4A3DI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI02
4A3DI 4NOZA 4NBEA 1WCMI 2DE7A 3HOXI 3LUSA 3RZOI 2E2JI 4NB9A 3GTQI 2P3YA 3U50C 3S16I 4NBBA 5IP7I 3GTPI 4Y52I 1TWGI 4A3MI 4BY1I 2AKLA 3S15I 1ZB9A 3S1RI 3HOZI 2R93I 3GTJI 1TWCI 2E2HI 1K83I 1SFOI 2HF1A 3GTKI 1I3QI 3Q87A 3CQZI 2RBLA 3ESWA 3S1QI 3S2HI 2F4OA 1TWAI 2JA5I 3FKII 5C44I 1Y1VS 2JNYA 3S1MI 1I50I 2BJOA 1ML8A 4A3KI 4BXXI 3H0GI 3I07A 1X3WA 1LQLA 3GTOI 4A3JI 1PFTA 1N2FA 3D6WA 3K7AI 5FLMI 3GKQA 3VB9A 1RO4A 4Y7NI 5C3EI 3GTGI 4NBHA 3S17I 2R7ZI 3PO3S 3S2DI 3HOYI 2J6AA 2NVYI 3HOVI 1NUIA 1USPB 2JR6A 4NBGA 1Y1WI 2JA7I 1L1OC 4NBCA 5C4JI 4A3EI 1X3ZA 3GTLI 4XX2A 2PK7A 1QYPA 5IP9I 1TFIA 2YU9I 4BBRI 4A3LI 2NVQI 4A93I 3H3VJ 3I4MI 4BY7I 2KPIA 2JA6I 2NVTI 1Y1VI 4QTUA 3S14I 2R92I 3RZDI 3GTMS 5C4XI 1TWHI 4A3II 3M4OI 1R9TI 3EERA 2JA8I 4A3FI 2B63I 4BBSI 1TWFI 2E2II 2F4MA 1DL6A 2DE5A 1WW9A 4QTTA 3GTMI 1RLYA 3VMIA 2K5RA 2NVXI 3PO3I 1USPA 3HOWI 3M3YI 1YUAA 4NBFA 1VLAA 4NBAA 4A3BI 4A3CI 4X6AI 2DE6A 5CM2M 1I6HI 4NBDA 3HOUI 4A3GI 1ZB8A 3I4NI 3PO2I 3GCFA 4NB8A 2VUMI 4MH4A 2JS4A 3VMGA 3VMHA 3S1NI
chains in the Genus database with same CATH superfamily
3RZOI 2W04A 4NB9A 3GTQI 3CCQZ 5IP7I 4Y52I 3F3FC 4NFRA 3S1RI 4DQYB 3GTJI 3J80f 2JIPA 1K83I 1K9M2 3TDHB 2QLVB 1Z03A 2V8IA 2HF1A 3GTKI 3MZLB 3Q87A 1VQN1 2GTIA 1VQ4Z 3KIHA 1TWAI 5C44I 1Y1VS 2BJOA 2ZAEB 3I561 4BXXI 3I07A 3CCR1 1LQLA 4DK1A 1M1K2 1PFTA 2JIOA 2OOYB 3D6WA 5FLMI 5IT9b 3GKQA 1RNIA 5C3EI 1VQ8Z 2R7ZI 5D1OB 3S2DI 3HKZA 1VQNZ 1QVGY 1QVFY 1KD12 2M48A 3NFZA 2OTL1 5FLXb 3NH4A 4NBGA 1L1OC 1K8A2 3TE5B 5T67A 4XX2A 2PK7A 2YU9I 3I56Z 3CC7Z 3BG1B 3KIFA 3G6E1 1Q822 4BY7I 2JA6I 1VQK1 1Q862 1Q7Y1 4MD8A 3CPWY 2R92I 3GTMS 1JWHC 4A3II 1RO0A 2VPZA 3CXCY 4A3FI 1YJW1 2V3VA 3I551 3NH5A 2E2II 5T6BA 1QVGZ 1QVFZ 4EWCA 2LFUA 1JJ2Y 2OTLZ 3CMAZ 2JUBA 3CCJ1 2NVXI 3JAMf 1VLAA 2H85A 5A2Qf 1YIT1 3CD61 3G6EZ 5CM2M 1I6HI 4A3GI 1ZB8A 1VQKZ 3I4NI 3J81b 3CPWZ 1M901 2R6MA 2JS4A 1YJNZ 1YJWZ 3S1NI 2VF1A 4NOZA 3J80b 2NAPA 1YUKA 3HOXI 1JJ2Z 3LUSA 3CCJZ 3U50C 2VPWA 2OZKA 3G4SZ 4BY1I 1Z02A 2AKLA 1K732 1KRLA 4S1TA 4E2WA 1TWCI 2E2HI 1KQSY 2OOXB 1SFOI 4HH4A 4E32A 4E2ZA 3CCUZ 1QXFA 1I3QI 2RHBA 3IFUA 2LEXA 