ4A 2JA8I 1VQMZ 4A93I 4A3DI 3NFZA 2V8IA 2E2II 2NVXI 1JWHC 4E2ZA 4HH4A 4MH4A 2F4MA 3CQZI 5AN9F 3GTMI 5C44I 2QEXZ 2KI7B 2OOYB 3G711 2Y0SA 2NVTI 3CCVZ 3HOXI 3JAMf 4A3II 1RNIA 1K9M1 2W03A 2YU9I 1VQ5Z 1YJWZ 1TWAI 1X3WA 3S14I 3CME1 3I56Z 1YJ91 1N8R2 4E2WA 4MD9A 1Q821 2F4OA 4X6AI 3F3FC 3HOUI 3CC2Z 1YJN1 3VMIA 2B63I 3HOWI 3GTQI 2HU9A 3IF8A 3P5JB 4A3GI 1VQLZ 3HKZA 1PFTA 2QR1B 2IZ3A 2P3YA 2OOXB 1QF8A 5IT9f 1L1OC 4MRIA 5T64A 3CC71 1Q7Y1 1VQ41 1VQO1 1RO0A 1NP6A 3ESWA 3FKII 3CCUZ 3S1RI 1VQ61 1YIJ1 3I07A 2QLVB 3NDIA 1KD12 3MZLB 2QA41 3CXCZ 1VQ7Z 3MONA 1VQPZ 5A2Qb 1K732 3S17I 3GTOI 1Q812 1N2FA 2H85A 2OZKA 1M1K2 3IX0A 1NJI2 3PO3I 3GTMS 3S2DI 1YUKA 3G4SZ 2ZAEB 4HGYA 5T67A 2E2JI 2DE7A 5D1OA 3OW2Y 3VMHA 1N8R1 1YI21 3S16I 2OTJZ 3QWUA 2RPRA 1USPA 4NBCA 3CXCY 1YIT1 3NH4A 4BY1I 1Q862 1P9NA 3J81f 4HGZA 5C3EI 3CC41 4MD8A 4DGLA 4A3JI 3CPWY 2M48A 3CPWZ 3CCJ1 2J6AA 1I3QI 1LQLA 3TE5B 3CCL1 3HOZI 3CD6Z 2VUMI 2HF1A 3KIHA 4RV9A 4E33A 1WCMI 4E32A 1YI2Z 4A3KI 1VQK1 2PM9A 4RVDA 3CCQZ 4A3FI 4XX2A 4E30A 1S7MA 3H3VJ 3J80f 1WW9A 2QKDA 3I4MI 3CCS1 3VMGA 4MONA 2RT9A 5IT9b 1K731 1VQKZ 3KIFA 3CCLZ 1VQOZ 1VQ8Z 4NB8A 3I4NI 4Y7NI 2LFUA 5CM2M 2DE6A 1S721 1Y1WI 4TNUA 3M4OI 1VLAA 1KRLA 3CCEZ 4NB9A 4NBAA 2KPIA 5FLXf 3CMAZ 1VQ81 2Q51A 2NVYI 1KC81 2RBLA 1I6HI 1S72Z 1K83I 5C4JI 1RO2A 5IP9I 1YUAA 2R7ZI 2O4HA 4NBFA 4RVGA 2QRCB 2PK7A 3GCFA 3CCU1 1Z02A 2NVQI 3OW2Z 4A3MI 3HOYI 2V8KA 1ZB9A 2E9HA 4NFRA 4MXUA 1TWFI 2EGTA 1YHQ1 2K3RA 4A3BI 2BJOA 2QA4Z 4RVHA 3S15I 1VQP1 1QVGZ 2QRDB 1ZH1A 3BG1B 3I55Z 3K7AI 4NH1C 2R92I 1Z03A 1DL6A 2E2HI 3CMA1 1VQNZ 3CC4Z 1VQ51 3GTPI 2VF1A 1KC82 3G4S1 1VQ9Z 4BY7I 3RZOI 3F3PC 3D9XA 3CCV1 3S2HI 2GTIA 4NBGA 3NDJA 1VQ6Z 4A3EI 3GTKI 4BXXI 1Y1VS 3IFUA 2QREB 3MZKB 2JMOA 3HOVI 5FLXb 1M902 3J7A4 1ML8A 4EWCA 2JNYA 4AYBA 2JUBA 3FQMA 5LL6f 3J80b 1M1K1 1TFIA 5D1PA 1W2BY 2R6MA 2M6NA 1JJ2Y 1Q7Y2 3FQQA 2AKLA 4BBSI 2G2KA 1M901 3CCM1 3CCRZ 4A3CI 4MD7A 2O53A 4QTTA 3EERA 3H0GI 3GTLI 4A3LI 2W04A 4QTUA 3M3YI 2PMZA 2JA5I 4CL1A 2GTHA 1YIJZ 1X3ZA 1Z01A 4NBBA 3CMEZ 3RZDI 1Q811 2JA6I 1K9M2 2YADA 1KQSZ 1VQ4Z 4E31A 2Q4ZA 3I551 1VQM1 1QVFZ 2OTL1 1QVFY 4NBHA 4NOZA 3G71Z 