4A3DI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 20
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI02
4BY7I 2B63I 3GTOI 5C44I 4A3KI 2RBLA 3S2DI 2F4OA 3LUSA 4QTTA 3H0GI 3GTQI 4A3BI 3S1NI 4BY1I 2R93I 4A3EI 2E2II 3HOXI 3VB9A 2YU9I 3GKQA 4BBSI 2JA8I 1X3WA 1RO4A 3PO3I 5C4XI 1R9TI 3GTPI 4NBCA 5IP9I 3U50C 3S15I 2JNYA 1RLYA 3GTKI 4NB9A 2HF1A 3M4OI 4QTUA 2NVTI 1I6HI 1Y1WI 5FLMI 3HOZI 1WW9A 1LQLA 1TWAI 4NBBA 1N2FA 1DL6A 1USPA 2JA5I 2JS4A 2F4MA 4A3II 3GTLI 1ZB9A 3PO2I 3Q87A 3VMHA 3ESWA 4NBFA 4A3JI 3H3VJ 1TWCI 3RZOI 4NBAA 4BXXI 4Y7NI 1PFTA 3S16I 2VUMI 2PK7A 2AKLA 1WCMI 4XX2A 4BBRI 2NVXI 4NBDA 2J6AA 3M3YI 4X6AI 2E2JI 1Y1VI 3VMGA 3S1QI 2E2HI 1L1OC 2DE6A 3RZDI 3FKII 3I07A 4A3CI 1I3QI 3K7AI 2BJOA 4A3MI 3S1RI 1USPB 4A3DI 1QYPA 1ML8A 2K5RA 5IP7I 3GTJI 3GTMI 4NB8A 1X3ZA 4NOZA 1Y1VS 3D6WA 2NVYI 1NUIA 3VMIA 3HOVI 3S1MI 1TWHI 4NBGA 1TWGI 4Y52I 3GTGI 2KPIA 5CM2M 3CQZI 3EERA 1SFOI 3GTMS 3HOYI 3I4NI 1K83I 4A3FI 2NVQI 5C4JI 1YUAA 1I50I 2R7ZI 2DE5A 2R92I 2DE7A 3HOUI 3I4MI 2JA7I 1VLAA 4A3LI 4NBHA 2P3YA 2JR6A 3GCFA 3S17I 3S2HI 4MH4A 4A3GI 3S14I 3HOWI 1ZB8A 1TWFI 4NBEA 4A93I 2JA6I 1TFIA 5C3EI 3PO3S
chains in the Genus database with same CATH superfamily
4BY7I 1Z01A 3S2DI 2F4OA 2WAQA 1VQ5Z 4BY1I 3J80b 4AYBA 2YU9I 3GKQA 4BBSI 2JA8I 1M902 3PO3I 1Q861 4MD7A 3JAMf 1R9TI 3CCVZ 1Q811 3CC4Z 4NBCA 5IP9I 1VQNZ 3U50C 3GTKI 4NFRA 2HF1A 2NVTI 1I6HI 1VQLZ 3IX0A 1TWAI 1RO2A 4NBBA 1DL6A 1USPA 2PM9A 3BG1B 4CL1A 2PMZA 1ZB9A 2WB1A 1YIJ1 2JIMA 4E2ZA 1Q16A 3FQMA 3RZOI 3EEDA 4Y7NI 1PFTA 3J81b 3G71Z 1WJ2A 1JJ2Y 2VUMI 3HKZA 2QREB 3MZLB 1VQ7Z 4NBDA 3F3PC 4NH1C 1Y1VI 3CCMZ 1YIT1 1FDOA 4E2WA 1KQSY 3CCUZ 1ML8A 3CMEZ 2VPXA 3CC71 3TDHB 4NOZA 1Y1VS 3D6WA 2H85A 2JMOA 2G2KA 2Q4ZA 4NBGA 1TWGI 1YI21 1VQ9Z 2AYDA 2V8KA 3NDIA 3T4NB 3BG0B 2KPIA 1VQ41 2QA4Z 1VQO1 2R6MA 1VQP1 2NVQI 3G6EZ 1I50I 2R7ZI 2OOYB 1VQM1 2JIQA 2M6NA 2ZAEB 3I4MI 4MXUA 3J81f 3CD6Z 2OZKA 1S721 3S2HI 4A3GI 4MH4A 1Q821 1JJ2Z 3CCSZ 2RT9A 2KI7B 1TFIA 5C3EI 4MD8A 3G4S1 2GU2A 3CCL1 4QTTA 3H0GI 4MONA 1KQSZ 3HOXI 1ZH1A 1K8A1 2LEXA 2VPWA 5C4XI 1WIIA 3I56Z 4HGYA 2M48A 3I55Z 1Q7Y1 2RPRA 1VQ8Z 3CCJ1 3CCRZ 4NB9A 2LIYA 1Z03A 2E9HA 4S1TA 1X0TA 