2IZ3A 3ESWA 3D2LA 4RS4A 1VQ41 3S2HI 2F4OA 2JA5I 2O4HA 4AYBA 3FKII 1SIWA 2JIQA 4MD7A 1S721 1Y8CA 1NJI2 1X3WA 1VQ91 4E2XA 1KQSZ 1KD11 3VB9A 1RO4A 1VQ81 2GU2A 2J6AA 2NVYI 3HOVI 3IF8A 3CC4Z 2QREB 2WB1A 5D1PA 3FQMA 2JMOA 1Q821 1S72Z 1KC81 2W03A 3OW2Y 3CC71 2NVQI 2KPIA 1VQ9Z 1P9NA 2AYDA 3G71Z 3T4NB 2JA8I 3CCSZ 4BBSI 4MRIA 2VUGA 2DE5A 2P28A 1WW9A 2E7ZA 4QTTA 3CMA1 3VMIA 1ZH1A 3MZKB 3NDIA 2QRDB 3M3YI 1YUAA 4E30A 3OW2Z 2RT9A 4NBAA 4A3BI 2DE6A 1FDOA 1N8R1 3HOUI 3VMHA 1YJN1 4A3DI 4NH1C 1Q812 1K731 1RO2A 2QKDA 5D1OA 4RVDA 3S16I 1X0TA 3IX0A 3GTPI 1YJ91 2WAQA 3G4S1 1ZB9A 5T64A 1VQO1 2Y0SA 1VQ71 2VPXA 3CCU1 2Q4ZA 2OTJZ 3CQZI 2RBLA 3CXCZ 2V8KA 4RVHA 4HGYA 4E33A 3S1QI 1NJI1 5IT9f 2HU9A 1S7MA 1YIJ1 1I50I 2QR1B 3NH8A 1ML8A 1K9M1 1YJ9Z 3H0GI 4TNUA 4A3JI 5FLXf 1VQOZ 3K7AI 3J7A4 1VQ7Z 3GTGI 1QF8A 3S17I 1NP6A 3D9XA 4RVGA 2EGTA 1Q7Y2 2M6NA 1NUIA 3CC41 1Q16A 2JR6A 1Y1WI 4NBCA 1M1K1 1YIJZ 2YADA 1X3ZA 3GTLI 2JIRA 1Z01A 4BBRI 4A3LI 3MONA 3H3VJ 3I4MI 1YHQ1 1WIIA 2NVTI 4QTUA 3G711 1WZNA 2QRCB 1VQ51 3VTNA 5C4XI 1TWHI 4RV9A 1R9TI 2V45A 3CCM1 2VPYA 3CCS1 1K8A1 2B63I 3QWUA 1M902 1VQMZ 1FDIA 3GTMI 3CC2Z 2RIQA 1RLYA 3EEDA 2IV2X 4CL1A 4E31A 2I3CA 3J81f 3CCL1 2K5RA 3PO3I 1Q861 3HOWI 1AA6A 4A3CI 1RQFA 1YHQZ 4NBDA 1Q811 3GCFA 1VQ5Z 2VUMI 4MH4A 3JAMb 2E9HA 3CCMZ 4NBEA 5A2Qb 5AN9F 1WCMI 2DE7A 4MONA 2E2JI 2P3YA 3CCLZ 4NBBA 1TWGI 4A3MI 3S15I 3HOZI 2R93I 2QEX1 1VQL1 2QA41 2KI7B 2OTJ1 1VQP1 2K3RA 2JNYA 3S1MI 3BG0B 4A3KI 2Q51A 4RVFA 3CCRZ 3CME1 2V8JA 3FQQA 3GTOI 2PMZA 2QEXZ 1N2FA 1VQLZ 1KC82 2QA4Z 1VQ61 4Y7NI 4DGLA 4NBHA 4MXUA 3PO3S 1VQPZ 5LL6f 1YI21 3HOYI 3CCV1 1USPB 2JA7I 5C4JI 4A3EI 3NDJA 1QYPA 5IP9I 1TFIA 3CMEZ 3CCE1 4A93I 2GTHA 1Y1VI 3S14I 3RZDI 1W2BY 1VQ6Z 3M4OI 3EERA 1WJ2A 2LIYA 3I55Z 2PM9A 1N8R2 1TWFI 2F4MA 1DL6A 1YI2Z 2IZ4A 1VQM1 3CCVZ 3CC21 4E2YA 3CCQ1 4MD9A 2G2KA 1USPA 2O53A 4NBFA 1YITZ 3CCEZ 3P5JB 3CD6Z 4X6AI 3F3PC 3PO2I 1W2BZ 4HGZA 4NB8A 3IR7A 2RPRA 2JIMA 3VMGA
chains in the Genus database with same CATH topology
