4A3DI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI02
1VLAA 1DL6A 4MH4A 1WCMI 4NBAA 3GTLI 3H0GI 1USPB 3GTGI 4XX2A 1YUAA 3S14I 4NBBA 1SFOI 2HF1A 3GTQI 3S15I 3S1RI 3M4OI 1TWAI 3HOZI 2NVTI 3I07A 4Y7NI 2VUMI 3RZOI 2YU9I 3S2DI 1PFTA 1X3WA 4X6AI 2K5RA 5C44I 3VMGA 5C4JI 3I4NI 2R92I 3GTPI 3S1QI 4A3JI 5FLMI 2DE5A 3HOXI 3PO3S 1L1OC 3ESWA 3PO2I 4NBFA 1QYPA 1Y1VI 3S17I 4BY1I 5C4XI 4NBGA 3S1NI 4A3LI 3VB9A 3VMIA 2RBLA 3H3VJ 1Y1WI 1ZB8A 2NVQI 3S1MI 3M3YI 1ZB9A 4A3EI 4BBSI 3HOYI 3I4MI 3GTMI 4A3GI 4A3DI 3LUSA 2KPIA 3VMHA 3GCFA 1N2FA 3GKQA 3K7AI 2E2JI 2AKLA 3S16I 2R7ZI 2JA5I 1RO4A 5C3EI 1R9TI 1NUIA 1RLYA 4A3KI 4NBCA 4NB9A 1K83I 2DE6A 5CM2M 2JA6I 3HOUI 4NBDA 1USPA 1LQLA 1X3ZA 2JR6A 4BBRI 2P3YA 2F4OA 4A3CI 3GTOI 3CQZI 1Y1VS 3GTJI 4NOZA 1TFIA 1I3QI 1WW9A 3Q87A 3RZDI 4NB8A 4QTTA 2E2HI 3GTKI 4BXXI 3HOVI 4A3II 1I6HI 1TWCI 3FKII 3S2HI 2BJOA 1I50I 3D6WA 3GTMS 2E2II 4BY7I 1ML8A 5IP7I 2NVXI 1TWFI 2DE7A 5IP9I 4A93I 2JA7I 2B63I 2F4MA 4Y52I 4QTUA 3PO3I 2NVYI 4NBHA 1TWHI 4A3BI 4A3MI 4NBEA 3EERA 2J6AA 2PK7A 2JA8I 4A3FI 2R93I 3HOWI 2JNYA 2JS4A 3U50C 1TWGI
chains in the Genus database with same CATH superfamily
2VPWA 1S7MA 1VLAA 2E7ZA 1VQ41 3S14I 2QRCB 4RVFA 3GTQI 1VQ71 4E2WA 1M1K1 1VQ6Z 5T67A 2JIPA 2JIOA 1K9M1 1PFTA 3VMGA 3CXCZ 1VQPZ 1Q822 3GTPI 3CCMZ 2DE5A 1YHQ1 3PO2I 5T6BA 1YJN1 1QVGY 3S17I 4BY1I 2QA4Z 3VB9A 3VMIA 3CCSZ 1Q861 4MXUA 1RNIA 2NVQI 2IV2X 1NJI2 4A3EI 3CCV1 3HOYI 3CPWY 4A3GI 1YI21 2M6NA 4A3DI 3LUSA 3CC41 4MRIA 1VQ91 3IR7A 2KPIA 2O4HA 2IZ4A 3GCFA 1N2FA 1QF8A 1YJ9Z 3S16I 1RO4A 1KD12 4MONA 1RLYA 1RO0A 4NBCA 3CME1 1JJ2Y 1FDOA 4NB9A 4E2ZA 3CCJ1 1K83I 5CM2M 2QEX1 1VQO1 1USPA 1SIWA 1RQFA 3CCUZ 2V8IA 2P3YA 3G4SZ 2F4OA 3J81f 1I3QI 4DQYB 4MD8A 2M48A 3BG0B 3KIFA 4A3II 1AA6A 1YJW1 3FKII 2YADA 2RHBA 1KQSY 2PM9A 1K9M2 2H85A 5IT9f 1KC81 3TE5B 1VQ51 4NBHA 3J80f 1TWHI 2LFUA 1K8A2 3FQMA 3CCQ1 3EEDA 4MD9A 2JA8I 3HOWI 3G6E1 1N8R1 1ZH1A 2ZAEB 1WCMI 2R6MA 3D2LA 4S1TA 4NBAA 3CCLZ 2OTJ1 2VF1A 1YIJZ 3I561 1YUAA 3CC21 1SFOI 1QVGZ 4E2YA 2HF1A 3M4OI 2E9HA 4RVGA 3HOZI 3I07A 1VQM1 2YU9I 1FDIA 2VPYA 5C4JI 3CPWZ 3S1QI 4A3JI 3MZLB 5FLMI 2KI7B 1Z03A 5A2Qf 3CMA1 1Y1VI 4A3LI 5C4XI 3P5JB 4NBGA 