3OW2Y 2JS4A 2W03A 4A3II 3J7A4 3PO2I 4HH4A 4BXXI 4NBAA 2QRCB 2OOXB 4RV9A 3D9XA 2AKLA 1QF8A 4BBRI 1N8R1 3CMA1 2E2JI 3VMGA 2E2HI 2OTL1 1L1OC 2O53A 1YIJZ 3P5JB 3RZDI 4DK1A 2I3CA 3K7AI 2GTHA 3S1RI 1QYPA 4TNUA 3CCQ1 3GTMI 2NAPA 1K732 1X3ZA 1KC81 1YUKA 4E32A 1NJI1 2V8JA 2P28A 1KD11 3OW2Z 1YITZ 1Q862 3GTMS 3KIHA 2K3RA 4A3FI 5C4JI 1YUAA 2VPZA 1K9M1 1Q812 3CC7Z 2JA7I 1VLAA 4A3LI 4NBHA 2P3YA 5D1PA 5T64A 1YHQ1 3S17I 4E33A 1Y8CA 1M1K1 3S14I 1VQK1 3NH4A 1YI2Z 5T6BA 1VQ4Z 1VQOZ 5C44I 4A3KI 2RBLA 1VQPZ 3GTQI 4A3BI 2R93I 4A3EI 2E2II 1VQMZ 3F3FC 1RO4A 4RVDA 2QEX1 2RHBA 1RO0A 1YJN1 1S72Z 1QVFZ 3S15I 2V8IA 2JNYA 1RLYA 2IV2X 1Y1WI 5FLMI 3G4SZ 3CCLZ 1WW9A 1Z02A 1KRLA 3CCE1 2VUGA 2JIRA 2F4MA 1VQ61 3CC21 1QVGZ 3GTLI 3Q87A 2HU9A 2QR1B 2O4HA 3VMHA 3CPWY 4RVFA 1SIWA 1YJW1 3NH8A 3VTNA 4E30A 1RNIA 3S16I 1M901 2YADA 3CCJZ 1RQFA 4XX2A 2J6AA 3M3YI 1WZNA 1P9NA 1YJ91 3MONA 3FQQA 3I07A 1QXFA 4A3CI 1Q822 4A3MI 2BJOA 4A3DI 2K5RA 5IP7I 3GTJI 2E7ZA 4NB8A 4RVGA 1S7MA 2NVYI 1NUIA 2W04A 3VMIA 1W2BY 1TWHI 3HOVI 3S1MI 5IT9b 2OTJ1 3CMAZ 3GTGI 4EWCA 1K8A2 3CQZI 2OTLZ 3EERA 1SFOI 4E31A 3I4NI 1VQ51 1K83I 3CPWZ 2Y0SA 5D1OB 1Q7Y2 2DE7A 2IZ4A 3HOUI 3CCQZ 2JIOA 2JR6A 1QVFY 3CCV1 3HOWI 3CC41 3KIFA 1ZB8A 1VQN1 4NBEA 1AA6A 2JA6I 3PO3S 2B63I 3GTOI 1VQL1 3NH5A 3LUSA 3S1NI 2LFUA 2GTIA 3VB9A 2VF1A 1QVGY 1X3WA 5A2Qb 2JUBA 3D2LA 1YHQZ 5T67A 4MD9A 2V3VA 5FLXb 1N8R2 3GTPI 1VQKZ 2EGTA 5IT9f 1W2BZ 3G711 2V45A 3IR7A 3M4OI 4QTUA 3CXCY 1VQ71 3HOZI 3J80f 1LQLA 3MZKB 5LL6f 1N2FA 3CCM1 2JA5I 4RS4A 2Q51A 1KC82 3ESWA 3CCU1 1NJI2 2QEXZ 4NBFA 4A3JI 3H3VJ 3CME1 1YJNZ 1KD12 1TWCI 1JWHC 3QWUA 4DGLA 4E2XA 2PK7A 2RIQA 1WCMI 1VQ91 2QRDB 2NVXI 2QKDA 1K9M2 3TE5B 2JIPA 4X6AI 2QA41 1NP6A 5D1OA 3CCEZ 4RVHA 1VQ6Z 3S1QI 3CC2Z 5A2Qf 2DE6A 3FKII 3G6E1 1I3QI 1M1K2 1YJWZ 4E2YA 1USPB 5FLXf 3IFUA 2VPYA 3CD61 3JAMb 3CCS1 4Y52I 3CXCZ 5AN9F 5CM2M 4DQYB 1YJ9Z 3HOYI 2QLVB 2DE5A 2R92I 2IZ3A 3NFZA 4MRIA 1FDIA 3GCFA 3I561 3NDJA 3I551 1TWFI 1VQ81 4A93I 2OTJZ 4HGZA 3CCR1 3IF8A 1K731
chains in the Genus database with same CATH topology