4NBEA 1I50I 1KD11 1ZB8A 1YJNZ 1TWHI 2DE5A 1NUIA 3PO2I 1RQFA 2RHBA 3CC21 2JA7I 1K8A1 2JR6A 3GTGI 1QYPA 3NH8A 3PO3S 2WB1A 1RO4A 4RVFA 3D6WA 1QVGY 2RIQA 3G6E1 3NH5A 1TWGI 5T6BA 3J81b 1VQL1 4Y52I 3S1QI 1SFOI 1YHQZ 5D1OB 1JJ2Z 3CCQ1 3T4NB 3VTNA 3CC7Z 3CCMZ 4NBDA 1KQSY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3W A;  3HOZ I;  1Y1V I;  3S14 I;  2VUM I;  3GKQ A;  2HF1 A;  3GTP I;  3LUS A;  4BY7 I;  3RZO I;  3S2H I;  1WCM I;  2F4O A;  4NBG A;  3U50 C;  4X6A I;  4A3E I;  3VB9 A;  5C4X I;  5FLM I;  3GTK I;  3HOU I;  4BXX I;  1Y1V S;  3VMI A;  2B63 I;  4A3K I;  3HOW I;  3S1M I;  2K5R A;  3GTQ I;  3HOV I;  4A3F I;  4XX2 A;  3Q87 A;  1ML8 A;  2JNY A;  4A3G I;  3H3V J;  1WW9 A;  3I4M I;  1TFI A;  1PFT A;  2P3Y A;  1TWC I;  3VMG A;  1L1O C;  2AKL A;  4BBS I;  3ESW A;  3FKI I;  4NB8 A;  4A3C I;  3I4N I;  4Y7N I;  3S1R I;  3GTJ I;  4QTT A;  3EER A;  3I07 A;  3H0G I;  5CM2 M;  5IP7 I;  3GTL I;  4A3L I;  2DE6 A;  1USP B;  2JS4 A;  4QTU A;  1R9T I;  3M3Y I;  1Y1W I;  2JA5 I;  1X3Z A;  1VLA A;  1RLY A;  4NBB A;  3RZD I;  4NB9 A;  3GTO I;  3M4O I;  3S17 I;  1N2F A;  4BBR I;  2JA6 I;  4NBA A;  2KPI A;  3S1N I;  3PO3 I;  2R93 I;  2JA8 I;  2NVY I;  3GTM S;  1I6H I;  2RBL A;  4A93 I;  1K83 I;  4A3D I;  5C4J I;  2E2I I;  2NVX I;  5IP9 I;  3S2D I;  1YUA A;  2R7Z I;  4NBF A;  4NBH A;  2E2J I;  4NOZ A;  2DE7 A;  4MH4 A;  2PK7 A;  3GCF A;  4NBE A;  1I50 I;  2F4M A;  3CQZ I;  2NVQ I;  1ZB8 A;  4A3M I;  3HOY I;  3GTM I;  5C44 I;  1TWH I;  3VMH A;  1ZB9 A;  2DE5 A;  1NUI A;  3PO2 I;  1TWF I;  3S16 I;  2JA7 I;  2JR6 A;  3GTG I;  1QYP A;  4A3B I;  3PO3 S;  1USP A;  2BJO A;  4NBC A;  2NVT I;  3S15 I;  1RO4 A;  3HOX I;  4A3I I;  3D6W A;  1TWG I;  4Y52 I;  4BY1 I;  5C3E I;  3K7A I;  2YU9 I;  3S1Q I;  1SFO I;  4A3J I;  2R92 I;  1DL6 A;  2J6A A;  2E2H I;  1I3Q I;  1TWA I;  1LQL A;  4NBD A; 
#chains in the Genus database with same CATH topology