1VQL1 2OTL1 4DGLA 1W2BY 3S1MI 2EGTA 1JJ2Z 1YHQZ 5D1OB 4BBSI 1VQN1 1YJNZ 4E33A 1Q7Y2 2E2JI 2HU9A 4RS4A 3CCR1 5C3EI 2P28A 3NH5A 1YUKA 1YI2Z 3CC4Z 3JAMf 1VQ9Z 1KQSZ 4NBDA 3BG1B 1LQLA 3NFZA 3CCEZ 1N8R2 3CQZI 3G711 5IT9b 4NOZA 1WW9A 2QR1B 3RZDI 1JWHC 4QTTA 3TDHB 3CMEZ 3GTKI 3CCJZ 2QEXZ 1VQOZ 2OOXB 4HH4A 1TWCI 3S2HI 1QVFY 2BJOA 3GTMS 4E31A 2E2II 1VQP1 1Q16A 4A93I 2JA7I 1K731 2B63I 1YJWZ 3NH8A 1VQ81 2VPZA 3MONA 4RV9A 2GU2A 4A3MI 3EERA 2JIRA 4A3FI 2R93I 1WJ2A 5FLXb 4E30A 2GTIA 1YIT1 1TWGI 1RO2A 4MH4A 3J7A4 1VQ5Z 5AN9F 1M1K2 2QRDB 1USPB 3GTGI 4XX2A 3CCQZ 4NH1C 2Y0SA 2WAQA 4EWCA 3HKZA 3G6EZ 2LEXA 3S1RI 3S15I 5A2Qb 2V45A 2NVTI 1W2BZ 3S2DI 1X0TA 3KIHA 1Z02A 2OTJZ 4X6AI 3I56Z 3I55Z 3CC2Z 3I4NI 2LIYA 2R92I 1Q862 3PO3S 1VQMZ 1QYPA 1S72Z 1Q821 3F3FC 3FQQA 4RVDA 2RBLA 3H3VJ 1Y1WI 1ZB8A 3M3YI 1P9NA 3OW2Y 3F3PC 1VQK1 3CMAZ 4NFRA 1VQLZ 2OTLZ 3VMHA 1VQ4Z 3NDJA 3GKQA 3K7AI 3CD61 2AKLA 3CC71 1VQ7Z 3IFUA 1VQNZ 1NUIA 1QVFZ 2W04A 2OZKA 2JA6I 3HOUI 4AYBA 2JR6A 1M901 4A3CI 3CCRZ 4E2XA 2PMZA 3HOVI 3NH4A 3IX0A 1KC82 1Q811 1I6HI 3IF8A 4HGYA 3NDIA 3D6WA 3CCVZ 3J81b 3G71Z 5T64A 1ML8A 5IP7I 2W03A 1TWFI 2DE7A 2NVYI 2WB1A 1NP6A 2O53A 4HGZA 4A3BI 3U50C 1VQ61 1K8A1 1DL6A 1VQ8Z 3J80b 4MD7A 3H0GI 3GTLI 2I3CA 4NBBA 4RVHA 3CCM1 1TWAI 1Y8CA 1YITZ 4Y7NI 2VUMI 3RZOI 4E32A 2VPXA 2QA41 1X3WA 3OW2Z 2K5RA 5C44I 2IZ3A 2QKDA 3QWUA 3CCS1 2QREB 1WIIA 2V8JA 3HOXI 3CCE1 1L1OC 3ESWA 4NBFA 2GTHA 1M902 3S1NI 2VUGA 1YJ91 2JIQA 1ZB9A 2V3VA 2QLVB 1Q812 3I4MI 3CXCY 2AYDA 3GTMI 1Z01A 1WZNA 2K3RA 4CL1A 2NAPA 2JMOA 3CCU1 2R7ZI 2JA5I 3G4S1 1VQKZ 1R9TI 2Q51A 2JIMA 1Q7Y1 4A3KI 2DE6A 2JUBA 1X3ZA 4BBRI 3CD6Z 5D1PA 3CC7Z 3T4NB 2RPRA 3GTOI 3VTNA 1Y1VS 3GTJI 1TFIA 3Q87A 3JAMb 4NB8A 2E2HI 4BXXI 2RT9A 1NJI1 1KRLA 5LL6f 1I50I 1QXFA 4TNUA 1K732 2V8KA 4BY7I 3I551 2NVXI 5IP9I 5FLXf 2F4MA 4Y52I 1KD11 4QTUA 3PO3I 3CCL1 1S721 2RIQA 4NBEA 1YIJ1 2J6AA 3D9XA 2PK7A 3MZKB 4DK1A 2Q4ZA 5D1OA 2G2KA 2OOYB 2JNYA 2JS4A
chains in the Genus database with same CATH topology
