2JS4A

Solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAEAPAQPSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Bordetella bronchiseptica protein BB2007.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
molecule keywords UPF0434 protein BB2007
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2js4A01
1TFIA 1Y1VS 4A3LI 4A3FI 3VMGA 1SFOI 1USPA 3GTKI 1LQLA 1TWHI 2RBLA 3HOUI 4NBGA 5CM2M 2F4MA 1ML8A 2F4OA 4NBAA 3S1NI 3VMHA 2DE5A 3HOYI 4NOZA 4BY1I 3PO2I 4Y7NI 3S15I 2NVTI 1DL6A 2B63I 4NBDA 2KPIA 2NVQI 4BBSI 3PO3I 3I07A 3S2HI 1X3ZA 2R93I 1X3WA 4XX2A 3GTGI 3HOWI 3S1RI 2YU9I 4NB9A 3EERA 3GTQI 5C4XI 4A3JI 2NVYI 4BXXI 4A3EI 5IP7I 1WW9A 1I3QI 2JA5I 4BY7I 3U50C 3S1MI 3GTJI 3FKII 3H0GI 4X6AI 1Y1WI 3HOZI 4A3DI 4A3MI 1I50I 1R9TI 4A93I 1RLYA 1L1OC 3GKQA 3M3YI 2R92I 2JA8I 3RZOI 4A3BI 5C44I 2AKLA 2E2HI 2E2JI 2JA7I 2J6AA 4NBEA 5C3EI 2JS4A 3GTMI 1RO4A 1YUAA 1PFTA 3RZDI 2JNYA 4QTTA 3I4NI 2DE6A 3ESWA 1ZB8A 2BJOA 3S2DI 1ZB9A 2JA6I 3PO3S 3HOXI 3HOVI 4A3CI 2DE7A 4NBFA 3S14I 4NBBA 3LUSA 4NBCA 4BBRI 4NB8A 3GTPI 3GTMS 1TWFI 5IP9I 3GTLI 3M4OI 3S17I 1NUIA 4QTUA 4Y52I 2HF1A 2K5RA 1K83I 1TWAI 1WCMI 2NVXI 1Y1VI 3VMIA 2P3YA 4A3KI 2E2II 5C4JI 1VLAA 3Q87A 4NBHA 4MH4A 3S1QI 3CQZI 2R7ZI 3VB9A 1TWGI 3GTOI 2JR6A 2VUMI 4A3GI 1TWCI 3K7AI 1I6HI 3GCFA 3D6WA 3H3VJ 5FLMI 1N2FA 2PK7A 3S16I 4A3II 1QYPA 3I4MI 1USPB
chains in the Genus database with same CATH superfamily
3G71Z 3CCJZ 4A3LI 4E30A 1S7MA 2VPXA 5A2Qb 1Q821 1JJ2Z 2W03A 5LL6f 1M901 2OOXB 2NAPA 2QREB 4NBGA 2F4OA 4NBAA 2VPYA 3S1NI 3VMHA 2M6NA 3KIFA 1YIJ1 2QA4Z 1DL6A 1VQL1 4NBDA 2NVQI 1Q862 3CC21 4NB9A 3J80b 1K732 2OTL1 1FDOA 1VQ71 2GU2A 4A3JI 3CPWY 1KQSY 4MD8A 2JUBA 5T64A 1WW9A 1I3QI 1M902 4HGZA 1YI21 2O53A 2V8JA 3FKII 4NFRA 2WAQA 2KI7B 1VQ9Z 3M3YI 1K8A1 2JA8I 1N8R1 3RZOI 1QVGZ 2E2JI 2J6AA 3CCLZ 4AYBA 1YJ91 1YJWZ 2W04A 3CC4Z 4RVFA 3J7A4 1YIT1 3J80f 3RZDI 4HGYA 3I4NI 1VQ81 4RVHA 1W2BZ 1VQ91 3CMEZ 3VTNA 1WZNA 4NBFA 2M48A 2RHBA 3S14I 4NBBA 3NDIA 5A2Qf 4MD9A 1VQ51 3CXCY 1RO0A 3GTMS 1P9NA 2JIQA 1VQ5Z 2K5RA 1KC81 1K83I 2G2KA 2E9HA 2EGTA 4MXUA 2VPWA 3VMIA 2P3YA 5C4JI 3QWUA 2V3VA 1Q811 2RT9A 4NBHA 4DK1A 3NH4A 1TWGI 3GTOI 3CCU1 2V45A 4MONA 3CCL1 3H3VJ 5IT9b 3NFZA 1Z03A 1N2FA 5FLMI 3IFUA 4E31A 4A3II 3CCE1 2IZ4A 1Y1VS 1Z01A 4A3FI 1SFOI 1NJI1 1X0TA 1LQLA 2RBLA 5D1PA 3NH8A 3CCJ1 4MRIA 4NOZA 4BY1I 3CD6Z 4Y7NI 3S15I 2NVTI 1KD12 4BBSI 1X3ZA 3GTGI 3CMA1 3EERA 1YUKA 2LEXA 4EWCA 5FLXf 1VQKZ 2NVYI 3IX0A 3G4SZ 5IT9f 4A3EI 1VQLZ 1K8A2 1NP6A 1RQFA 1KRLA 4BY7I 3G6E1 3S1MI 2Y0SA 1VQ6Z 3H0GI 4A3DI 4A3MI 3NDJA 1R9TI 2ZAEB 3BG0B 3T4NB 3TE5B 2R92I 3KIHA 4DGLA 3CCVZ 2E2HI 2AKLA 2JA7I 2JMOA 1Q7Y1 3EEDA 2JS4A 3GTMI 1Q812 1RO4A 4E2WA 1PFTA 3F3PC 3IR7A 2IZ3A 1VQ61 1Q861 3MZKB 3CCR1 1ZB8A 3OW2Z 3S2DI 4RV9A 3HOXI 3HOVI 4A3CI 1Q16A 2I3CA 3CME1 4E33A 1SIWA 2RPRA 4MD7A 3GTPI 2YADA 1W2BY 2R6MA 3M4OI 3S17I 1NUIA 2GTIA 2PM9A 2JIPA 2E7ZA 3CCUZ 1YJ9Z 1S72Z 1WCMI 1Q7Y2 1Y1VI 3J81f 1Z02A 4HH4A 3VB9A 2JR6A 2VUMI 3K7AI 3D6WA 3FQQA 2QR1B 1QYPA 3I4MI 1USPB 1TFIA 2V8IA 2JIMA 1KD11 2QRCB 3VMGA 1USPA 3GTKI 5T6BA 2F4MA 4E2ZA 3NH5A 2DE5A 3HOYI 3JAMb 1YITZ 3PO2I 4E2YA 1QVFZ 3CC41 2VF1A 2O4HA 2KPIA 3D9XA 3PO3I 3I07A 1YIJZ 3P5JB 4RVGA 2R93I 3HOWI 2Q51A 2YU9I 5C4XI 1K9M2 4BXXI 3CPWZ 5IP7I 1JJ2Y 3G711 2JA5I 3U50C 3MONA 3GTJI 3CC2Z 1Y1WI 2LFUA 3HOZI 3I55Z 1S721 4A93I 2OOYB 3G6EZ 3J81b 4A3BI 2VUGA 2AYDA 3G4S1 3CCQ1 4CL1A 1RNIA 3FQMA 3OW2Y 1VQK1 1QF8A 1YHQZ 4QTTA 3HKZA 1YI2Z 3F3FC 1K9M1 1VQ41 2BJOA 3BG1B 1K731 2PMZA 4E2XA 3CD61 1N8R2 3LUSA 4NB8A 1VQMZ 4E32A 2JIRA 2OTLZ 1TWFI 3GTLI 4QTUA 4DQYB 2NVXI 4A3KI 2QA41 2E2II 3D2LA 1Q822 2H85A 1VLAA 3CCEZ 1VQ4Z 4MH4A 4A3GI 1YJNZ 1TWCI 3CC71 3GCFA 1VQP1 2PK7A 1QVFY 3CCS1 3CMAZ 3IF8A 2QEXZ 1RO2A 1WIIA 1VQN1 2IV2X 2V8KA 1TWHI 3HOUI 3I551 5CM2M 3MZLB 4NH1C 5T67A 1ML8A 1JWHC 3TDHB 1FDIA 2B63I 2QRDB 3CXCZ 3S2HI 1AA6A 1X3WA 4XX2A 1QXFA 1VQ8Z 3CCM1 3GTQI 4RVDA 2QLVB 3I561 2OZKA 1KC82 2Q4ZA 4X6AI 1VQPZ 2QKDA 1I50I 5AN9F 1RLYA 1L1OC 4TNUA 1QVGY 2HU9A 3GKQA 4S1TA 3CCMZ 2OTJZ 2GTHA 1WJ2A 3CCRZ 4RS4A 5C44I 2WB1A 2OTJ1 4NBEA 2JIOA 5C3EI 1VQ7Z 1YUAA 2QEX1 2JNYA 2P28A 2DE6A 3ESWA 3CCV1 3CCSZ 1ZB9A 2JA6I 3PO3S 5D1OA 1M1K2 2DE7A 1YJW1 3JAMf 1YJN1 3I56Z 5D1OB 4NBCA 4BBRI 1M1K1 1YHQ1 1ZH1A 5IP9I 3CC7Z 4Y52I 3CCQZ 2HF1A 5FLXb 1TWAI 1Y8CA 2K3RA 1NJI2 3Q87A 1KQSZ 2RIQA 1VQOZ 3S1QI 3CQZI 2R7ZI 1VQO1 1VQNZ 1I6HI 2VPZA 2LIYA 3S16I 1VQM1 3S1RI