3RZOI 2W04A 4NB9A 3GTQI 3CCQZ 5IP7I 4Y52I 3F3FC 4NFRA 3S1RI 4DQYB 3GTJI 3J80f 1K83I 1K9M2 3TDHB 2QLVB 1Z03A 2V8IA 2HF1A 3GTKI 3MZLB 3Q87A 1VQN1 2GTIA 1VQ4Z 3KIHA 1TWAI 5C44I 1Y1VS 2BJOA 2ZAEB 3I561 4BXXI 3I07A 3CCR1 1LQLA 4DK1A 1M1K2 1PFTA 2OOYB 3D6WA 5FLMI 5IT9b 3GKQA 1RNIA 5C3EI 1VQ8Z 2R7ZI 5D1OB 3S2DI 3HKZA 1VQNZ 1QVGY 1QVFY 1KD12 2M48A 3NFZA 2OTL1 5FLXb 3NH4A 4NBGA 1L1OC 1K8A2 3TE5B 5T67A 4XX2A 2PK7A 2YU9I 3I56Z 3CC7Z 3BG1B 3KIFA 3G6E1 1Q822 4BY7I 2JA6I 1VQK1 1Q862 1Q7Y1 4MD8A 3CPWY 2R92I 3GTMS 1JWHC 4A3II 1RO0A 3CXCY 4A3FI 1YJW1 3I551 3NH5A 2E2II 5T6BA 1QVGZ 1QVFZ 4EWCA 2LFUA 1JJ2Y 2OTLZ 3CMAZ 2JUBA 3CCJ1 2NVXI 3JAMf 1VLAA 2H85A 5A2Qf 1YIT1 3CD61 3G6EZ 5CM2M 1I6HI 4A3GI 1ZB8A 1VQKZ 3I4NI 3J81b 3CPWZ 1M901 2R6MA 2JS4A 1YJNZ 1YJWZ 3S1NI 2VF1A 4NOZA 3J80b 1YUKA 3HOXI 1JJ2Z 3LUSA 3CCJZ 3U50C 2OZKA 3G4SZ 4BY1I 1Z02A 2AKLA 1K732 1KRLA 4S1TA 4E2WA 1TWCI 2E2HI 1KQSY 2OOXB 1SFOI 4HH4A 4E32A 4E2ZA 3CCUZ 1I3QI 2RHBA 3IFUA 2IZ3A 3ESWA 4RS4A 1VQ41 3S2HI 2F4OA 2JA5I 2O4HA 4AYBA 3FKII 4MD7A 1S721 1NJI2 1X3WA 1VQ91 4E2XA 1KQSZ 1KD11 3VB9A 1RO4A 1VQ81 2GU2A 2J6AA 2NVYI 3HOVI 3IF8A 3CC4Z 2QREB 2WB1A 5D1PA 3FQMA 2JMOA 1Q821 1S72Z 1KC81 2W03A 3OW2Y 3CC71 2NVQI 2KPIA 1VQ9Z 1P9NA 3G71Z 3T4NB 2JA8I 3CCSZ 4BBSI 4MRIA 2VUGA 2DE5A 2P28A 1WW9A 4QTTA 3CMA1 3VMIA 1ZH1A 3MZKB 3NDIA 2QRDB 3M3YI 1YUAA 4E30A 3OW2Z 2RT9A 4NBAA 4A3BI 2DE6A 1N8R1 3HOUI 3VMHA 1YJN1 4A3DI 4NH1C 1Q812 1K731 1RO2A 2QKDA 5D1OA 4RVDA 3S16I 1X0TA 3IX0A 3GTPI 1YJ91 2WAQA 3G4S1 1ZB9A 5T64A 1VQO1 2Y0SA 1VQ71 3CCU1 2Q4ZA 2OTJZ 3CQZI 2RBLA 3CXCZ 2V8KA 4RVHA 4HGYA 4E33A 3S1QI 1NJI1 5IT9f 2HU9A 1S7MA 1YIJ1 1I50I 2QR1B 3NH8A 1ML8A 1K9M1 1YJ9Z 3H0GI 4TNUA 4A3JI 5FLXf 1VQOZ 3K7AI 3J7A4 1VQ7Z 3GTGI 1QF8A 3S17I 1NP6A 3D9XA 4RVGA 2EGTA 1Q7Y2 2M6NA 1NUIA 3CC41 2JR6A 1Y1WI 4NBCA 1M1K1 1YIJZ 2YADA 1X3ZA 3GTLI 1Z01A 4BBRI 4A3LI 3MONA 3H3VJ 3I4MI 1YHQ1 1WIIA 2NVTI 4QTUA 3G711 2QRCB 1VQ51 3VTNA 5C4XI 1TWHI 4RV9A 1R9TI 3CCM1 3CCS1 1K8A1 2B63I 3QWUA 1M902 1VQMZ 3GTMI 3CC2Z 2RIQA 1RLYA 3EEDA 4CL1A 3J81f 4E31A 2I3CA 3CCL1 2K5RA 3PO3I 1Q861 3HOWI 4A3CI 1RQFA 1YHQZ 4NBDA 1Q811 3GCFA 1VQ5Z 2VUMI 4MH4A 3JAMb 2E9HA 3CCMZ 4NBEA 5A2Qb 5AN9F 1WCMI 2DE7A 4MONA 2E2JI 2P3YA 3CCLZ 4NBBA 1TWGI 4A3MI 3S15I 3HOZI 2R93I 2QEX1 1VQL1 2QA41 2KI7B 2OTJ1 1VQP1 2K3RA 2JNYA 3S1MI 3BG0B 4A3KI 2Q51A 