 4E2X A;  4DK1 A;  1WII A;  1Y1V I;  3CCE 1;  3GKQ A;  3LUS A;  3CCS Z;  2E7Z A;  3EED A;  1FDI A;  1VQ9 1;  4S1T A;  2VPX A;  3U50 C;  3VB9 A;  5C4X I;  5FLM I;  2P28 A;  1Q86 1;  3S1M I;  2K5R A;  2JIR A;  2LIY A;  3TDH B;  3Q87 A;  2GU2 A;  2WAQ A;  4E2Y A;  3G6E Z;  1K8A 2;  2OTL Z;  1W2B Z;  1TWC I;  3I56 1;  1YJ9 Z;  2OTJ 1;  4RS4 A;  1VQN 1;  3CCR 1;  1Q82 2;  1YJW 1;  3BG0 B;  4DQY B;  1X0T A;  3GTJ I;  2VUG A;  2I3C A;  5IP7 I;  1VQ7 1;  1USP B;  1YIT Z;  1NJI 1;  2JS4 A;  1R9T I;  3JAM b;  5A2Q f;  2V8J A;  1RLY A;  1WJ2 A;  3CD6 1;  4BBR I;  2QEX 1;  3S1N I;  2R93 I;  3CCJ Z;  2IZ4 A;  2JA8 I;  1VQM Z;  4A93 I;  4A3D I;  3NFZ A;  2V8I A;  2E2I I;  2NVX I;  1JWH C;  4E2Z A;  4HH4 A;  4MH4 A;  1FDO A;  2F4M A;  3CQZ I;  5AN9 F;  3GTM I;  5C44 I;  2QEX Z;  2KI7 B;  2OOY B;  3G71 1;  2Y0S A;  2NVT I;  3CCV Z;  3HOX I;  3JAM f;  4A3I I;  1RNI A;  1K9M 1;  2W03 A;  2YU9 I;  1VQ5 Z;  1YJW Z;  1TWA I;  1X3W A;  3IR7 A;  3S14 I;  3CME 1;  3I56 Z;  1YJ9 1;  1N8R 2;  4E2W A;  4MD9 A;  1Q82 1;  2F4O A;  4X6A I;  3F3F C;  3HOU I;  3CC2 Z;  1YJN 1;  3VMI A;  2B63 I;  3HOW I;  3GTQ I;  2HU9 A;  3IF8 A;  3P5J B;  4A3G I;  1VQL Z;  3HKZ A;  1PFT A;  2QR1 B;  1WZN A;  2IZ3 A;  2JIM A;  2P3Y A;  2OOX B;  1QF8 A;  5IT9 f;  1L1O C;  4MRI A;  5T64 A;  3CC7 1;  1Q7Y 1;  1VQ4 1;  1VQO 1;  1RO0 A;  1NP6 A;  3ESW A;  3FKI I;  3CCU Z;  3S1R I;  1VQ6 1;  1YIJ 1;  3I07 A;  1QXF A;  2QLV B;  3NDI A;  1KD1 2;  3MZL B;  2QA4 1;  3CXC Z;  1VQ7 Z;  3MON A;  1VQP Z;  5A2Q b;  1K73 2;  3S17 I;  3GTO I;  1Q81 2;  1N2F A;  2H85 A;  2OZK A;  1M1K 2;  3IX0 A;  1NJI 2;  3PO3 I;  3GTM S;  2VPY A;  3S2D I;  2LEX A;  1YUK A;  3G4S Z;  2ZAE B;  4HGY A;  5T67 A;  2E2J I;  2AYD A;  2DE7 A;  3D2L A;  2VPZ A;  1Q16 A;  5D1O A;  3OW2 Y;  3VMH A;  1N8R 1;  1YI2 1;  3S16 I;  2OTJ Z;  3QWU A;  2RPR A;  1USP A;  4NBC A;  3CXC Y;  1YIT 1;  3NH4 A;  4BY1 I;  1Q86 2;  1P9N A;  3J81 f;  4HGZ A;  5C3E I;  3CC4 1;  4MD8 A;  4DGL A;  4A3J I;  3CPW Y;  2M48 A;  2V45 A;  3CPW Z;  3CCJ 1;  2J6A A;  1I3Q I;  1SIW A;  1LQL A;  3TE5 B;  3CCL 1;  3HOZ I;  3CD6 Z;  2VUM I;  2HF1 A;  3KIH A;  4RV9 A;  4E33 A;  1WCM I;  4E32 A;  1YI2 Z;  4A3K I;  1VQK 1;  2PM9 A;  4RVD A;  3CCQ Z;  4A3F I;  4XX2 A;  4E30 A;  1S7M A;  3H3V J;  3J80 f;  1WW9 A;  2QKD A;  3I4M I;  2JIQ A;  3CCS 1;  3VMG A;  4MON A;  2RT9 A;  5IT9 b;  2JIO A;  1K73 1;  1VQK Z;  3KIF A;  3CCL Z;  1VQO Z;  1VQ8 Z;  4NB8 A;  3I4N I;  4Y7N I;  2LFU A;  5CM2 M;  2DE6 A;  1S72 1;  2NAP A;  1Y1W I;  4TNU A;  3M4O I;  1VLA A;  1KRL A;  3CCE Z;  4NB9 A;  1AA6 A;  4NBA A;  2KPI A;  5FLX f;  3CMA Z;  1VQ8 1;  2Q51 A;  2NVY I;  1KC8 1;  2RBL A;  1I6H I;  1S72 Z;  1K83 I;  5C4J I;  1RO2 A;  5IP9 I;  1YUA A;  2R7Z I;  2O4H A;  4NBF A;  4RVG A;  2QRC B;  2PK7 A;  3GCF A;  3CCU 1;  1Z02 A;  2NVQ I;  3OW2 Z;  2JIP A;  4A3M I;  3HOY I;  2V8K A;  1ZB9 A;  2E9H A;  4NFR A;  4MXU A;  1TWF I;  2EGT A;  1YHQ 1;  2K3R A;  4A3B I;  2BJO A;  2QA4 Z;  4RVH A;  3S15 I;  1VQP 1;  1QVG Z;  2QRD B;  1ZH1 A;  3BG1 B;  3I55 Z;  3K7A I;  4NH1 C;  2R92 I;  1Z03 A;  1DL6 A;  2E2H I;  3CMA 1;  1VQN Z;  3CC4 Z;  1VQ5 1;  3GTP I;  1Y8C A;  2VF1 A;  1KC8 2;  3G4S 1;  1VQ9 Z;  4BY7 I;  3RZO I;  3F3P C;  3D9X A;  3CCV 1;  3S2H I;  2GTI A;  4NBG A;  3NDJ A;  1VQ6 Z;  4A3E I;  3GTK I;  4BXX I;  1Y1V S;  3IFU A;  2QRE B;  3MZK B;  2JMO A;  3HOV I;  5FLX b;  2IV2 X;  1M90 2;  3J7A 4;  1ML8 A;  4EWC A;  2JNY A;  4AYB A;  2JUB A;  3FQM A;  5LL6 f;  3J80 b;  1M1K 1;  1TFI A;  5D1P A;  1W2B Y;  2R6M A;  2M6N A;  1JJ2 Y;  1Q7Y 2;  3FQQ A;  2AKL A;  4BBS I;  2G2K A;  1M90 1;  3CCM 1;  3CCR Z;  4A3C I;  4MD7 A;  2O53 A;  4QTT A;  3EER A;  3H0G I;  3GTL I;  4A3L I;  2W04 A;  4QTU A;  3M3Y I;  2PMZ A;  2JA5 I;  4CL1 A;  2GTH A;  1YIJ Z;  1X3Z A;  1Z01 A;  4NBB A;  3CME Z;  3RZD I;  1Q81 1;  2JA6 I;  2V3V A;  1K9M 2;  2YAD A;  1KQS Z;  1VQ4 Z;  4E31 A;  2Q4Z A;  3I55 1;  1VQM 1;  1QVF Z;  2OTL 1;  1QVF Y;  4NBH A;  4NOZ A;  3G71 Z;  4NBE A;  1I50 I;  1KD1 1;  1ZB8 A;  1YJN Z;  1TWH I;  2DE5 A;  1NUI A;  3PO2 I;  1RQF A;  2RHB A;  3CC2 1;  2JA7 I;  1K8A 1;  2JR6 A;  3GTG I;  1QYP A;  2VPW A;  3NH8 A;  3PO3 S;  2WB1 A;  1RO4 A;  4RVF A;  3D6W A;  1QVG Y;  2RIQ A;  3G6E 1;  3NH5 A;  1TWG I;  5T6B A;  3J81 b;  1VQL 1;  4Y52 I;  3S1Q I;  1SFO I;  1YHQ Z;  5D1O B;  1JJ2 Z;  3CCQ 1;  3T4N B;  3VTN A;  3CC7 Z;  3CCM Z;  4NBD A;  1KQS Y; 
#chains in the Genus database with same CATH homology