chains in the Genus database with same CATH topology
3G71Z 3CCJZ 4A3LI 4E30A 1S7MA 5A2Qb 1Q821 1JJ2Z 2W03A 5LL6f 1M901 2OOXB 2QREB 4NBGA 2F4OA 4NBAA 3S1NI 3VMHA 2M6NA 3KIFA 1YIJ1 2QA4Z 1DL6A 1VQL1 4NBDA 2NVQI 1Q862 3CC21 4NB9A 3J80b 1K732 2OTL1 1VQ71 2GU2A 4A3JI 3CPWY 1KQSY 4MD8A 2JUBA 5T64A 1WW9A 1I3QI 1M902 4HGZA 1YI21 2O53A 2V8JA 3FKII 4NFRA 2WAQA 2KI7B 1VQ9Z 3M3YI 1K8A1 2JA8I 1N8R1 3RZOI 1QVGZ 2E2JI 2J6AA 3CCLZ 4AYBA 1YJ91 1YJWZ 2W04A 3CC4Z 4RVFA 3J7A4 1YIT1 3J80f 3RZDI 4HGYA 3I4NI 1VQ81 4RVHA 1W2BZ 1VQ91 3CMEZ 3VTNA 4NBFA 2M48A 2RHBA 3S14I 4NBBA 3NDIA 5A2Qf 4MD9A 1VQ51 3CXCY 1RO0A 3GTMS 1P9NA 1VQ5Z 2K5RA 1KC81 1K83I 2G2KA 2E9HA 2EGTA 4MXUA 3VMIA 2P3YA 5C4JI 3QWUA 1Q811 2RT9A 4NBHA 4DK1A 3NH4A 1TWGI 3GTOI 3CCU1 4MONA 3CCL1 3H3VJ 5IT9b 3NFZA 1Z03A 1N2FA 5FLMI 3IFUA 4E31A 4A3II 3CCE1 2IZ4A 1Y1VS 1Z01A 4A3FI 1SFOI 1NJI1 1X0TA 1LQLA 2RBLA 5D1PA 3NH8A 3CCJ1 4MRIA 4NOZA 4BY1I 3CD6Z 4Y7NI 3S15I 2NVTI 1KD12 4BBSI 1X3ZA 3GTGI 3CMA1 3EERA 1YUKA 4EWCA 5FLXf 1VQKZ 2NVYI 3IX0A 3G4SZ 5IT9f 4A3EI 1VQLZ 1K8A2 1NP6A 1RQFA 1KRLA 4BY7I 3G6E1 3S1MI 2Y0SA 1VQ6Z 3H0GI 4A3DI 4A3MI 3NDJA 1R9TI 2ZAEB 3BG0B 3T4NB 3TE5B 2R92I 3KIHA 4DGLA 3CCVZ 2E2HI 2AKLA 2JA7I 2JMOA 1Q7Y1 3EEDA 2JS4A 3GTMI 1Q812 1RO4A 4E2WA 1PFTA 3F3PC 2IZ3A 1VQ61 1Q861 3MZKB 3CCR1 1ZB8A 3OW2Z 3S2DI 4RV9A 3HOXI 3HOVI 4A3CI 2I3CA 3CME1 4E33A 2RPRA 4MD7A 3GTPI 2YADA 1W2BY 2R6MA 3M4OI 3S17I 1NUIA 2GTIA 2PM9A 3CCUZ 1YJ9Z 1S72Z 1WCMI 1Q7Y2 1Y1VI 3J81f 1Z02A 4HH4A 3VB9A 2JR6A 2VUMI 3K7AI 3D6WA 3FQQA 2QR1B 1QYPA 3I4MI 1USPB 1TFIA 2V8IA 1KD11 2QRCB 3VMGA 1USPA 3GTKI 5T6BA 2F4MA 4E2ZA 3NH5A 2DE5A 3HOYI 3JAMb 1YITZ 3PO2I 4E2YA 1QVFZ 3CC41 2VF1A 2O4HA 2KPIA 3D9XA 3PO3I 3I07A 1YIJZ 3P5JB 4RVGA 2R93I 3HOWI 2Q51A 2YU9I 5C4XI 1K9M2 4BXXI 3CPWZ 5IP7I 1JJ2Y 3G711 2JA5I 3U50C 3MONA 3GTJI 3CC2Z 1Y1WI 2LFUA 3HOZI 3I55Z 1S721 4A93I 2OOYB 3G6EZ 3J81b 4A3BI 2VUGA 3G4S1 3CCQ1 4CL1A 1RNIA 3FQMA 3OW2Y 1VQK1 1QF8A 1YHQZ 4QTTA 3HKZA 1YI2Z 3F3FC 1K9M1 1VQ41 2BJOA 3BG1B 1K731 2PMZA 4E2XA 3CD61 1N8R2 3LUSA 4NB8A 1VQMZ 4E32A 2OTLZ 1TWFI 3GTLI 4QTUA 4DQYB 2NVXI 4A3KI 2QA41 2E2II 1Q822 2H85A 1VLAA 3CCEZ 1VQ4Z 4MH4A 4A3GI 1YJNZ 1TWCI 3CC71 3GCFA 1VQP1 2PK7A 1QVFY 3CCS1 3CMAZ 3IF8A 2QEXZ 