4BY7I 1Z01A 3S2DI 2F4OA 2WAQA 1VQ5Z 4BY1I 3J80b 4AYBA 2YU9I 3GKQA 4BBSI 2JA8I 1M902 3PO3I 1Q861 4MD7A 3JAMf 1R9TI 3CCVZ 1Q811 3CC4Z 4NBCA 5IP9I 1VQNZ 3U50C 3GTKI 4NFRA 2HF1A 2NVTI 1I6HI 1VQLZ 3IX0A 1TWAI 1RO2A 4NBBA 1DL6A 1USPA 2PM9A 3BG1B 4CL1A 2PMZA 1ZB9A 2WB1A 1YIJ1 4E2ZA 3FQMA 3RZOI 3EEDA 4Y7NI 1PFTA 3J81b 3G71Z 1JJ2Y 2VUMI 3HKZA 2QREB 3MZLB 1VQ7Z 4NBDA 3F3PC 4NH1C 1Y1VI 3CCMZ 1YIT1 4E2WA 1KQSY 3CCUZ 1ML8A 3CMEZ 3CC71 3TDHB 4NOZA 1Y1VS 3D6WA 2H85A 2JMOA 2G2KA 2Q4ZA 4NBGA 1TWGI 1YI21 1VQ9Z 2V8KA 3NDIA 3T4NB 3BG0B 2KPIA 1VQ41 2QA4Z 1VQO1 2R6MA 1VQP1 2NVQI 3G6EZ 1I50I 2R7ZI 2OOYB 1VQM1 2M6NA 2ZAEB 3I4MI 4MXUA 3J81f 3CD6Z 2OZKA 1S721 3S2HI 4A3GI 4MH4A 1Q821 1JJ2Z 3CCSZ 2RT9A 2KI7B 1TFIA 5C3EI 4MD8A 3G4S1 2GU2A 3CCL1 4QTTA 3H0GI 4MONA 1KQSZ 3HOXI 1ZH1A 1K8A1 5C4XI 1WIIA 3I56Z 4HGYA 2M48A 3I55Z 1Q7Y1 2RPRA 1VQ8Z 3CCJ1 3CCRZ 4NB9A 2LIYA 1Z03A 2E9HA 4S1TA 1X0TA 3OW2Y 2JS4A 2W03A 4A3II 3J7A4 3PO2I 4HH4A 4BXXI 4NBAA 2QRCB 2OOXB 4RV9A 3D9XA 2AKLA 1QF8A 4BBRI 1N8R1 3CMA1 2E2JI 3VMGA 2E2HI 2OTL1 1L1OC 2O53A 1YIJZ 3P5JB 3RZDI 4DK1A 2I3CA 3K7AI 2GTHA 3S1RI 1QYPA 4TNUA 3CCQ1 3GTMI 1K732 1X3ZA 1KC81 1YUKA 4E32A 1NJI1 2V8JA 2P28A 1KD11 3OW2Z 1YITZ 1Q862 3GTMS 3KIHA 2K3RA 4A3FI 5C4JI 1YUAA 1K9M1 1Q812 3CC7Z 2JA7I 1VLAA 4A3LI 4NBHA 2P3YA 5D1PA 5T64A 1YHQ1 3S17I 4E33A 1M1K1 3S14I 1VQK1 3NH4A 1YI2Z 5T6BA 1VQ4Z 1VQOZ 5C44I 4A3KI 2RBLA 1VQPZ 3GTQI 4A3BI 2R93I 4A3EI 2E2II 1VQMZ 3F3FC 1RO4A 4RVDA 2QEX1 2RHBA 1RO0A 1YJN1 1S72Z 1QVFZ 3S15I 2V8IA 2JNYA 1RLYA 1Y1WI 5FLMI 3G4SZ 3CCLZ 1WW9A 1Z02A 1KRLA 3CCE1 2VUGA 2F4MA 1VQ61 3CC21 1QVGZ 3GTLI 3Q87A 2HU9A 2QR1B 2O4HA 3VMHA 3CPWY 4RVFA 1YJW1 3NH8A 3VTNA 4E30A 1RNIA 3S16I 1M901 2YADA 3CCJZ 1RQFA 4XX2A 2J6AA 3M3YI 1P9NA 1YJ91 3MONA 3FQQA 3I07A 4A3CI 1Q822 4A3MI 2BJOA 4A3DI 2K5RA 5IP7I 3GTJI 4NB8A 4RVGA 1S7MA 2NVYI 1NUIA 2W04A 3VMIA 1W2BY 1TWHI 3HOVI 3S1MI 5IT9b 2OTJ1 3CMAZ 3GTGI 4EWCA 1K8A2 3CQZI 2OTLZ 3EERA 1SFOI 4E31A 3I4NI 1VQ51 1K83I 3CPWZ 2Y0SA 5D1OB 1Q7Y2 2DE7A 2IZ4A 3HOUI 3CCQZ 2JR6A 1QVFY 3CCV1 3HOWI 3CC41 3KIFA 1ZB8A 1VQN1 4NBEA 2JA6I 3PO3S 2B63I 3GTOI 1VQL1 3NH5A 3LUSA 3S1NI 2LFUA 2GTIA 3VB9A 2VF1A 1QVGY 1X3WA 5A2Qb 2JUBA 1YHQZ 5T67A 4MD9A 5FLXb 1N8R2 3GTPI 1VQKZ 2EGTA 5IT9f 1W2BZ 3G711 3M4OI 4QTUA 3CXCY 1VQ71 3HOZI 3J80f 1LQLA 3MZKB 5LL6f 