4RVFA 3CCRZ 3CME1 2V8JA 3FQQA 3GTOI 2PMZA 2QEXZ 1N2FA 1VQLZ 1KC82 2QA4Z 1VQ61 4Y7NI 4DGLA 4NBHA 4MXUA 3PO3S 1VQPZ 5LL6f 1YI21 3HOYI 3CCV1 1USPB 2JA7I 5C4JI 4A3EI 3NDJA 1QYPA 5IP9I 1TFIA 3CMEZ 3CCE1 4A93I 2GTHA 1Y1VI 3S14I 3RZDI 1W2BY 1VQ6Z 3M4OI 3EERA 2LIYA 3I55Z 2PM9A 1N8R2 1TWFI 2F4MA 1DL6A 1YI2Z 2IZ4A 1VQM1 3CCVZ 3CC21 4E2YA 3CCQ1 4MD9A 2G2KA 1USPA 2O53A 4NBFA 1YITZ 3CCEZ 3P5JB 3CD6Z 4X6AI 3F3PC 3PO2I 1W2BZ 4HGZA 4NB8A 2RPRA 3VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D I;  4NOZ A;  4NBE A;  1WCM I;  2DE7 A;  3HOX I;  3LUS A;  3RZO I;  2E2J I;  4NB9 A;  3GTQ I;  2P3Y A;  3U50 C;  3S16 I;  4NBB A;  5IP7 I;  3GTP I;  4Y52 I;  1TWG I;  4A3M I;  4BY1 I;  2AKL A;  3S15 I;  1ZB9 A;  3S1R I;  3HOZ I;  2R93 I;  3GTJ I;  1TWC I;  2E2H I;  1K83 I;  1SFO I;  2HF1 A;  3GTK I;  1I3Q I;  3Q87 A;  3CQZ I;  2RBL A;  3ESW A;  3S1Q I;  3S2H I;  2F4O A;  1TWA I;  2JA5 I;  3FKI I;  5C44 I;  1Y1V S;  2JNY A;  3S1M I;  1I50 I;  2BJO A;  1ML8 A;  4A3K I;  4BXX I;  3H0G I;  3I07 A;  1X3W A;  1LQL A;  3GTO I;  4A3J I;  1PFT A;  1N2F A;  3D6W A;  3K7A I;  5FLM I;  3GKQ A;  3VB9 A;  1RO4 A;  4Y7N I;  5C3E I;  3GTG I;  4NBH A;  3S17 I;  2R7Z I;  3PO3 S;  3S2D I;  3HOY I;  2J6A A;  2NVY I;  3HOV I;  1NUI A;  1USP B;  2JR6 A;  4NBG A;  1Y1W I;  2JA7 I;  1L1O C;  4NBC A;  5C4J I;  4A3E I;  1X3Z A;  3GTL I;  4XX2 A;  2PK7 A;  1QYP A;  5IP9 I;  1TFI A;  2YU9 I;  4BBR I;  4A3L I;  2NVQ I;  4A93 I;  3H3V J;  3I4M I;  4BY7 I;  2KPI A;  2JA6 I;  2NVT I;  1Y1V I;  4QTU A;  3S14 I;  2R92 I;  3RZD I;  3GTM S;  5C4X I;  1TWH I;  4A3I I;  3M4O I;  1R9T I;  3EER A;  2JA8 I;  4A3F I;  2B63 I;  4BBS I;  1TWF I;  2E2I I;  2F4M A;  1DL6 A;  2DE5 A;  1WW9 A;  4QTT A;  3GTM I;  1RLY A;  3VMI A;  2K5R A;  2NVX I;  3PO3 I;  1USP A;  3HOW I;  3M3Y I;  1YUA A;  4NBF A;  1VLA A;  4NBA A;  4A3B I;  4A3C I;  4X6A I;  2DE6 A;  5CM2 M;  1I6H I;  4NBD A;  3HOU I;  4A3G I;  1ZB8 A;  3I4N I;  3PO2 I;  3GCF A;  4NB8 A;  2VUM I;  4MH4 A;  2JS4 A;  3VMG A;  3VMH A;  3S1N I; 
#chains in the Genus database with same CATH topology