1RO2A 1WIIA 1VQN1 2V8KA 1TWHI 3HOUI 3I551 5CM2M 3MZLB 4NH1C 5T67A 1ML8A 1JWHC 3TDHB 2B63I 2QRDB 3CXCZ 3S2HI 1X3WA 4XX2A 1VQ8Z 3CCM1 3GTQI 4RVDA 2QLVB 3I561 2OZKA 1KC82 2Q4ZA 4X6AI 1VQPZ 2QKDA 1I50I 5AN9F 1RLYA 1L1OC 4TNUA 1QVGY 2HU9A 3GKQA 4S1TA 3CCMZ 2OTJZ 2GTHA 3CCRZ 4RS4A 5C44I 2WB1A 2OTJ1 4NBEA 5C3EI 1VQ7Z 1YUAA 2QEX1 2JNYA 2P28A 2DE6A 3ESWA 3CCV1 3CCSZ 1ZB9A 2JA6I 3PO3S 5D1OA 1M1K2 2DE7A 1YJW1 3JAMf 1YJN1 3I56Z 5D1OB 4NBCA 4BBRI 1M1K1 1YHQ1 1ZH1A 5IP9I 3CC7Z 4Y52I 3CCQZ 2HF1A 5FLXb 1TWAI 2K3RA 1NJI2 3Q87A 1KQSZ 2RIQA 1VQOZ 3S1QI 3CQZI 2R7ZI 1VQO1 1VQNZ 1I6HI 2LIYA 3S16I 1VQM1 3S1RI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFI A;  1Y1V S;  4A3L I;  4A3F I;  3VMG A;  1SFO I;  1USP A;  3GTK I;  1LQL A;  1TWH I;  2RBL A;  3HOU I;  4NBG A;  5CM2 M;  2F4M A;  1ML8 A;  2F4O A;  4NBA A;  3S1N I;  3VMH A;  2DE5 A;  3HOY I;  4NOZ A;  4BY1 I;  3PO2 I;  4Y7N I;  3S15 I;  2NVT I;  1DL6 A;  2B63 I;  4NBD A;  2KPI A;  2NVQ I;  4BBS I;  3PO3 I;  3I07 A;  3S2H I;  1X3Z A;  2R93 I;  1X3W A;  4XX2 A;  3GTG I;  3HOW I;  3S1R I;  2YU9 I;  4NB9 A;  3EER A;  3GTQ I;  5C4X I;  4A3J I;  2NVY I;  4BXX I;  4A3E I;  5IP7 I;  1WW9 A;  1I3Q I;  2JA5 I;  4BY7 I;  3U50 C;  3S1M I;  3GTJ I;  3FKI I;  3H0G I;  4X6A I;  1Y1W I;  3HOZ I;  4A3D I;  4A3M I;  1I50 I;  1R9T I;  4A93 I;  1RLY A;  1L1O C;  3GKQ A;  3M3Y I;  2R92 I;  2JA8 I;  3RZO I;  4A3B I;  5C44 I;  2AKL A;  2E2H I;  2E2J I;  2JA7 I;  2J6A A;  4NBE A;  5C3E I;  2JS4 A;  3GTM I;  1RO4 A;  1YUA A;  1PFT A;  3RZD I;  2JNY A;  4QTT A;  3I4N I;  2DE6 A;  3ESW A;  1ZB8 A;  2BJO A;  3S2D I;  1ZB9 A;  2JA6 I;  3PO3 S;  3HOX I;  3HOV I;  4A3C I;  2DE7 A;  4NBF A;  3S14 I;  4NBB A;  3LUS A;  4NBC A;  4BBR I;  4NB8 A;  3GTP I;  3GTM S;  1TWF I;  5IP9 I;  3GTL I;  3M4O I;  3S17 I;  1NUI A;  4QTU A;  4Y52 I;  2HF1 A;  2K5R A;  1K83 I;  1TWA I;  1WCM I;  2NVX I;  1Y1V I;  3VMI A;  2P3Y A;  4A3K I;  2E2I I;  5C4J I;  1VLA A;  3Q87 A;  4NBH A;  4MH4 A;  3S1Q I;  3CQZ I;  2R7Z I;  3VB9 A;  1TWG I;  3GTO I;  2JR6 A;  2VUM I;  4A3G I;  1TWC I;  3K7A I;  1I6H I;  3GCF A;  3D6W A;  3H3V J;  5FLM I;  1N2F A;  2PK7 A;  3S16 I;  4A3I I;  1QYP A;  3I4M I;  1USP B; 