1N2FA 3CCM1 2JA5I 4RS4A 2Q51A 1KC82 3ESWA 3CCU1 1NJI2 2QEXZ 4NBFA 4A3JI 3H3VJ 3CME1 1YJNZ 1KD12 1TWCI 1JWHC 3QWUA 4DGLA 4E2XA 2PK7A 2RIQA 1WCMI 1VQ91 2QRDB 2NVXI 2QKDA 1K9M2 3TE5B 4X6AI 2QA41 1NP6A 5D1OA 3CCEZ 4RVHA 1VQ6Z 3S1QI 3CC2Z 5A2Qf 2DE6A 3FKII 3G6E1 1I3QI 1M1K2 1YJWZ 4E2YA 1USPB 5FLXf 3IFUA 3CD61 3JAMb 3CCS1 4Y52I 3CXCZ 5AN9F 5CM2M 4DQYB 1YJ9Z 3HOYI 2QLVB 2DE5A 2R92I 2IZ3A 3NFZA 4MRIA 3GCFA 3I561 3NDJA 3I551 1TWFI 1VQ81 4A93I 2OTJZ 4HGZA 3CCR1 3IF8A 1K731
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 I;  2B63 I;  3GTO I;  5C44 I;  4A3K I;  2RBL A;  3S2D I;  2F4O A;  3LUS A;  4QTT A;  3H0G I;  3GTQ I;  4A3B I;  3S1N I;  4BY1 I;  2R93 I;  4A3E I;  2E2I I;  3HOX I;  3VB9 A;  2YU9 I;  3GKQ A;  4BBS I;  2JA8 I;  1X3W A;  1RO4 A;  3PO3 I;  5C4X I;  1R9T I;  3GTP I;  4NBC A;  5IP9 I;  3U50 C;  3S15 I;  2JNY A;  1RLY A;  3GTK I;  4NB9 A;  2HF1 A;  3M4O I;  4QTU A;  2NVT I;  1I6H I;  1Y1W I;  5FLM I;  3HOZ I;  1WW9 A;  1LQL A;  1TWA I;  4NBB A;  1N2F A;  1DL6 A;  1USP A;  2JA5 I;  2JS4 A;  2F4M A;  4A3I I;  3GTL I;  1ZB9 A;  3PO2 I;  3Q87 A;  3VMH A;  3ESW A;  4NBF A;  4A3J I;  3H3V J;  1TWC I;  3RZO I;  4NBA A;  4BXX I;  4Y7N I;  1PFT A;  3S16 I;  2VUM I;  2PK7 A;  2AKL A;  1WCM I;  4XX2 A;  4BBR I;  2NVX I;  4NBD A;  2J6A A;  3M3Y I;  4X6A I;  2E2J I;  1Y1V I;  3VMG A;  3S1Q I;  2E2H I;  1L1O C;  2DE6 A;  3RZD I;  3FKI I;  3I07 A;  4A3C I;  1I3Q I;  3K7A I;  2BJO A;  4A3M I;  3S1R I;  1USP B;  4A3D I;  1QYP A;  1ML8 A;  2K5R A;  5IP7 I;  3GTJ I;  3GTM I;  4NB8 A;  1X3Z A;  4NOZ A;  1Y1V S;  3D6W A;  2NVY I;  1NUI A;  3VMI A;  3HOV I;  3S1M I;  1TWH I;  4NBG A;  1TWG I;  4Y52 I;  3GTG I;  2KPI A;  5CM2 M;  3CQZ I;  3EER A;  1SFO I;  3GTM S;  3HOY I;  3I4N I;  1K83 I;  4A3F I;  2NVQ I;  5C4J I;  1YUA A;  1I50 I;  2R7Z I;  2DE5 A;  2R92 I;  2DE7 A;  3HOU I;  3I4M I;  2JA7 I;  1VLA A;  4A3L I;  4NBH A;  2P3Y A;  2JR6 A;  3GCF A;  3S17 I;  3S2H I;  4MH4 A;  4A3G I;  3S14 I;  3HOW I;  1ZB8 A;  1TWF I;  4NBE A;  4A93 I;  2JA6 I;  1TFI A;  5C3E I;  3PO3 S; 
#chains in the Genus database with same CATH topology