 3RZO I;  2W04 A;  4NB9 A;  3GTQ I;  3CCQ Z;  5IP7 I;  4Y52 I;  3F3F C;  4NFR A;  3S1R I;  4DQY B;  3GTJ I;  3J80 f;  2JIP A;  1K83 I;  1K9M 2;  3TDH B;  2QLV B;  1Z03 A;  2V8I A;  2HF1 A;  3GTK I;  3MZL B;  3Q87 A;  1VQN 1;  2GTI A;  1VQ4 Z;  3KIH A;  1TWA I;  5C44 I;  1Y1V S;  2BJO A;  2ZAE B;  3I56 1;  4BXX I;  3I07 A;  3CCR 1;  1LQL A;  4DK1 A;  1M1K 2;  1PFT A;  2JIO A;  2OOY B;  3D6W A;  5FLM I;  5IT9 b;  3GKQ A;  1RNI A;  5C3E I;  1VQ8 Z;  2R7Z I;  5D1O B;  3S2D I;  3HKZ A;  1VQN Z;  1QVG Y;  1QVF Y;  1KD1 2;  2M48 A;  3NFZ A;  2OTL 1;  5FLX b;  3NH4 A;  4NBG A;  1L1O C;  1K8A 2;  3TE5 B;  5T67 A;  4XX2 A;  2PK7 A;  2YU9 I;  3I56 Z;  3CC7 Z;  3BG1 B;  3KIF A;  3G6E 1;  1Q82 2;  4BY7 I;  2JA6 I;  1VQK 1;  1Q86 2;  1Q7Y 1;  4MD8 A;  3CPW Y;  2R92 I;  3GTM S;  1JWH C;  4A3I I;  1RO0 A;  2VPZ A;  3CXC Y;  4A3F I;  1YJW 1;  2V3V A;  3I55 1;  3NH5 A;  2E2I I;  5T6B A;  1QVG Z;  1QVF Z;  4EWC A;  2LFU A;  1JJ2 Y;  2OTL Z;  3CMA Z;  2JUB A;  3CCJ 1;  2NVX I;  3JAM f;  1VLA A;  2H85 A;  5A2Q f;  1YIT 1;  3CD6 1;  3G6E Z;  5CM2 M;  1I6H I;  4A3G I;  1ZB8 A;  1VQK Z;  3I4N I;  3J81 b;  3CPW Z;  1M90 1;  2R6M A;  2JS4 A;  1YJN Z;  1YJW Z;  3S1N I;  2VF1 A;  4NOZ A;  3J80 b;  2NAP A;  1YUK A;  3HOX I;  1JJ2 Z;  3LUS A;  3CCJ Z;  3U50 C;  2VPW A;  2OZK A;  3G4S Z;  4BY1 I;  1Z02 A;  2AKL A;  1K73 2;  1KRL A;  4S1T A;  4E2W A;  1TWC I;  2E2H I;  1KQS Y;  2OOX B;  1SFO I;  4HH4 A;  4E32 A;  4E2Z A;  3CCU Z;  1QXF A;  1I3Q I;  2RHB A;  3IFU A;  2LEX A;  2IZ3 A;  3ESW A;  3D2L A;  4RS4 A;  1VQ4 1;  3S2H I;  2F4O A;  2JA5 I;  2O4H A;  4AYB A;  3FKI I;  1SIW A;  2JIQ A;  4MD7 A;  1S72 1;  1Y8C A;  1NJI 2;  1X3W A;  1VQ9 1;  4E2X A;  1KQS Z;  1KD1 1;  3VB9 A;  1RO4 A;  1VQ8 1;  2GU2 A;  2J6A A;  2NVY I;  3HOV I;  3IF8 A;  3CC4 Z;  2QRE B;  2WB1 A;  5D1P A;  3FQM A;  2JMO A;  1Q82 1;  1S72 Z;  1KC8 1;  2W03 A;  3OW2 Y;  3CC7 1;  2NVQ I;  2KPI A;  1VQ9 Z;  1P9N A;  2AYD A;  3G71 Z;  3T4N B;  2JA8 I;  3CCS Z;  4BBS I;  4MRI A;  2VUG A;  2DE5 A;  2P28 A;  1WW9 A;  2E7Z A;  4QTT A;  3CMA 1;  3VMI A;  1ZH1 A;  3MZK B;  3NDI A;  2QRD B;  3M3Y I;  1YUA A;  4E30 A;  3OW2 Z;  2RT9 A;  4NBA A;  4A3B I;  2DE6 A;  1FDO A;  1N8R 1;  