1S7MA 1VLAA 1VQ41 3S14I 2QRCB 4RVFA 3GTQI 1VQ71 4E2WA 1M1K1 1VQ6Z 5T67A 1K9M1 1PFTA 3VMGA 3CXCZ 1VQPZ 1Q822 3GTPI 3CCMZ 2DE5A 1YHQ1 3PO2I 5T6BA 1YJN1 1QVGY 3S17I 4BY1I 2QA4Z 3VB9A 3VMIA 3CCSZ 1Q861 4MXUA 1RNIA 2NVQI 1NJI2 4A3EI 3CCV1 3HOYI 3CPWY 4A3GI 1YI21 2M6NA 4A3DI 3LUSA 3CC41 4MRIA 1VQ91 2KPIA 2O4HA 2IZ4A 3GCFA 1N2FA 1QF8A 1YJ9Z 3S16I 1RO4A 1KD12 4MONA 1RLYA 1RO0A 4NBCA 3CME1 1JJ2Y 4NB9A 4E2ZA 3CCJ1 1K83I 5CM2M 2QEX1 1VQO1 1USPA 1RQFA 3CCUZ 2V8IA 2P3YA 3G4SZ 2F4OA 3J81f 1I3QI 4DQYB 4MD8A 2M48A 3BG0B 3KIFA 4A3II 1YJW1 3FKII 2YADA 2RHBA 1KQSY 2PM9A 1K9M2 2H85A 5IT9f 1KC81 3TE5B 1VQ51 4NBHA 1TWHI 3J80f 2LFUA 1K8A2 3FQMA 3CCQ1 3EEDA 4MD9A 2JA8I 3HOWI 3G6E1 1N8R1 1ZH1A 2ZAEB 1WCMI 2R6MA 4S1TA 4NBAA 3CCLZ 2OTJ1 2VF1A 1YIJZ 3I561 1YUAA 3CC21 1SFOI 1QVGZ 4E2YA 2HF1A 3M4OI 2E9HA 4RVGA 3HOZI 3I07A 1VQM1 2YU9I 5C4JI 3CPWZ 3S1QI 4A3JI 3MZLB 5FLMI 2KI7B 1Z03A 5A2Qf 3CMA1 1Y1VI 4A3LI 5C4XI 3P5JB 4NBGA 1VQL1 2OTL1 4DGLA 1W2BY 3S1MI 2EGTA 1JJ2Z 1YHQZ 5D1OB 4BBSI 1VQN1 1YJNZ 4E33A 1Q7Y2 2E2JI 2HU9A 4RS4A 3CCR1 5C3EI 2P28A 3NH5A 1YUKA 1YI2Z 3CC4Z 3JAMf 1VQ9Z 1KQSZ 4NBDA 3BG1B 1LQLA 3NFZA 3CCEZ 1N8R2 3CQZI 3G711 5IT9b 4NOZA 1WW9A 3RZDI 2QR1B 1JWHC 4QTTA 3TDHB 3CMEZ 3GTKI 3CCJZ 2QEXZ 1VQOZ 2OOXB 4HH4A 1TWCI 3S2HI 1QVFY 2BJOA 3GTMS 4E31A 2E2II 1VQP1 4A93I 2JA7I 1K731 2B63I 1YJWZ 3NH8A 1VQ81 3MONA 4RV9A 2GU2A 4A3MI 3EERA 4A3FI 2R93I 5FLXb 2GTIA 4E30A 1YIT1 1TWGI 1RO2A 4MH4A 3J7A4 1VQ5Z 5AN9F 1M1K2 2QRDB 1USPB 3GTGI 4XX2A 3CCQZ 4NH1C 2Y0SA 2WAQA 4EWCA 3HKZA 3G6EZ 3S15I 3S1RI 5A2Qb 2NVTI 1W2BZ 3S2DI 1X0TA 3KIHA 1Z02A 2OTJZ 4X6AI 3I56Z 3I55Z 3CC2Z 3I4NI 2LIYA 2R92I 1Q862 3PO3S 1VQMZ 1QYPA 1S72Z 1Q821 3F3FC 3FQQA 4RVDA 2RBLA 3H3VJ 1Y1WI 1ZB8A 3M3YI 1P9NA 3OW2Y 3F3PC 1VQK1 3CMAZ 4NFRA 1VQLZ 2OTLZ 3VMHA 1VQ4Z 3NDJA 3GKQA 3K7AI 3CD61 2AKLA 3CC71 1VQ7Z 3IFUA 1VQNZ 1NUIA 1QVFZ 2W04A 2OZKA 2JA6I 3HOUI 4AYBA 2JR6A 1M901 4A3CI 3CCRZ 4E2XA 2PMZA 3HOVI 3NH4A 3IX0A 1KC82 1Q811 1I6HI 3IF8A 4HGYA 3NDIA 3D6WA 3CCVZ 3J81b 3G71Z 5T64A 1ML8A 5IP7I 2W03A 1TWFI 2DE7A 2NVYI 2WB1A 1NP6A 2O53A 4HGZA 4A3BI 3U50C 1VQ61 1K8A1 1DL6A 1VQ8Z 3J80b 4MD7A 3H0GI 3GTLI 2I3CA 4NBBA 4RVHA 3CCM1 1TWAI 1YITZ 4Y7NI 2VUMI 3RZOI 4E32A 2QA41 1X3WA 3OW2Z 2K5RA 5C44I 2IZ3A 2QKDA 3QWUA 3CCS1 2QREB 1WIIA 2V8JA 3HOXI 3CCE1 1L1OC 3ESWA 4NBFA 2GTHA 1M902 3S1NI 2VUGA 