#chains in the Genus database with same CATH topology
 3G71 Z;  3CCJ Z;  4A3L I;  4E30 A;  1S7M A;  2VPX A;  5A2Q b;  1Q82 1;  1JJ2 Z;  2W03 A;  5LL6 f;  1M90 1;  2OOX B;  2NAP A;  2QRE B;  4NBG A;  2F4O A;  4NBA A;  2VPY A;  3S1N I;  3VMH A;  2M6N A;  3KIF A;  1YIJ 1;  2QA4 Z;  1DL6 A;  1VQL 1;  4NBD A;  2NVQ I;  1Q86 2;  3CC2 1;  4NB9 A;  3J80 b;  1K73 2;  2OTL 1;  1FDO A;  1VQ7 1;  2GU2 A;  4A3J I;  3CPW Y;  1KQS Y;  4MD8 A;  2JUB A;  5T64 A;  1WW9 A;  1I3Q I;  1M90 2;  4HGZ A;  1YI2 1;  2O53 A;  2V8J A;  3FKI I;  4NFR A;  2WAQ A;  2KI7 B;  1VQ9 Z;  3M3Y I;  1K8A 1;  2JA8 I;  1N8R 1;  3RZO I;  1QVG Z;  2E2J I;  2J6A A;  3CCL Z;  4AYB A;  1YJ9 1;  1YJW Z;  2W04 A;  3CC4 Z;  4RVF A;  3J7A 4;  1YIT 1;  3J80 f;  3RZD I;  4HGY A;  3I4N I;  1VQ8 1;  4RVH A;  1W2B Z;  1VQ9 1;  3CME Z;  3VTN A;  1WZN A;  4NBF A;  2M48 A;  2RHB A;  3S14 I;  4NBB A;  3NDI A;  5A2Q f;  4MD9 A;  1VQ5 1;  3CXC Y;  1RO0 A;  3GTM S;  1P9N A;  2JIQ A;  1VQ5 Z;  2K5R A;  1KC8 1;  1K83 I;  2G2K A;  2E9H A;  2EGT A;  4MXU A;  2VPW A;  3VMI A;  2P3Y A;  5C4J I;  3QWU A;  2V3V A;  1Q81 1;  2RT9 A;  4NBH A;  4DK1 A;  3NH4 A;  1TWG I;  3GTO I;  3CCU 1;  2V45 A;  4MON A;  3CCL 1;  3H3V J;  5IT9 b;  3NFZ A;  1Z03 A;  1N2F A;  5FLM I;  3IFU A;  4E31 A;  4A3I I;  3CCE 1;  2IZ4 A;  1Y1V S;  1Z01 A;  4A3F I;  1SFO I;  1NJI 1;  1X0T A;  1LQL A;  2RBL A;  5D1P A;  3NH8 A;  3CCJ 1;  4MRI A;  4NOZ A;  4BY1 I;  3CD6 Z;  4Y7N I;  3S15 I;  2NVT I;  1KD1 2;  4BBS I;  1X3Z A;  3GTG I;  3CMA 1;  3EER A;  1YUK A;  2LEX A;  4EWC A;  5FLX f;  1VQK Z;  2NVY I;  3IX0 A;  3G4S Z;  5IT9 f;  4A3E I;  1VQL Z;  1K8A 2;  1NP6 A;  1RQF A;  1KRL A;  4BY7 I;  3G6E 1;  3S1M I;  2Y0S A;  1VQ6 Z;  3H0G I;  4A3D I;  4A3M I;  3NDJ A;  1R9T I;  2ZAE B;  3BG0 B;  3T4N B;  3TE5 B;  2R92 I;  3KIH A;  4DGL A;  3CCV Z;  2E2H I;  2AKL A;  2JA7 I;  2JMO A;  1Q7Y 1;  3EED A;  2JS4 A;  3GTM I;  1Q81 2;  1RO4 A;  4E2W A;  1PFT A;  3F3P C;  3IR7 A;  2IZ3 A;  1VQ6 1;  1Q86 1;  3MZK B;  3CCR 1;  1ZB8 A;  3OW2 Z;  3S2D I;  4RV9 A;  3HOX I;  3HOV I;  4A3C I;  1Q16 A;  2I3C A;  3CME 1;  4E33 A;  1SIW A;  2RPR A;  4MD7 A;  3GTP I;  2YAD A;  1W2B Y;  2R6M