3HOU I;  3VMH A;  1YJN 1;  4A3D I;  4NH1 C;  1Q81 2;  1K73 1;  1RO2 A;  2QKD A;  5D1O A;  4RVD A;  3S16 I;  1X0T A;  3IX0 A;  3GTP I;  1YJ9 1;  2WAQ A;  3G4S 1;  1ZB9 A;  5T64 A;  1VQO 1;  2Y0S A;  1VQ7 1;  2VPX A;  3CCU 1;  2Q4Z A;  2OTJ Z;  3CQZ I;  2RBL A;  3CXC Z;  2V8K A;  4RVH A;  4HGY A;  4E33 A;  3S1Q I;  1NJI 1;  5IT9 f;  2HU9 A;  1S7M A;  1YIJ 1;  1I50 I;  2QR1 B;  3NH8 A;  1ML8 A;  1K9M 1;  1YJ9 Z;  3H0G I;  4TNU A;  4A3J I;  5FLX f;  1VQO Z;  3K7A I;  3J7A 4;  1VQ7 Z;  3GTG I;  1QF8 A;  3S17 I;  1NP6 A;  3D9X A;  4RVG A;  2EGT A;  1Q7Y 2;  2M6N A;  1NUI A;  3CC4 1;  1Q16 A;  2JR6 A;  1Y1W I;  4NBC A;  1M1K 1;  1YIJ Z;  2YAD A;  1X3Z A;  3GTL I;  2JIR A;  1Z01 A;  4BBR I;  4A3L I;  3MON A;  3H3V J;  3I4M I;  1YHQ 1;  1WII A;  2NVT I;  4QTU A;  3G71 1;  1WZN A;  2QRC B;  1VQ5 1;  3VTN A;  5C4X I;  1TWH I;  4RV9 A;  1R9T I;  2V45 A;  3CCM 1;  2VPY A;  3CCS 1;  1K8A 1;  2B63 I;  3QWU A;  1M90 2;  1VQM Z;  1FDI A;  3GTM I;  3CC2 Z;  2RIQ A;  1RLY A;  3EED A;  2IV2 X;  4CL1 A;  4E31 A;  2I3C A;  3J81 f;  3CCL 1;  2K5R A;  3PO3 I;  1Q86 1;  3HOW I;  1AA6 A;  4A3C I;  1RQF A;  1YHQ Z;  4NBD A;  1Q81 1;  3GCF A;  1VQ5 Z;  2VUM I;  4MH4 A;  3JAM b;  2E9H A;  3CCM Z;  4NBE A;  5A2Q b;  5AN9 F;  1WCM I;  2DE7 A;  4MON A;  2E2J I;  2P3Y A;  3CCL Z;  4NBB A;  1TWG I;  4A3M I;  3S15 I;  3HOZ I;  2R93 I;  2QEX 1;  1VQL 1;  2QA4 1;  2KI7 B;  2OTJ 1;  1VQP 1;  2K3R A;  2JNY A;  3S1M I;  3BG0 B;  4A3K I;  2Q51 A;  4RVF A;  3CCR Z;  3CME 1;  2V8J A;  3FQQ A;  3GTO I;  2PMZ A;  2QEX Z;  1N2F A;  1VQL Z;  1KC8 2;  2QA4 Z;  1VQ6 1;  4Y7N I;  4DGL A;  4NBH A;  4MXU A;  3PO3 S;  1VQP Z;  5LL6 f;  1YI2 1;  3HOY I;  3CCV 1;  1USP B;  2JA7 I;  5C4J I;  4A3E I;  3NDJ A;  1QYP A;  5IP9 I;  1TFI A;  3CME Z;  3CCE 1;  4A93 I;  2GTH A;  1Y1V I;  3S14 I;  3RZD I;  1W2B Y;  1VQ6 Z;  3M4O I;  3EER A;  1WJ2 A;  2LIY A;  3I55 Z;  2PM9 A;  1N8R 2;  1TWF I;  2F4M A;  1DL6 A;  1YI2 Z;  2IZ4 A;  1VQM 1;  3CCV Z;  3CC2 1;  4E2Y A;  3CCQ 1;  4MD9 A;  2G2K A;  1USP A;  2O53 A;  4NBF A;  1YIT Z;  3CCE Z;  3P5J B;  3CD6 Z;  4X6A I;  3F3P C;  3PO2 I;  1W2B Z;  4HGZ A;  4NB8 A;  3IR7 A;  2RPR A;  2JIM A;  3VMG A; 