1YJ91 1ZB9A 2QLVB 1Q812 3I4MI 3CXCY 3GTMI 1Z01A 2K3RA 4CL1A 2JMOA 3CCU1 2R7ZI 2JA5I 3G4S1 1VQKZ 1R9TI 2Q51A 1Q7Y1 4A3KI 2DE6A 2JUBA 1X3ZA 4BBRI 3CD6Z 5D1PA 3CC7Z 3T4NB 2RPRA 3GTOI 3VTNA 1Y1VS 3GTJI 1TFIA 3Q87A 3JAMb 4NB8A 2E2HI 4BXXI 2RT9A 1NJI1 1KRLA 5LL6f 1I50I 4TNUA 1K732 2V8KA 4BY7I 3I551 2NVXI 5IP9I 5FLXf 2F4MA 4Y52I 1KD11 4QTUA 3PO3I 3CCL1 1S721 2RIQA 4NBEA 1YIJ1 2J6AA 3D9XA 2PK7A 3MZKB 4DK1A 2Q4ZA 5D1OA 2G2KA 2OOYB 2JNYA 2JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  1DL6 A;  4MH4 A;  1WCM I;  4NBA A;  3GTL I;  3H0G I;  1USP B;  3GTG I;  4XX2 A;  1YUA A;  3S14 I;  4NBB A;  1SFO I;  2HF1 A;  3GTQ I;  3S15 I;  3S1R I;  3M4O I;  1TWA I;  3HOZ I;  2NVT I;  3I07 A;  4Y7N I;  2VUM I;  3RZO I;  2YU9 I;  3S2D I;  1PFT A;  1X3W A;  4X6A I;  2K5R A;  5C44 I;  3VMG A;  5C4J I;  3I4N I;  2R92 I;  3GTP I;  3S1Q I;  4A3J I;  5FLM I;  2DE5 A;  3HOX I;  3PO3 S;  1L1O C;  3ESW A;  3PO2 I;  4NBF A;  1QYP A;  1Y1V I;  3S17 I;  4BY1 I;  5C4X I;  4NBG A;  3S1N I;  4A3L I;  3VB9 A;  3VMI A;  2RBL A;  3H3V J;  1Y1W I;  1ZB8 A;  2NVQ I;  3S1M I;  3M3Y I;  1ZB9 A;  4A3E I;  4BBS I;  3HOY I;  3I4M I;  3GTM I;  4A3G I;  4A3D I;  3LUS A;  2KPI A;  3VMH A;  3GCF A;  1N2F A;  3GKQ A;  3K7A I;  2E2J I;  2AKL A;  3S16 I;  2R7Z I;  2JA5 I;  1RO4 A;  5C3E I;  1R9T I;  1NUI A;  1RLY A;  4A3K I;  4NBC A;  4NB9 A;  1K83 I;  2DE6 A;  5CM2 M;  2JA6 I;  3HOU I;  4NBD A;  1USP A;  1LQL A;  1X3Z A;  2JR6 A;  4BBR I;  2P3Y A;  2F4O A;  4A3C I;  3GTO I;  3CQZ I;  1Y1V S;  3GTJ I;  4NOZ A;  1TFI A;  1I3Q I;  1WW9 A;  3Q87 A;  3RZD I;  4NB8 A;  4QTT A;  2E2H I;  3GTK I;  4BXX I;  3HOV I;  4A3I I;  1I6H I;  1TWC I;  3FKI I;  3S2H I;  2BJO A;  1I50 I;  3D6W A;  3GTM S;  2E2I I;  4BY7 I;  1ML8 A;  5IP7 I;  2NVX I;  1TWF I;  2DE7 A;  5IP9 I;  4A93 I;  2JA7 I;  2B63 I;  2F4M A;  4Y52 I;  4QTU A;  3PO3 I;  2NVY I;  4NBH A;  1TWH I;  4A3B I;  4A3M I;  4NBE A;  3EER A;  2J6A A;  2PK7 A;  2JA8 I;  4A3F I;  2R93 I;  3HOW I;  2JNY A;  2JS4 A;  3U50 C;  1TWG I; 
#chains in the Genus database with same CATH topology
