4A3DI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3dI02
2E2II 3VB9A 1TWHI 3U50C 2NVQI 4A3MI 1ZB8A 3K7AI 4A3JI 3S14I 2BJOA 1TWFI 2E2JI 2JA5I 1TWCI 2AKLA 3PO3S 1X3ZA 1WCMI 4A3BI 1ML8A 3VMGA 4A3II 4NBDA 3HOUI 3GCFA 4A3FI 2KPIA 3HOZI 1R9TI 3S1RI 2NVXI 4NB9A 2R93I 2YU9I 3H3VJ 3S2DI 1QYPA 1PFTA 3D6WA 4Y52I 2PK7A 1DL6A 3I4MI 2JA8I 1YUAA 1LQLA 4BY1I 3EERA 1VLAA 2F4OA 5C4JI 2VUMI 2DE5A 1Y1WI 3GTLI 2DE6A 2F4MA 4A93I 3ESWA 5IP9I 3S16I 4A3KI 3S1NI 2E2HI 3PO3I 4A3EI 2RBLA 3RZOI 3HOVI 4NB8A 4NBCA 2JA7I 5C3EI 2HF1A 3CQZI 2J6AA 4Y7NI 4QTTA 5CM2M 3S17I 1NUIA 2B63I 1I50I 1I3QI 3GTGI 3GTPI 4A3GI 3GTMS 2JR6A 3PO2I 3M4OI 1TWAI 3LUSA 1USPB 1N2FA 4NBHA 4NBEA 3GTJI 2DE7A 3HOYI 1RLYA 4QTUA 3VMHA 2NVTI 1L1OC 3H0GI 2K5RA 3S2HI 2R7ZI 3S1MI 4NOZA 3HOWI 3S1QI 1Y1VS 3FKII 3GTQI 3GTOI 1TFIA 3VMIA 4BXXI 1RO4A 2JNYA 5FLMI 3I4NI 3HOXI 3RZDI 4MH4A 1X3WA 4BBRI 4NBGA 4NBAA 3GTMI 4BY7I 1USPA 4XX2A 2P3YA 4X6AI 4A3LI 2NVYI 2JA6I 4BBSI 2R92I 5C4XI 4NBBA 3S15I 1TWGI 1I6HI 1ZB9A 3Q87A 1WW9A 2JS4A 4A3DI 3GTKI 1Y1VI 4NBFA 3M3YI 4A3CI 1K83I 1SFOI 3GKQA 5C44I 3I07A 5IP7I
chains in the Genus database with same CATH superfamily
1VQM1 1W2BZ 1TWHI 4NFRA 1YIT1 1QVGZ 3CCLZ 4E2YA 3I55Z 1TWFI 2JA5I 5D1OB 3J7A4 3NDIA 3CD6Z 3VMGA 5T67A 3J80b 3HOUI 3HOZI 2Q4ZA 1K9M1 3I551 2R93I 4HGYA 3H3VJ 4RVHA 2QRCB 4TNUA 1QYPA 2IZ3A 2OOXB 3J81b 1S72Z 4RVFA 4E2ZA 1KC82 3CD61 3OW2Z 1YUAA 1AA6A 3CCQZ 1NJI1 5FLXb 1RO0A 2VUMI 1VQPZ 2QLVB 2DE6A 2F4MA 1S721 2JMOA 1YI2Z 3CCQ1 3BG1B 3HOVI 2OTJ1 2KI7B 4Y7NI 3FQMA 4QTTA 1YIJZ 1YI21 1TWAI 1Q821 2DE7A 3VMHA 1L1OC 2V8JA 1YIJ1 3CCU1 3S2HI 1N8R1 3HKZA 3KIFA 3S1QI 2Q51A 1TFIA 3VMIA 4BXXI 2QEXZ 2JNYA 5FLMI 3IFUA 5IT9f 2RT9A 4NBAA 2V3VA 1YUKA 2NAPA 1USPA 3CXCY 2QEX1 1VQ8Z 4X6AI 1Q16A 1KC81 5C4XI 3FQQA 2RIQA 1M1K2 3CC41 4HH4A 1NJI2 1VQ5Z 1VQ81 3CCJZ 1YHQZ 3M3YI 4A3CI 2LIYA 1K83I 3CCVZ 1JJ2Y 2PM9A 4A93I 2P28A 4MD8A 3U50C 1VQ51 5T64A 1YHQ1 4A3JI 3G6EZ 2M6NA 3G711 3F3PC 2BJOA 3CCV1 5D1OA 1TWCI 4A3II 4NBDA 3G6E1 2NVXI 2K3RA 2V45A 1Q822 3S2DI 1KQSY 1PFTA 3CPWY 2PK7A 1QF8A 1DL6A 1VQ41 3I4MI 1WIIA 4BY1I 3BG0B 3EERA 1N8R2 3NH4A 2JUBA 1RNIA 2VPWA 3IX0A 3GTLI 3TDHB 1YJ91 1K8A2 2VPXA 5IP9I 4A3KI 3S1NI 1VQ6Z 3PO3I 4E31A 1FDIA 4DQYB 2RBLA 2RPRA 3CCL1 2GTIA 2HF1A 2GU2A 2J6AA 5CM2M 1I50I 1M1K1 1VQ61 3PO2I 1K732 1RLYA 2NVTI 2QA4Z 4RVGA 2O4HA 1VQ7Z 4HGZA 3S1MI 2VF1A 4NOZA 2PMZA 