 4BY7 I;  1Z01 A;  3S2D I;  2F4O A;  2WAQ A;  1VQ5 Z;  4BY1 I;  3J80 b;  4AYB A;  2YU9 I;  3GKQ A;  4BBS I;  2JA8 I;  1M90 2;  3PO3 I;  1Q86 1;  4MD7 A;  3JAM f;  1R9T I;  3CCV Z;  1Q81 1;  3CC4 Z;  4NBC A;  5IP9 I;  1VQN Z;  3U50 C;  3GTK I;  4NFR A;  2HF1 A;  2NVT I;  1I6H I;  1VQL Z;  3IX0 A;  1TWA I;  1RO2 A;  4NBB A;  1DL6 A;  1USP A;  2PM9 A;  3BG1 B;  4CL1 A;  2PMZ A;  1ZB9 A;  2WB1 A;  1YIJ 1;  2JIM A;  4E2Z A;  1Q16 A;  3FQM A;  3RZO I;  3EED A;  4Y7N I;  1PFT A;  3J81 b;  3G71 Z;  1WJ2 A;  1JJ2 Y;  2VUM I;  3HKZ A;  2QRE B;  3MZL B;  1VQ7 Z;  4NBD A;  3F3P C;  4NH1 C;  1Y1V I;  3CCM Z;  1YIT 1;  1FDO A;  4E2W A;  1KQS Y;  3CCU Z;  1ML8 A;  3CME Z;  2VPX A;  3CC7 1;  3TDH B;  4NOZ A;  1Y1V S;  3D6W A;  2H85 A;  2JMO A;  2G2K A;  2Q4Z A;  4NBG A;  1TWG I;  1YI2 1;  1VQ9 Z;  2AYD A;  2V8K A;  3NDI A;  3T4N B;  3BG0 B;  2KPI A;  1VQ4 1;  2QA4 Z;  1VQO 1;  2R6M A;  1VQP 1;  2NVQ I;  3G6E Z;  1I50 I;  2R7Z I;  2OOY B;  1VQM 1;  2JIQ A;  2M6N A;  2ZAE B;  3I4M I;  4MXU A;  3J81 f;  3CD6 Z;  2OZK A;  1S72 1;  3S2H I;  4A3G I;  4MH4 A;  1Q82 1;  1JJ2 Z;  3CCS Z;  2RT9 A;  2KI7 B;  1TFI A;  5C3E I;  4MD8 A;  3G4S 1;  2GU2 A;  3CCL 1;  4QTT A;  3H0G I;  4MON A;  1KQS Z;  3HOX I;  1ZH1 A;  1K8A 1;  2LEX A;  2VPW A;  5C4X I;  1WII A;  3I56 Z;  4HGY A;  2M48 A;  3I55 Z;  1Q7Y 1;  2RPR A;  1VQ8 Z;  3CCJ 1;  3CCR Z;  4NB9 A;  2LIY A;  1Z03 A;  2E9H A;  4S1T A;  1X0T A;  3OW2 Y;  2JS4 A;  2W03 A;  4A3I I;  3J7A 4;  3PO2 I;  4HH4 A;  4BXX I;  4NBA A;  2QRC B;  2OOX B;  4RV9 A;  3D9X A;  2AKL A;  1QF8 A;  4BBR I;  1N8R 1;  3CMA 1;  2E2J I;  3VMG A;  2E2H I;  2OTL 1;  1L1O C;  2O53 A;  1YIJ Z;  3P5J B;  3RZD I;  4DK1 A;  2I3C A;  3K7A I;  2GTH A;  3S1R I;  1QYP A;  4TNU A;  3CCQ 1;  3GTM I;  2NAP A;  1K73 2;  1X3Z A;  1KC8 1;  1YUK A;  4E32 A;  1NJI 1;  2V8J A;  2P28 A;  1KD1 1;  3OW2 Z;  1YIT Z;  1Q86 2;  3GTM S;  3KIH A;  2K3R A;  4A3F I;  5C4J I;  1YUA A;  2VPZ A;  1K9M 1;  1Q81 2;  3CC7 Z;  2JA7 I;  1VLA A;  4A3L I;  4NBH A;  2P3Y A;  5D1P A;  5T64 A;  1YHQ 1;  3S17 I;  4E33 A;  1Y8C A;  1M1K 1;  3S14 I;  1VQK 1;  3NH4 A;  1YI2 Z;  5T6B A;  1VQ4 Z;  1VQO Z;  5C44 I;  4A3K I;  2RBL A;  1VQP