 2VPW A;  1S7M A;  1VLA A;  2E7Z A;  1VQ4 1;  3S14 I;  2QRC B;  4RVF A;  3GTQ I;  1VQ7 1;  4E2W A;  1M1K 1;  1VQ6 Z;  5T67 A;  2JIP A;  2JIO A;  1K9M 1;  1PFT A;  3VMG A;  3CXC Z;  1VQP Z;  1Q82 2;  3GTP I;  3CCM Z;  2DE5 A;  1YHQ 1;  3PO2 I;  5T6B A;  1YJN 1;  1QVG Y;  3S17 I;  4BY1 I;  2QA4 Z;  3VB9 A;  3VMI A;  3CCS Z;  1Q86 1;  4MXU A;  1RNI A;  2NVQ I;  2IV2 X;  1NJI 2;  4A3E I;  3CCV 1;  3HOY I;  3CPW Y;  4A3G I;  1YI2 1;  2M6N A;  4A3D I;  3LUS A;  3CC4 1;  4MRI A;  1VQ9 1;  3IR7 A;  2KPI A;  2O4H A;  2IZ4 A;  3GCF A;  1N2F A;  1QF8 A;  1YJ9 Z;  3S16 I;  1RO4 A;  1KD1 2;  4MON A;  1RLY A;  1RO0 A;  4NBC A;  3CME 1;  1JJ2 Y;  1FDO A;  4NB9 A;  4E2Z A;  3CCJ 1;  1K83 I;  5CM2 M;  2QEX 1;  1VQO 1;  1USP A;  1SIW A;  1RQF A;  3CCU Z;  2V8I A;  2P3Y A;  3G4S Z;  2F4O A;  3J81 f;  1I3Q I;  4DQY B;  4MD8 A;  2M48 A;  3BG0 B;  3KIF A;  4A3I I;  1AA6 A;  1YJW 1;  3FKI I;  2YAD A;  2RHB A;  1KQS Y;  2PM9 A;  1K9M 2;  2H85 A;  5IT9 f;  1KC8 1;  3TE5 B;  1VQ5 1;  4NBH A;  3J80 f;  1TWH I;  2LFU A;  1K8A 2;  3FQM A;  3CCQ 1;  3EED A;  4MD9 A;  2JA8 I;  3HOW I;  3G6E 1;  1N8R 1;  1ZH1 A;  2ZAE B;  1WCM I;  2R6M A;  3D2L A;  4S1T A;  4NBA A;  3CCL Z;  2OTJ 1;  2VF1 A;  1YIJ Z;  3I56 1;  1YUA A;  3CC2 1;  1SFO I;  1QVG Z;  4E2Y A;  2HF1 A;  3M4O I;  2E9H A;  4RVG A;  3HOZ I;  3I07 A;  1VQM 1;  2YU9 I;  1FDI A;  2VPY A;  5C4J I;  3CPW Z;  3S1Q I;  4A3J I;  3MZL B;  5FLM I;  2KI7 B;  1Z03 A;  5A2Q f;  3CMA 1;  1Y1V I;  4A3L I;  5C4X I;  3P5J B;  4NBG A;  1VQL 1;  2OTL 1;  4DGL A;  1W2B Y;  3S1M I;  2EGT A;  1JJ2 Z;  1YHQ Z;  5D1O B;  4BBS I;  1VQN 1;  1YJN Z;  4E33 A;  1Q7Y 2;  2E2J I;  2HU9 A;  4RS4 A;  3CCR 1;  5C3E I;  2P28 A;  3NH5 A;  1YUK A;  1YI2 Z;  3CC4 Z;  3JAM f;  1VQ9 Z;  1KQS Z;  4NBD A;  3BG1 B;  1LQL A;  3NFZ A;  3CCE Z;  1N8R 2;  3CQZ I;  3G71 1;  5IT9 b;  4NOZ A;  1WW9 A;  2QR1 B;  3RZD I;  1JWH C;  4QTT A;  3TDH B;  3CME Z;  3GTK I;  3CCJ Z;  2QEX Z;  1VQO Z;  2OOX B;  4HH4 A;  1TWC I;  3S2H I;  1QVF Y;  2BJO A;  3GTM S;  4E31 A;  2E2I I;  1VQP 1;  1Q16 A;  4A93 I;  2JA7 I;  1K73 1;  2B63 I;  1YJW Z;  3NH8 A;  1VQ8 1;  2VPZ A;  3MON A;  4RV9 A;  2GU2 A;  4A3M I;  3EER A;  2JIR A;  4A3F I;  2R93 I;  