A;  3M4O I;  3S17 I;  1NUI A;  2GTI A;  2PM9 A;  2JIP A;  2E7Z A;  3CCU Z;  1YJ9 Z;  1S72 Z;  1WCM I;  1Q7Y 2;  1Y1V I;  3J81 f;  1Z02 A;  4HH4 A;  3VB9 A;  2JR6 A;  2VUM I;  3K7A I;  3D6W A;  3FQQ A;  2QR1 B;  1QYP A;  3I4M I;  1USP B;  1TFI A;  2V8I A;  2JIM A;  1KD1 1;  2QRC B;  3VMG A;  1USP A;  3GTK I;  5T6B A;  2F4M A;  4E2Z A;  3NH5 A;  2DE5 A;  3HOY I;  3JAM b;  1YIT Z;  3PO2 I;  4E2Y A;  1QVF Z;  3CC4 1;  2VF1 A;  2O4H A;  2KPI A;  3D9X A;  3PO3 I;  3I07 A;  1YIJ Z;  3P5J B;  4RVG A;  2R93 I;  3HOW I;  2Q51 A;  2YU9 I;  5C4X I;  1K9M 2;  4BXX I;  3CPW Z;  5IP7 I;  1JJ2 Y;  3G71 1;  2JA5 I;  3U50 C;  3MON A;  3GTJ I;  3CC2 Z;  1Y1W I;  2LFU A;  3HOZ I;  3I55 Z;  1S72 1;  4A93 I;  2OOY B;  3G6E Z;  3J81 b;  4A3B I;  2VUG A;  2AYD A;  3G4S 1;  3CCQ 1;  4CL1 A;  1RNI A;  3FQM A;  3OW2 Y;  1VQK 1;  1QF8 A;  1YHQ Z;  4QTT A;  3HKZ A;  1YI2 Z;  3F3F C;  1K9M 1;  1VQ4 1;  2BJO A;  3BG1 B;  1K73 1;  2PMZ A;  4E2X A;  3CD6 1;  1N8R 2;  3LUS A;  4NB8 A;  1VQM Z;  4E32 A;  2JIR A;  2OTL Z;  1TWF I;  3GTL I;  4QTU A;  4DQY B;  2NVX I;  4A3K I;  2QA4 1;  2E2I I;  3D2L A;  1Q82 2;  2H85 A;  1VLA A;  3CCE Z;  1VQ4 Z;  4MH4 A;  4A3G I;  1YJN Z;  1TWC I;  3CC7 1;  3GCF A;  1VQP 1;  2PK7 A;  1QVF Y;  3CCS 1;  3CMA Z;  3IF8 A;  2QEX Z;  1RO2 A;  1WII A;  1VQN 1;  2IV2 X;  2V8K A;  1TWH I;  3HOU I;  3I55 1;  5CM2 M;  3MZL B;  4NH1 C;  5T67 A;  1ML8 A;  1JWH C;  3TDH B;  1FDI A;  2B63 I;  2QRD B;  3CXC Z;  3S2H I;  1AA6 A;  1X3W A;  4XX2 A;  1QXF A;  1VQ8 Z;  3CCM 1;  3GTQ I;  4RVD A;  2QLV B;  3I56 1;  2OZK A;  1KC8 2;  2Q4Z A;  4X6A I;  1VQP Z;  2QKD A;  1I50 I;  5AN9 F;  1RLY A;  1L1O C;  4TNU A;  1QVG Y;  2HU9 A;  3GKQ A;  4S1T A;  3CCM Z;  2OTJ Z;  2GTH A;  1WJ2 A;  3CCR Z;  4RS4 A;  5C44 I;  2WB1 A;  2OTJ 1;  4NBE A;  2JIO A;  5C3E I;  1VQ7 Z;  1YUA A;  2QEX 1;  2JNY A;  2P28 A;  2DE6 A;  3ESW A;  3CCV 1;  3CCS Z;  1ZB9 A;  2JA6 I;  3PO3 S;  5D1O A;  1M1K 2;  2DE7 A;  1YJW 1;  3JAM f;  1YJN 1;  3I56 Z;  5D1O B;  4NBC A;  4BBR I;  1M1K 1;  1YHQ 1;  1ZH1 A;  5IP9 I;  3CC7 Z;  4Y52 I;  3CCQ Z;  2HF1 A;  5FLX b;  1TWA I;  1Y8C A;  2K3R A;  1NJI 2;  3Q87 A;  1KQS Z;  2RIQ A;  1VQO Z;  3S1Q I;  3CQZ I;  2R7Z I;  1VQO 1;  1VQN Z;  1I6H I;  2VPZ A;  2LIY A;  3S16 I;  1VQM 1;  3S1R I; 