Z;  3GTQ I;  4A3B I;  2R93 I;  4A3E I;  2E2I I;  1VQM Z;  3F3F C;  1RO4 A;  4RVD A;  2QEX 1;  2RHB A;  1RO0 A;  1YJN 1;  1S72 Z;  1QVF Z;  3S15 I;  2V8I A;  2JNY A;  1RLY A;  2IV2 X;  1Y1W I;  5FLM I;  3G4S Z;  3CCL Z;  1WW9 A;  1Z02 A;  1KRL A;  3CCE 1;  2VUG A;  2JIR A;  2F4M A;  1VQ6 1;  3CC2 1;  1QVG Z;  3GTL I;  3Q87 A;  2HU9 A;  2QR1 B;  2O4H A;  3VMH A;  3CPW Y;  4RVF A;  1SIW A;  1YJW 1;  3NH8 A;  3VTN A;  4E30 A;  1RNI A;  3S16 I;  1M90 1;  2YAD A;  3CCJ Z;  1RQF A;  4XX2 A;  2J6A A;  3M3Y I;  1WZN A;  1P9N A;  1YJ9 1;  3MON A;  3FQQ A;  3I07 A;  1QXF A;  4A3C I;  1Q82 2;  4A3M I;  2BJO A;  4A3D I;  2K5R A;  5IP7 I;  3GTJ I;  2E7Z A;  4NB8 A;  4RVG A;  1S7M A;  2NVY I;  1NUI A;  2W04 A;  3VMI A;  1W2B Y;  1TWH I;  3HOV I;  3S1M I;  5IT9 b;  2OTJ 1;  3CMA Z;  3GTG I;  4EWC A;  1K8A 2;  3CQZ I;  2OTL Z;  3EER A;  1SFO I;  4E31 A;  3I4N I;  1VQ5 1;  1K83 I;  3CPW Z;  2Y0S A;  5D1O B;  1Q7Y 2;  2DE7 A;  2IZ4 A;  3HOU I;  3CCQ Z;  2JIO A;  2JR6 A;  1QVF Y;  3CCV 1;  3HOW I;  3CC4 1;  3KIF A;  1ZB8 A;  1VQN 1;  4NBE A;  1AA6 A;  2JA6 I;  3PO3 S;  2B63 I;  3GTO I;  1VQL 1;  3NH5 A;  3LUS A;  3S1N I;  2LFU A;  2GTI A;  3VB9 A;  2VF1 A;  1QVG Y;  1X3W A;  5A2Q b;  2JUB A;  3D2L A;  1YHQ Z;  5T67 A;  4MD9 A;  2V3V A;  5FLX b;  1N8R 2;  3GTP I;  1VQK Z;  2EGT A;  5IT9 f;  1W2B Z;  3G71 1;  2V45 A;  3IR7 A;  3M4O I;  4QTU A;  3CXC Y;  1VQ7 1;  3HOZ I;  3J80 f;  1LQL A;  3MZK B;  5LL6 f;  1N2F A;  3CCM 1;  2JA5 I;  4RS4 A;  2Q51 A;  1KC8 2;  3ESW A;  3CCU 1;  1NJI 2;  2QEX Z;  4NBF A;  4A3J I;  3H3V J;  3CME 1;  1YJN Z;  1KD1 2;  1TWC I;  1JWH C;  3QWU A;  4DGL A;  4E2X A;  2PK7 A;  2RIQ A;  1WCM I;  1VQ9 1;  2QRD B;  2NVX I;  2QKD A;  1K9M 2;  3TE5 B;  2JIP A;  4X6A I;  2QA4 1;  1NP6 A;  5D1O A;  3CCE Z;  4RVH A;  1VQ6 Z;  3S1Q I;  3CC2 Z;  5A2Q f;  2DE6 A;  3FKI I;  3G6E 1;  1I3Q I;  1M1K 2;  1YJW Z;  4E2Y A;  1USP B;  5FLX f;  3IFU A;  2VPY A;  3CD6 1;  3JAM b;  3CCS 1;  4Y52 I;  3CXC Z;  5AN9 F;  5CM2 M;  4DQY B;  1YJ9 Z;  3HOY I;  2QLV B;  2DE5 A;  2R92 I;  2IZ3 A;  3NFZ A;  4MRI A;  1FDI A;  3GCF A;  3I56 1;  3NDJ A;  3I55 1;  1TWF I;  1VQ8 1;  4A93 I;  2OTJ Z;  4HGZ A;  3CCR 1;  3IF8 A;  1K73 1; 