1WJ2 A;  5FLX b;  4E30 A;  2GTI A;  1YIT 1;  1TWG I;  1RO2 A;  4MH4 A;  3J7A 4;  1VQ5 Z;  5AN9 F;  1M1K 2;  2QRD B;  1USP B;  3GTG I;  4XX2 A;  3CCQ Z;  4NH1 C;  2Y0S A;  2WAQ A;  4EWC A;  3HKZ A;  3G6E Z;  2LEX A;  3S1R I;  3S15 I;  5A2Q b;  2V45 A;  2NVT I;  1W2B Z;  3S2D I;  1X0T A;  3KIH A;  1Z02 A;  2OTJ Z;  4X6A I;  3I56 Z;  3I55 Z;  3CC2 Z;  3I4N I;  2LIY A;  2R92 I;  1Q86 2;  3PO3 S;  1VQM Z;  1QYP A;  1S72 Z;  1Q82 1;  3F3F C;  3FQQ A;  4RVD A;  2RBL A;  3H3V J;  1Y1W I;  1ZB8 A;  3M3Y I;  1P9N A;  3OW2 Y;  3F3P C;  1VQK 1;  3CMA Z;  4NFR A;  1VQL Z;  2OTL Z;  3VMH A;  1VQ4 Z;  3NDJ A;  3GKQ A;  3K7A I;  3CD6 1;  2AKL A;  3CC7 1;  1VQ7 Z;  3IFU A;  1VQN Z;  1NUI A;  1QVF Z;  2W04 A;  2OZK A;  2JA6 I;  3HOU I;  4AYB A;  2JR6 A;  1M90 1;  4A3C I;  3CCR Z;  4E2X A;  2PMZ A;  3HOV I;  3NH4 A;  3IX0 A;  1KC8 2;  1Q81 1;  1I6H I;  3IF8 A;  4HGY A;  3NDI A;  3D6W A;  3CCV Z;  3J81 b;  3G71 Z;  5T64 A;  1ML8 A;  5IP7 I;  2W03 A;  1TWF I;  2DE7 A;  2NVY I;  2WB1 A;  1NP6 A;  2O53 A;  4HGZ A;  4A3B I;  3U50 C;  1VQ6 1;  1K8A 1;  1DL6 A;  1VQ8 Z;  3J80 b;  4MD7 A;  3H0G I;  3GTL I;  2I3C A;  4NBB A;  4RVH A;  3CCM 1;  1TWA I;  1Y8C A;  1YIT Z;  4Y7N I;  2VUM I;  3RZO I;  4E32 A;  2VPX A;  2QA4 1;  1X3W A;  3OW2 Z;  2K5R A;  5C44 I;  2IZ3 A;  2QKD A;  3QWU A;  3CCS 1;  2QRE B;  1WII A;  2V8J A;  3HOX I;  3CCE 1;  1L1O C;  3ESW A;  4NBF A;  2GTH A;  1M90 2;  3S1N I;  2VUG A;  1YJ9 1;  2JIQ A;  1ZB9 A;  2V3V A;  2QLV B;  1Q81 2;  3I4M I;  3CXC Y;  2AYD A;  3GTM I;  1Z01 A;  1WZN A;  2K3R A;  4CL1 A;  2NAP A;  2JMO A;  3CCU 1;  2R7Z I;  2JA5 I;  3G4S 1;  1VQK Z;  1R9T I;  2Q51 A;  2JIM A;  1Q7Y 1;  4A3K I;  2DE6 A;  2JUB A;  1X3Z A;  4BBR I;  3CD6 Z;  5D1P A;  3CC7 Z;  3T4N B;  2RPR A;  3GTO I;  3VTN A;  1Y1V S;  3GTJ I;  1TFI A;  3Q87 A;  3JAM b;  4NB8 A;  2E2H I;  4BXX I;  2RT9 A;  1NJI 1;  1KRL A;  5LL6 f;  1I50 I;  1QXF A;  4TNU A;  1K73 2;  2V8K A;  4BY7 I;  3I55 1;  2NVX I;  5IP9 I;  5FLX f;  2F4M A;  4Y52 I;  1KD1 1;  4QTU A;  3PO3 I;  3CCL 1;  1S72 1;  2RIQ A;  4NBE A;  1YIJ 1;  2J6A A;  3D9X A;  2PK7 A;  3MZK B;  4DK1 A;  2Q4Z A;  5D1O A;  2G2K A;  2OOY B;  2JNY A;  2JS4 A; 