#chains in the Genus database with same CATH homology
 3RZO I;  2W04 A;  4NB9 A;  3GTQ I;  3CCQ Z;  5IP7 I;  4Y52 I;  3F3F C;  4NFR A;  3S1R I;  4DQY B;  3GTJ I;  3J80 f;  1K83 I;  1K9M 2;  3TDH B;  2QLV B;  1Z03 A;  2V8I A;  2HF1 A;  3GTK I;  3MZL B;  3Q87 A;  1VQN 1;  2GTI A;  1VQ4 Z;  3KIH A;  1TWA I;  5C44 I;  1Y1V S;  2BJO A;  2ZAE B;  3I56 1;  4BXX I;  3I07 A;  3CCR 1;  1LQL A;  4DK1 A;  1M1K 2;  1PFT A;  2OOY B;  3D6W A;  5FLM I;  5IT9 b;  3GKQ A;  1RNI A;  5C3E I;  1VQ8 Z;  2R7Z I;  5D1O B;  3S2D I;  3HKZ A;  1VQN Z;  1QVG Y;  1QVF Y;  1KD1 2;  2M48 A;  3NFZ A;  2OTL 1;  5FLX b;  3NH4 A;  4NBG A;  1L1O C;  1K8A 2;  3TE5 B;  5T67 A;  4XX2 A;  2PK7 A;  2YU9 I;  3I56 Z;  3CC7 Z;  3BG1 B;  3KIF A;  3G6E 1;  1Q82 2;  4BY7 I;  2JA6 I;  1VQK 1;  1Q86 2;  1Q7Y 1;  4MD8 A;  3CPW Y;  2R92 I;  3GTM S;  1JWH C;  4A3I I;  1RO0 A;  3CXC Y;  4A3F I;  1YJW 1;  3I55 1;  3NH5 A;  2E2I I;  5T6B A;  1QVG Z;  1QVF Z;  4EWC A;  2LFU A;  1JJ2 Y;  2OTL Z;  3CMA Z;  2JUB A;  3CCJ 1;  2NVX I;  3JAM f;  1VLA A;  2H85 A;  5A2Q f;  1YIT 1;  3CD6 1;  3G6E Z;  5CM2 M;  1I6H I;  4A3G I;  1ZB8 A;  1VQK Z;  3I4N I;  3J81 b;  3CPW Z;  1M90 1;  2R6M A;  2JS4 A;  1YJN Z;  1YJW Z;  3S1N I;  2VF1 A;  4NOZ A;  3J80 b;  1YUK A;  3HOX I;  1JJ2 Z;  3LUS A;  3CCJ Z;  3U50 C;  2OZK A;  3G4S Z;  4BY1 I;  1Z02 A;  2AKL A;  1K73 2;  1KRL A;  4S1T A;  4E2W A;  1TWC I;  2E2H I;  1KQS Y;  2OOX B;  1SFO I;  4HH4 A;  4E32 A;  4E2Z A;  3CCU Z;  1I3Q I;  2RHB A;  3IFU A;  2IZ3 A;  3ESW A;  4RS4 A;  1VQ4 1;  3S2H I;  2F4O A;  2JA5 I;  2O4H A;  4AYB A;  3FKI I;  4MD7 A;  1S72 1;  1NJI 2;  1X3W A;  1VQ9 1;  4E2X A;  1KQS Z;  1KD1 1;  3VB9 A;  1RO4 A;  1VQ8 1;  2GU2 A;  2J6A A;  2NVY I;  3HOV I;  3IF8 A;  3CC4 Z;  2QRE B;  2WB1 A;  5D1P A;  3FQM A;  2JMO A;  1Q82 1;  1S72 Z;  1KC8 1;  2W03 A;  3OW2 Y;  3CC7 1;  2NVQ I;  2KPI A;  1VQ9 Z;  1P9N A;  3G71 Z;  3T4N B;  2JA8 I;  3CCS Z;  4BBS I;  4MRI A;  2VUG A;  2DE5 A;  2P28 A;  1WW9 A;  4QTT A;  3CMA 1;  3VMI A;  1ZH1 A;  3MZK B;  3NDI A;  2QRD B;  3M3Y I;  1YUA A;  4E30 A;  3OW2 Z;  2RT9 A;  4NBA A;  4A3B