#chains in the Genus database with same CATH homology
 4BY7 I;  1Z01 A;  3S2D I;  2F4O A;  2WAQ A;  1VQ5 Z;  4BY1 I;  3J80 b;  4AYB A;  2YU9 I;  3GKQ A;  4BBS I;  2JA8 I;  1M90 2;  3PO3 I;  1Q86 1;  4MD7 A;  3JAM f;  1R9T I;  3CCV Z;  1Q81 1;  3CC4 Z;  4NBC A;  5IP9 I;  1VQN Z;  3U50 C;  3GTK I;  4NFR A;  2HF1 A;  2NVT I;  1I6H I;  1VQL Z;  3IX0 A;  1TWA I;  1RO2 A;  4NBB A;  1DL6 A;  1USP A;  2PM9 A;  3BG1 B;  4CL1 A;  2PMZ A;  1ZB9 A;  2WB1 A;  1YIJ 1;  4E2Z A;  3FQM A;  3RZO I;  3EED A;  4Y7N I;  1PFT A;  3J81 b;  3G71 Z;  1JJ2 Y;  2VUM I;  3HKZ A;  2QRE B;  3MZL B;  1VQ7 Z;  4NBD A;  3F3P C;  4NH1 C;  1Y1V I;  3CCM Z;  1YIT 1;  4E2W A;  1KQS Y;  3CCU Z;  1ML8 A;  3CME Z;  3CC7 1;  3TDH B;  4NOZ A;  1Y1V S;  3D6W A;  2H85 A;  2JMO A;  2G2K A;  2Q4Z A;  4NBG A;  1TWG I;  1YI2 1;  1VQ9 Z;  2V8K A;  3NDI A;  3T4N B;  3BG0 B;  2KPI A;  1VQ4 1;  2QA4 Z;  1VQO 1;  2R6M A;  1VQP 1;  2NVQ I;  3G6E Z;  1I50 I;  2R7Z I;  2OOY B;  1VQM 1;  2M6N A;  2ZAE B;  3I4M I;  4MXU A;  3J81 f;  3CD6 Z;  2OZK A;  1S72 1;  3S2H I;  4A3G I;  4MH4 A;  1Q82 1;  1JJ2 Z;  3CCS Z;  2RT9 A;  2KI7 B;  1TFI A;  5C3E I;  4MD8 A;  3G4S 1;  2GU2 A;  3CCL 1;  4QTT A;  3H0G I;  4MON A;  1KQS Z;  3HOX I;  1ZH1 A;  1K8A 1;  5C4X I;  1WII A;  3I56 Z;  4HGY A;  2M48 A;  3I55 Z;  1Q7Y 1;  2RPR A;  1VQ8 Z;  3CCJ 1;  3CCR Z;  4NB9 A;  2LIY A;  1Z03 A;  2E9H A;  4S1T A;  1X0T A;  3OW2 Y;  2JS4 A;  2W03 A;  4A3I I;  3J7A 4;  3PO2 I;  4HH4 A;  4BXX I;  4NBA A;  2QRC B;  2OOX B;  4RV9 A;  3D9X A;  2AKL A;  1QF8 A;  4BBR I;  1N8R 1;  3CMA 1;  2E2J I;  3VMG A;  2E2H I;  2OTL 1;  1L1O C;  2O53 A;  1YIJ Z;  3P5J B;  3RZD I;  4DK1 A;  2I3C A;  3K7A I;  2GTH A;  3S1R I;  1QYP A;  4TNU A;  3CCQ 1;  3GTM I;  1K73 2;  1X3Z A;  1KC8 1;  1YUK A;  4E32 A;  1NJI 1;  2V8J A;  2P28 A;  1KD1 1;  3OW2 Z;  1YIT Z;  1Q86 2;  3GTM S;  3KIH A;  2K3R A;  4A3F I;  5C4J I;  1YUA A;  1K9M 1;  1Q81 2;  3CC7 Z;  2JA7 I;  1VLA A;  4A3L I;  4NBH A;  2P3Y A;  5D1P A;  5T64 A;  1YHQ 1;  3S17 I;  4E33 A;  1M1K 1;  3S14 I;  1VQK 1;  3NH4 A;  1YI2 Z;  5T6B A;  1VQ4 Z;  1VQO Z;  