#chains in the Genus database with same CATH homology
 1S7M A;  1VLA A;  1VQ4 1;  3S14 I;  2QRC B;  4RVF A;  3GTQ I;  1VQ7 1;  4E2W A;  1M1K 1;  1VQ6 Z;  5T67 A;  1K9M 1;  1PFT A;  3VMG A;  3CXC Z;  1VQP Z;  1Q82 2;  3GTP I;  3CCM Z;  2DE5 A;  1YHQ 1;  3PO2 I;  5T6B A;  1YJN 1;  1QVG Y;  3S17 I;  4BY1 I;  2QA4 Z;  3VB9 A;  3VMI A;  3CCS Z;  1Q86 1;  4MXU A;  1RNI A;  2NVQ I;  1NJI 2;  4A3E I;  3CCV 1;  3HOY I;  3CPW Y;  4A3G I;  1YI2 1;  2M6N A;  4A3D I;  3LUS A;  3CC4 1;  4MRI A;  1VQ9 1;  2KPI A;  2O4H A;  2IZ4 A;  3GCF A;  1N2F A;  1QF8 A;  1YJ9 Z;  3S16 I;  1RO4 A;  1KD1 2;  4MON A;  1RLY A;  1RO0 A;  4NBC A;  3CME 1;  1JJ2 Y;  4NB9 A;  4E2Z A;  3CCJ 1;  1K83 I;  5CM2 M;  2QEX 1;  1VQO 1;  1USP A;  1RQF A;  3CCU Z;  2V8I A;  2P3Y A;  3G4S Z;  2F4O A;  3J81 f;  1I3Q I;  4DQY B;  4MD8 A;  2M48 A;  3BG0 B;  3KIF A;  4A3I I;  1YJW 1;  3FKI I;  2YAD A;  2RHB A;  1KQS Y;  2PM9 A;  1K9M 2;  2H85 A;  5IT9 f;  1KC8 1;  3TE5 B;  1VQ5 1;  4NBH A;  1TWH I;  3J80 f;  2LFU A;  1K8A 2;  3FQM A;  3CCQ 1;  3EED A;  4MD9 A;  2JA8 I;  3HOW I;  3G6E 1;  1N8R 1;  1ZH1 A;  2ZAE B;  1WCM I;  2R6M A;  4S1T A;  4NBA A;  3CCL Z;  2OTJ 1;  2VF1 A;  1YIJ Z;  3I56 1;  1YUA A;  3CC2 1;  1SFO I;  1QVG Z;  4E2Y A;  2HF1 A;  3M4O I;  2E9H A;  4RVG A;  3HOZ I;  3I07 A;  1VQM 1;  2YU9 I;  5C4J I;  3CPW Z;  3S1Q I;  4A3J I;  3MZL B;  5FLM I;  2KI7 B;  1Z03 A;  5A2Q f;  3CMA 1;  1Y1V I;  4A3L I;  5C4X I;  3P5J B;  4NBG A;  1VQL 1;  2OTL 1;  4DGL A;  1W2B Y;  3S1M I;  2EGT A;  1JJ2 Z;  1YHQ Z;  5D1O B;  4BBS I;  1VQN 1;  1YJN Z;  4E33 A;  1Q7Y 2;  2E2J I;  2HU9 A;  4RS4 A;  3CCR 1;  5C3E I;  2P28 A;  3NH5 A;  1YUK A;  1YI2 Z;  3CC4 Z;  3JAM f;  1VQ9 Z;  1KQS Z;  4NBD A;  3BG1 B;  1LQL A;  3NFZ A;  3CCE Z;  1N8R 2;  3CQZ I;  3G71 1;  5IT9 b;  4NOZ A;  1WW9 A;  3RZD I;  2QR1 B;  1JWH C;  4QTT A;  3TDH B;  3CME Z;  3GTK I;  3CCJ Z;  2QEX Z;  1VQO Z;  2OOX B;  4HH4 A;  1TWC I;  3S2H I;  1QVF Y;  2BJO A;  3GTM S;  4E31 A;  2E2I I;  1VQP 1;  4A93 I;  2JA7 I;  1K73 1;  2B63 I;  1YJW Z;  3NH8 A;  1VQ8 1;  3MON A;  4RV9 A;  2GU2 A;  4A3M I;  3EER