#chains in the Genus database with same CATH homology
 3G71 Z;  3CCJ Z;  4A3L I;  4E30 A;  1S7M A;  5A2Q b;  1Q82 1;  1JJ2 Z;  2W03 A;  5LL6 f;  1M90 1;  2OOX B;  2QRE B;  4NBG A;  2F4O A;  4NBA A;  3S1N I;  3VMH A;  2M6N A;  3KIF A;  1YIJ 1;  2QA4 Z;  1DL6 A;  1VQL 1;  4NBD A;  2NVQ I;  1Q86 2;  3CC2 1;  4NB9 A;  3J80 b;  1K73 2;  2OTL 1;  1VQ7 1;  2GU2 A;  4A3J I;  3CPW Y;  1KQS Y;  4MD8 A;  2JUB A;  5T64 A;  1WW9 A;  1I3Q I;  1M90 2;  4HGZ A;  1YI2 1;  2O53 A;  2V8J A;  3FKI I;  4NFR A;  2WAQ A;  2KI7 B;  1VQ9 Z;  3M3Y I;  1K8A 1;  2JA8 I;  1N8R 1;  3RZO I;  1QVG Z;  2E2J I;  2J6A A;  3CCL Z;  4AYB A;  1YJ9 1;  1YJW Z;  2W04 A;  3CC4 Z;  4RVF A;  3J7A 4;  1YIT 1;  3J80 f;  3RZD I;  4HGY A;  3I4N I;  1VQ8 1;  4RVH A;  1W2B Z;  1VQ9 1;  3CME Z;  3VTN A;  4NBF A;  2M48 A;  2RHB A;  3S14 I;  4NBB A;  3NDI A;  5A2Q f;  4MD9 A;  1VQ5 1;  3CXC Y;  1RO0 A;  3GTM S;  1P9N A;  1VQ5 Z;  2K5R A;  1KC8 1;  1K83 I;  2G2K A;  2E9H A;  2EGT A;  4MXU A;  3VMI A;  2P3Y A;  5C4J I;  3QWU A;  1Q81 1;  2RT9 A;  4NBH A;  4DK1 A;  3NH4 A;  1TWG I;  3GTO I;  3CCU 1;  4MON A;  3CCL 1;  3H3V J;  5IT9 b;  3NFZ A;  1Z03 A;  1N2F A;  5FLM I;  3IFU A;  4E31 A;  4A3I I;  3CCE 1;  2IZ4 A;  1Y1V S;  1Z01 A;  4A3F I;  1SFO I;  1NJI 1;  1X0T A;  1LQL A;  2RBL A;  5D1P A;  3NH8 A;  3CCJ 1;  4MRI A;  4NOZ A;  4BY1 I;  3CD6 Z;  4Y7N I;  3S15 I;  2NVT I;  1KD1 2;  4BBS I;  1X3Z A;  3GTG I;  3CMA 1;  3EER A;  1YUK A;  4EWC A;  5FLX f;  1VQK Z;  2NVY I;  3IX0 A;  3G4S Z;  5IT9 f;  4A3E I;  1VQL Z;  1K8A 2;  1NP6 A;  1RQF A;  1KRL A;  4BY7 I;  3G6E 1;  3S1M I;  2Y0S A;  1VQ6 Z;  3H0G I;  4A3D I;  4A3M I;  3NDJ A;  1R9T I;  2ZAE B;  3BG0 B;  3T4N B;  3TE5 B;  2R92 I;  3KIH A;  4DGL A;  3CCV Z;  2E2H I;  2AKL A;  2JA7 I;  2JMO A;  1Q7Y 1;  3EED A;  2JS4 A;  3GTM I;  1Q81 2;  1RO4 A;  4E2W A;  1PFT A;  3F3P C;  2IZ3 A;  1VQ6 1;  1Q86 1;  3MZK B;  3CCR 1;  1ZB8 A;  3OW2 Z;  3S2D I;  4RV9 A;  3HOX I;  3HOV I;  4A3C I;  2I3C A;  3CME 1;  4E33 A;  2RPR A;  4MD7 A;  3GTP I;  2YAD A;  1W2B Y;  2R6M A;  3M4O I;  3S17 I;  1NUI