 4E2X A;  4DK1 A;  1WII A;  1Y1V I;  3CCE 1;  3GKQ A;  3LUS A;  3CCS Z;  3EED A;  1VQ9 1;  4S1T A;  3U50 C;  3VB9 A;  5C4X I;  5FLM I;  2P28 A;  1Q86 1;  3S1M I;  2K5R A;  2LIY A;  3TDH B;  3Q87 A;  2GU2 A;  2WAQ A;  4E2Y A;  3G6E Z;  1K8A 2;  2OTL Z;  1W2B Z;  1TWC I;  3I56 1;  1YJ9 Z;  2OTJ 1;  4RS4 A;  1VQN 1;  3CCR 1;  1Q82 2;  1YJW 1;  3BG0 B;  4DQY B;  1X0T A;  3GTJ I;  2VUG A;  2I3C A;  5IP7 I;  1VQ7 1;  1USP B;  1YIT Z;  1NJI 1;  2JS4 A;  1R9T I;  3JAM b;  5A2Q f;  2V8J A;  1RLY A;  3CD6 1;  4BBR I;  2QEX 1;  3S1N I;  2R93 I;  3CCJ Z;  2IZ4 A;  2JA8 I;  1VQM Z;  4A93 I;  4A3D I;  3NFZ A;  2V8I A;  2E2I I;  2NVX I;  1JWH C;  4E2Z A;  4HH4 A;  4MH4 A;  2F4M A;  3CQZ I;  5AN9 F;  3GTM I;  5C44 I;  2QEX Z;  2KI7 B;  2OOY B;  3G71 1;  2Y0S A;  2NVT I;  3CCV Z;  3HOX I;  3JAM f;  4A3I I;  1RNI A;  1K9M 1;  2W03 A;  2YU9 I;  1VQ5 Z;  1YJW Z;  1TWA I;  1X3W A;  3S14 I;  3CME 1;  3I56 Z;  1YJ9 1;  1N8R 2;  4E2W A;  4MD9 A;  1Q82 1;  2F4O A;  4X6A I;  3F3F C;  3HOU I;  3CC2 Z;  1YJN 1;  3VMI A;  2B63 I;  3HOW I;  3GTQ I;  2HU9 A;  3IF8 A;  3P5J B;  4A3G I;  1VQL Z;  3HKZ A;  1PFT A;  2QR1 B;  2IZ3 A;  2P3Y A;  2OOX B;  1QF8 A;  5IT9 f;  1L1O C;  4MRI A;  5T64 A;  3CC7 1;  1Q7Y 1;  1VQ4 1;  1VQO 1;  1RO0 A;  1NP6 A;  3ESW A;  3FKI I;  3CCU Z;  3S1R I;  1VQ6 1;  1YIJ 1;  3I07 A;  2QLV B;  3NDI A;  1KD1 2;  3MZL B;  2QA4 1;  3CXC Z;  1VQ7 Z;  3MON A;  1VQP Z;  5A2Q b;  1K73 2;  3S17 I;  3GTO I;  1Q81 2;  1N2F A;  2H85 A;  2OZK A;  1M1K 2;  3IX0 A;  1NJI 2;  3PO3 I;  3GTM S;  3S2D I;  1YUK A;  3G4S Z;  2ZAE B;  4HGY A;  5T67 A;  2E2J I;  2DE7 A;  5D1O A;  3OW2 Y;  3VMH A;  1N8R 1;  1YI2 1;  3S16 I;  2OTJ Z;  3QWU A;  2RPR A;  1USP A;  4NBC A;  3CXC Y;  1YIT 1;  3NH4 A;  4BY1 I;  1Q86 2;  1P9N A;  3J81 f;  4HGZ A;  5C3E I;  3CC4 1;  4MD8 A;  4DGL A;  4A3J I;  3CPW Y;  2M48 A;  3CPW Z;  3CCJ 1;  2J6A A;  1I3Q I;  1LQL A;  3TE5 B;  3CCL 1;  3HOZ I;  3CD6 Z;  2VUM I;  2HF1 A;  3KIH A;  4RV9 A;  4E33 A;  1WCM I;  4E32 A;  1YI2 Z;  4A3K I;  1VQK 1;  2PM9 A;  4RVD A;  3CCQ Z;  4A3F I;  4XX2 A;  4E30 