I;  2DE6 A;  1N8R 1;  3HOU I;  3VMH A;  1YJN 1;  4A3D I;  4NH1 C;  1Q81 2;  1K73 1;  1RO2 A;  2QKD A;  5D1O A;  4RVD A;  3S16 I;  1X0T A;  3IX0 A;  3GTP I;  1YJ9 1;  2WAQ A;  3G4S 1;  1ZB9 A;  5T64 A;  1VQO 1;  2Y0S A;  1VQ7 1;  3CCU 1;  2Q4Z A;  2OTJ Z;  3CQZ I;  2RBL A;  3CXC Z;  2V8K A;  4RVH A;  4HGY A;  4E33 A;  3S1Q I;  1NJI 1;  5IT9 f;  2HU9 A;  1S7M A;  1YIJ 1;  1I50 I;  2QR1 B;  3NH8 A;  1ML8 A;  1K9M 1;  1YJ9 Z;  3H0G I;  4TNU A;  4A3J I;  5FLX f;  1VQO Z;  3K7A I;  3J7A 4;  1VQ7 Z;  3GTG I;  1QF8 A;  3S17 I;  1NP6 A;  3D9X A;  4RVG A;  2EGT A;  1Q7Y 2;  2M6N A;  1NUI A;  3CC4 1;  2JR6 A;  1Y1W I;  4NBC A;  1M1K 1;  1YIJ Z;  2YAD A;  1X3Z A;  3GTL I;  1Z01 A;  4BBR I;  4A3L I;  3MON A;  3H3V J;  3I4M I;  1YHQ 1;  1WII A;  2NVT I;  4QTU A;  3G71 1;  2QRC B;  1VQ5 1;  3VTN A;  5C4X I;  1TWH I;  4RV9 A;  1R9T I;  3CCM 1;  3CCS 1;  1K8A 1;  2B63 I;  3QWU A;  1M90 2;  1VQM Z;  3GTM I;  3CC2 Z;  2RIQ A;  1RLY A;  3EED A;  4CL1 A;  3J81 f;  4E31 A;  2I3C A;  3CCL 1;  2K5R A;  3PO3 I;  1Q86 1;  3HOW I;  4A3C I;  1RQF A;  1YHQ Z;  4NBD A;  1Q81 1;  3GCF A;  1VQ5 Z;  2VUM I;  4MH4 A;  3JAM b;  2E9H A;  3CCM Z;  4NBE A;  5A2Q b;  5AN9 F;  1WCM I;  2DE7 A;  4MON A;  2E2J I;  2P3Y A;  3CCL Z;  4NBB A;  1TWG I;  4A3M I;  3S15 I;  3HOZ I;  2R93 I;  2QEX 1;  1VQL 1;  2QA4 1;  2KI7 B;  2OTJ 1;  1VQP 1;  2K3R A;  2JNY A;  3S1M I;  3BG0 B;  4A3K I;  2Q51 A;  4RVF A;  3CCR Z;  3CME 1;  2V8J A;  3FQQ A;  3GTO I;  2PMZ A;  2QEX Z;  1N2F A;  1VQL Z;  1KC8 2;  2QA4 Z;  1VQ6 1;  4Y7N I;  4DGL A;  4NBH A;  4MXU A;  3PO3 S;  1VQP Z;  5LL6 f;  1YI2 1;  3HOY I;  3CCV 1;  1USP B;  2JA7 I;  5C4J I;  4A3E I;  3NDJ A;  1QYP A;  5IP9 I;  1TFI A;  3CME Z;  3CCE 1;  4A93 I;  2GTH A;  1Y1V I;  3S14 I;  3RZD I;  1W2B Y;  1VQ6 Z;  3M4O I;  3EER A;  2LIY A;  3I55 Z;  2PM9 A;  1N8R 2;  1TWF I;  2F4M A;  1DL6 A;  1YI2 Z;  2IZ4 A;  1VQM 1;  3CCV Z;  3CC2 1;  4E2Y A;  3CCQ 1;  4MD9 A;  2G2K A;  1USP A;  2O53 A;  4NBF A;  1YIT Z;  3CCE Z;  3P5J B;  3CD6 Z;  4X6A I;  3F3P C;  3PO2 I;  1W2B Z;  4HGZ A;  4NB8 A;  2RPR A;  3VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...