A;  4A3F I;  2R93 I;  5FLX b;  2GTI A;  4E30 A;  1YIT 1;  1TWG I;  1RO2 A;  4MH4 A;  3J7A 4;  1VQ5 Z;  5AN9 F;  1M1K 2;  2QRD B;  1USP B;  3GTG I;  4XX2 A;  3CCQ Z;  4NH1 C;  2Y0S A;  2WAQ A;  4EWC A;  3HKZ A;  3G6E Z;  3S15 I;  3S1R I;  5A2Q b;  2NVT I;  1W2B Z;  3S2D I;  1X0T A;  3KIH A;  1Z02 A;  2OTJ Z;  4X6A I;  3I56 Z;  3I55 Z;  3CC2 Z;  3I4N I;  2LIY A;  2R92 I;  1Q86 2;  3PO3 S;  1VQM Z;  1QYP A;  1S72 Z;  1Q82 1;  3F3F C;  3FQQ A;  4RVD A;  2RBL A;  3H3V J;  1Y1W I;  1ZB8 A;  3M3Y I;  1P9N A;  3OW2 Y;  3F3P C;  1VQK 1;  3CMA Z;  4NFR A;  1VQL Z;  2OTL Z;  3VMH A;  1VQ4 Z;  3NDJ A;  3GKQ A;  3K7A I;  3CD6 1;  2AKL A;  3CC7 1;  1VQ7 Z;  3IFU A;  1VQN Z;  1NUI A;  1QVF Z;  2W04 A;  2OZK A;  2JA6 I;  3HOU I;  4AYB A;  2JR6 A;  1M90 1;  4A3C I;  3CCR Z;  4E2X A;  2PMZ A;  3HOV I;  3NH4 A;  3IX0 A;  1KC8 2;  1Q81 1;  1I6H I;  3IF8 A;  4HGY A;  3NDI A;  3D6W A;  3CCV Z;  3J81 b;  3G71 Z;  5T64 A;  1ML8 A;  5IP7 I;  2W03 A;  1TWF I;  2DE7 A;  2NVY I;  2WB1 A;  1NP6 A;  2O53 A;  4HGZ A;  4A3B I;  3U50 C;  1VQ6 1;  1K8A 1;  1DL6 A;  1VQ8 Z;  3J80 b;  4MD7 A;  3H0G I;  3GTL I;  2I3C A;  4NBB A;  4RVH A;  3CCM 1;  1TWA I;  1YIT Z;  4Y7N I;  2VUM I;  3RZO I;  4E32 A;  2QA4 1;  1X3W A;  3OW2 Z;  2K5R A;  5C44 I;  2IZ3 A;  2QKD A;  3QWU A;  3CCS 1;  2QRE B;  1WII A;  2V8J A;  3HOX I;  3CCE 1;  1L1O C;  3ESW A;  4NBF A;  2GTH A;  1M90 2;  3S1N I;  2VUG A;  1YJ9 1;  1ZB9 A;  2QLV B;  1Q81 2;  3I4M I;  3CXC Y;  3GTM I;  1Z01 A;  2K3R A;  4CL1 A;  2JMO A;  3CCU 1;  2R7Z I;  2JA5 I;  3G4S 1;  1VQK Z;  1R9T I;  2Q51 A;  1Q7Y 1;  4A3K I;  2DE6 A;  2JUB A;  1X3Z A;  4BBR I;  3CD6 Z;  5D1P A;  3CC7 Z;  3T4N B;  2RPR A;  3GTO I;  3VTN A;  1Y1V S;  3GTJ I;  1TFI A;  3Q87 A;  3JAM b;  4NB8 A;  2E2H I;  4BXX I;  2RT9 A;  1NJI 1;  1KRL A;  5LL6 f;  1I50 I;  4TNU A;  1K73 2;  2V8K A;  4BY7 I;  3I55 1;  2NVX I;  5IP9 I;  5FLX f;  2F4M A;  4Y52 I;  1KD1 1;  4QTU A;  3PO3 I;  3CCL 1;  1S72 1;  2RIQ A;  4NBE A;  1YIJ 1;  2J6A A;  3D9X A;  2PK7 A;  3MZK B;  4DK1 A;  2Q4Z A;  5D1O A;  2G2K A;  2OOY B;  2JNY A;  2JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...