A;  1S7M A;  3H3V J;  3J80 f;  1WW9 A;  2QKD A;  3I4M I;  3CCS 1;  3VMG A;  4MON A;  2RT9 A;  5IT9 b;  1K73 1;  1VQK Z;  3KIF A;  3CCL Z;  1VQO Z;  1VQ8 Z;  4NB8 A;  3I4N I;  4Y7N I;  2LFU A;  5CM2 M;  2DE6 A;  1S72 1;  1Y1W I;  4TNU A;  3M4O I;  1VLA A;  1KRL A;  3CCE Z;  4NB9 A;  4NBA A;  2KPI A;  5FLX f;  3CMA Z;  1VQ8 1;  2Q51 A;  2NVY I;  1KC8 1;  2RBL A;  1I6H I;  1S72 Z;  1K83 I;  5C4J I;  1RO2 A;  5IP9 I;  1YUA A;  2R7Z I;  2O4H A;  4NBF A;  4RVG A;  2QRC B;  2PK7 A;  3GCF A;  3CCU 1;  1Z02 A;  2NVQ I;  3OW2 Z;  4A3M I;  3HOY I;  2V8K A;  1ZB9 A;  2E9H A;  4NFR A;  4MXU A;  1TWF I;  2EGT A;  1YHQ 1;  2K3R A;  4A3B I;  2BJO A;  2QA4 Z;  4RVH A;  3S15 I;  1VQP 1;  1QVG Z;  2QRD B;  1ZH1 A;  3BG1 B;  3I55 Z;  3K7A I;  4NH1 C;  2R92 I;  1Z03 A;  1DL6 A;  2E2H I;  3CMA 1;  1VQN Z;  3CC4 Z;  1VQ5 1;  3GTP I;  2VF1 A;  1KC8 2;  3G4S 1;  1VQ9 Z;  4BY7 I;  3RZO I;  3F3P C;  3D9X A;  3CCV 1;  3S2H I;  2GTI A;  4NBG A;  3NDJ A;  1VQ6 Z;  4A3E I;  3GTK I;  4BXX I;  1Y1V S;  3IFU A;  2QRE B;  3MZK B;  2JMO A;  3HOV I;  5FLX b;  1M90 2;  3J7A 4;  1ML8 A;  4EWC A;  2JNY A;  4AYB A;  2JUB A;  3FQM A;  5LL6 f;  3J80 b;  1M1K 1;  1TFI A;  5D1P A;  1W2B Y;  2R6M A;  2M6N A;  1JJ2 Y;  1Q7Y 2;  3FQQ A;  2AKL A;  4BBS I;  2G2K A;  1M90 1;  3CCM 1;  3CCR Z;  4A3C I;  4MD7 A;  2O53 A;  4QTT A;  3EER A;  3H0G I;  3GTL I;  4A3L I;  2W04 A;  4QTU A;  3M3Y I;  2PMZ A;  2JA5 I;  4CL1 A;  2GTH A;  1YIJ Z;  1X3Z A;  1Z01 A;  4NBB A;  3CME Z;  3RZD I;  1Q81 1;  2JA6 I;  1K9M 2;  2YAD A;  1KQS Z;  1VQ4 Z;  4E31 A;  2Q4Z A;  3I55 1;  1VQM 1;  1QVF Z;  2OTL 1;  1QVF Y;  4NBH A;  4NOZ A;  3G71 Z;  4NBE A;  1I50 I;  1KD1 1;  1ZB8 A;  1YJN Z;  1TWH I;  2DE5 A;  1NUI A;  3PO2 I;  1RQF A;  2RHB A;  3CC2 1;  2JA7 I;  1K8A 1;  2JR6 A;  3GTG I;  1QYP A;  3NH8 A;  3PO3 S;  2WB1 A;  1RO4 A;  4RVF A;  3D6W A;  1QVG Y;  2RIQ A;  3G6E 1;  3NH5 A;  1TWG I;  5T6B A;  3J81 b;  1VQL 1;  4Y52 I;  3S1Q I;  1SFO I;  1YHQ Z;  5D1O B;  1JJ2 Z;  3CCQ 1;  3T4N B;  3VTN A;  3CC7 Z;  3CCM Z;  4NBD A;  1KQS Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...