A;  2GTI A;  2PM9 A;  3CCU Z;  1YJ9 Z;  1S72 Z;  1WCM I;  1Q7Y 2;  1Y1V I;  3J81 f;  1Z02 A;  4HH4 A;  3VB9 A;  2JR6 A;  2VUM I;  3K7A I;  3D6W A;  3FQQ A;  2QR1 B;  1QYP A;  3I4M I;  1USP B;  1TFI A;  2V8I A;  1KD1 1;  2QRC B;  3VMG A;  1USP A;  3GTK I;  5T6B A;  2F4M A;  4E2Z A;  3NH5 A;  2DE5 A;  3HOY I;  3JAM b;  1YIT Z;  3PO2 I;  4E2Y A;  1QVF Z;  3CC4 1;  2VF1 A;  2O4H A;  2KPI A;  3D9X A;  3PO3 I;  3I07 A;  1YIJ Z;  3P5J B;  4RVG A;  2R93 I;  3HOW I;  2Q51 A;  2YU9 I;  5C4X I;  1K9M 2;  4BXX I;  3CPW Z;  5IP7 I;  1JJ2 Y;  3G71 1;  2JA5 I;  3U50 C;  3MON A;  3GTJ I;  3CC2 Z;  1Y1W I;  2LFU A;  3HOZ I;  3I55 Z;  1S72 1;  4A93 I;  2OOY B;  3G6E Z;  3J81 b;  4A3B I;  2VUG A;  3G4S 1;  3CCQ 1;  4CL1 A;  1RNI A;  3FQM A;  3OW2 Y;  1VQK 1;  1QF8 A;  1YHQ Z;  4QTT A;  3HKZ A;  1YI2 Z;  3F3F C;  1K9M 1;  1VQ4 1;  2BJO A;  3BG1 B;  1K73 1;  2PMZ A;  4E2X A;  3CD6 1;  1N8R 2;  3LUS A;  4NB8 A;  1VQM Z;  4E32 A;  2OTL Z;  1TWF I;  3GTL I;  4QTU A;  4DQY B;  2NVX I;  4A3K I;  2QA4 1;  2E2I I;  1Q82 2;  2H85 A;  1VLA A;  3CCE Z;  1VQ4 Z;  4MH4 A;  4A3G I;  1YJN Z;  1TWC I;  3CC7 1;  3GCF A;  1VQP 1;  2PK7 A;  1QVF Y;  3CCS 1;  3CMA Z;  3IF8 A;  2QEX Z;  1RO2 A;  1WII A;  1VQN 1;  2V8K A;  1TWH I;  3HOU I;  3I55 1;  5CM2 M;  3MZL B;  4NH1 C;  5T67 A;  1ML8 A;  1JWH C;  3TDH B;  2B63 I;  2QRD B;  3CXC Z;  3S2H I;  1X3W A;  4XX2 A;  1VQ8 Z;  3CCM 1;  3GTQ I;  4RVD A;  2QLV B;  3I56 1;  2OZK A;  1KC8 2;  2Q4Z A;  4X6A I;  1VQP Z;  2QKD A;  1I50 I;  5AN9 F;  1RLY A;  1L1O C;  4TNU A;  1QVG Y;  2HU9 A;  3GKQ A;  4S1T A;  3CCM Z;  2OTJ Z;  2GTH A;  3CCR Z;  4RS4 A;  5C44 I;  2WB1 A;  2OTJ 1;  4NBE A;  5C3E I;  1VQ7 Z;  1YUA A;  2QEX 1;  2JNY A;  2P28 A;  2DE6 A;  3ESW A;  3CCV 1;  3CCS Z;  1ZB9 A;  2JA6 I;  3PO3 S;  5D1O A;  1M1K 2;  2DE7 A;  1YJW 1;  3JAM f;  1YJN 1;  3I56 Z;  5D1O B;  4NBC A;  4BBR I;  1M1K 1;  1YHQ 1;  1ZH1 A;  5IP9 I;  3CC7 Z;  4Y52 I;  3CCQ Z;  2HF1 A;  5FLX b;  1TWA I;  2K3R A;  1NJI 2;  3Q87 A;  1KQS Z;  2RIQ A;  1VQO Z;  3S1Q I;  3CQZ I;  2R7Z I;  1VQO 1;  1VQN Z;  1I6H I;  2LIY A;  3S16 I;  1VQM 1;  3S1R I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...