5C44 I;  4A3K I;  2RBL A;  1VQP Z;  3GTQ I;  4A3B I;  2R93 I;  4A3E I;  2E2I I;  1VQM Z;  3F3F C;  1RO4 A;  4RVD A;  2QEX 1;  2RHB A;  1RO0 A;  1YJN 1;  1S72 Z;  1QVF Z;  3S15 I;  2V8I A;  2JNY A;  1RLY A;  1Y1W I;  5FLM I;  3G4S Z;  3CCL Z;  1WW9 A;  1Z02 A;  1KRL A;  3CCE 1;  2VUG A;  2F4M A;  1VQ6 1;  3CC2 1;  1QVG Z;  3GTL I;  3Q87 A;  2HU9 A;  2QR1 B;  2O4H A;  3VMH A;  3CPW Y;  4RVF A;  1YJW 1;  3NH8 A;  3VTN A;  4E30 A;  1RNI A;  3S16 I;  1M90 1;  2YAD A;  3CCJ Z;  1RQF A;  4XX2 A;  2J6A A;  3M3Y I;  1P9N A;  1YJ9 1;  3MON A;  3FQQ A;  3I07 A;  4A3C I;  1Q82 2;  4A3M I;  2BJO A;  4A3D I;  2K5R A;  5IP7 I;  3GTJ I;  4NB8 A;  4RVG A;  1S7M A;  2NVY I;  1NUI A;  2W04 A;  3VMI A;  1W2B Y;  1TWH I;  3HOV I;  3S1M I;  5IT9 b;  2OTJ 1;  3CMA Z;  3GTG I;  4EWC A;  1K8A 2;  3CQZ I;  2OTL Z;  3EER A;  1SFO I;  4E31 A;  3I4N I;  1VQ5 1;  1K83 I;  3CPW Z;  2Y0S A;  5D1O B;  1Q7Y 2;  2DE7 A;  2IZ4 A;  3HOU I;  3CCQ Z;  2JR6 A;  1QVF Y;  3CCV 1;  3HOW I;  3CC4 1;  3KIF A;  1ZB8 A;  1VQN 1;  4NBE A;  2JA6 I;  3PO3 S;  2B63 I;  3GTO I;  1VQL 1;  3NH5 A;  3LUS A;  3S1N I;  2LFU A;  2GTI A;  3VB9 A;  2VF1 A;  1QVG Y;  1X3W A;  5A2Q b;  2JUB A;  1YHQ Z;  5T67 A;  4MD9 A;  5FLX b;  1N8R 2;  3GTP I;  1VQK Z;  2EGT A;  5IT9 f;  1W2B Z;  3G71 1;  3M4O I;  4QTU A;  3CXC Y;  1VQ7 1;  3HOZ I;  3J80 f;  1LQL A;  3MZK B;  5LL6 f;  1N2F A;  3CCM 1;  2JA5 I;  4RS4 A;  2Q51 A;  1KC8 2;  3ESW A;  3CCU 1;  1NJI 2;  2QEX Z;  4NBF A;  4A3J I;  3H3V J;  3CME 1;  1YJN Z;  1KD1 2;  1TWC I;  1JWH C;  3QWU A;  4DGL A;  4E2X A;  2PK7 A;  2RIQ A;  1WCM I;  1VQ9 1;  2QRD B;  2NVX I;  2QKD A;  1K9M 2;  3TE5 B;  4X6A I;  2QA4 1;  1NP6 A;  5D1O A;  3CCE Z;  4RVH A;  1VQ6 Z;  3S1Q I;  3CC2 Z;  5A2Q f;  2DE6 A;  3FKI I;  3G6E 1;  1I3Q I;  1M1K 2;  1YJW Z;  4E2Y A;  1USP B;  5FLX f;  3IFU A;  3CD6 1;  3JAM b;  3CCS 1;  4Y52 I;  3CXC Z;  5AN9 F;  5CM2 M;  4DQY B;  1YJ9 Z;  3HOY I;  2QLV B;  2DE5 A;  2R92 I;  2IZ3 A;  3NFZ A;  4MRI A;  3GCF A;  3I56 1;  3NDJ A;  3I55 1;  1TWF I;  1VQ8 1;  4A93 I;  2OTJ Z;  4HGZ A;  3CCR 1;  3IF8 A;  1K73 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...