3CMAZ 2QA41 1VQP1 1VQ71 3CCMZ 1Y8CA 3I4NI 4NBGA 1SIWA 5A2Qf 3GTMI 1Q811 1VQ9Z 3CC2Z 2R6MA 3CCM1 4A3LI 2NVYI 3T4NB 5IT9b 4DK1A 4NBBA 3S15I 1TWGI 1VQ91 3Q87A 2M48A 2JIMA 3CCEZ 4A3DI 1Y1VI 2RHBA 4NBFA 5D1PA 1KD12 1K8A1 3KIHA 5C44I 1QVFY 3CCE1 2W03A 4E30A 2NVQI 4MD7A 4A3MI 3G4SZ 3CCSZ 1S7MA 2V8IA 1Z02A 2E2JI 1WZNA 3PO3S 1K731 1ZH1A 1WCMI 1ML8A 2JIQA 3GCFA 3G4S1 3CCS1 4E2WA 1R9TI 3S1RI 1NP6A 2YU9I 3CMEZ 2G2KA 3D6WA 2GTHA 2VPZA 2JIOA 2JIPA 5LL6f 1Z01A 3MONA 1LQLA 1VLAA 3JAMf 2F4OA 5C4JI 3CCJ1 4NH1C 1RQFA 4MONA 3S16I 2E2HI 3QWUA 4A3EI 4RV9A 1Q812 2WB1A 4NBCA 2EGTA 2JA7I 5C3EI 1Q7Y2 1VQLZ 1FDOA 3S17I 1W2BY 2B63I 3GTPI 4A3GI 3D2LA 3GTMS 2JR6A 1QVGY 1USPB 4NBHA 4NBEA 3GTJI 1X0TA 1KD11 2Y0SA 4E33A 1M901 5T6BA 2H85A 2QREB 1VQMZ 3HOWI 4E32A 1RO2A 1Y1VS 3FKII 2HU9A 1YITZ 3GTOI 3CCRZ 2I3CA 3OW2Y 2E9HA 3HOXI 4MH4A 1X3WA 2OZKA 1KQSZ 4BY7I 3CPWZ 2E7ZA 2QKDA 4XX2A 3CCR1 2JA6I 5A2Qb 2OTLZ 1ZB9A 1WW9A 2IZ4A 2JS4A 2JIRA 2OTL1 3GKQA 4A3FI 2E2II 3EEDA 3VB9A 4EWCA 3VTNA 3CMA1 2VPYA 1Q861 2VUGA 1Q7Y1 1ZB8A 3K7AI 2IV2X 3S14I 3J80f 2OTJZ 4CL1A 1WJ2A 1VQKZ 5AN9F 2AKLA 3J81f 1X3ZA 4A3BI 4RS4A 2KPIA 2LFUA 4S1TA 3CC21 2LEXA 4NB9A 4AYBA 1VQK1 5FLXf 3CCUZ 1M902 4Y52I 2JA8I 2QR1B 3TE5B 2AYDA 4MXUA 2DE5A 1Y1WI 2OOYB 3P5JB 3ESWA 3JAMb 1YJNZ 4MRIA 3RZOI 3IR7A 4NB8A 3CQZI 3NFZA 1NUIA 3D9XA 1I3QI 3GTGI 3M4OI 1YJN1 3LUSA 3CC4Z 1N2FA 3HOYI 4QTUA 3CME1 1K9M2 1QVFZ 3NH8A 3H0GI 2K5RA 3F3FC 1KRLA 4MD9A 3CXCZ 2R7ZI 3NH5A 3GTQI 4RVDA 1RO4A 3G71Z 1Q862 3CC7Z 2QRDB 1VQNZ 3RZDI 2WAQA 4BBRI 1JWHC 2O53A 1VQOZ 2YADA 2V8KA 1JJ2Z 3MZKB 4E2XA 3CC71 1Z03A 1VQL1 2P3YA 2ZAEB 3I56Z 4BBSI 3MZLB 1VQN1 2R92I 1YJWZ 1VQO1 1VQ4Z 1I6HI 1P9NA 3IF8A 2W04A 3GTKI 3I561 3NDJA 1YJW1 1YJ9Z 1SFOI 1QXFA 4DGLA 3I07A 5IP7I
chains in the Genus database with same CATH topology
1VQM1 1W2BZ 1TWHI 4NFRA 1YIT1 1QVGZ 3CCLZ 4E2YA 3I55Z 1TWFI 2JA5I 5D1OB 3J7A4 3NDIA 3CD6Z 3VMGA 5T67A 3J80b 3HOUI 3HOZI 2Q4ZA 1K9M1 3I551 2R93I 4HGYA 3H3VJ 4RVHA 2QRCB 4TNUA 1QYPA 2IZ3A 2OOXB 3J81b 1S72Z 4RVFA 4E2ZA 1KC82 3CD61 3OW2Z 1YUAA 3CCQZ 1NJI1 5FLXb 1RO0A 2VUMI 1VQPZ 2QLVB 2DE6A 2F4MA 1S721 2JMOA 1YI2Z 3CCQ1 3BG1B 3HOVI 2OTJ1 2KI7B 4Y7NI 3FQMA 4QTTA 1YIJZ 1YI21 1TWAI 1Q821 2DE7A 3VMHA 1L1OC 2V8JA 1YIJ1 3CCU1 3S2HI 1N8R1 3HKZA 3KIFA 3S1QI 2Q51A 1TFIA 3VMIA 4BXXI 2QEXZ 2JNYA 5FLMI 3IFUA 5IT9f 2RT9A 4NBAA 1YUKA 1USPA 3CXCY 2QEX1 1VQ8Z 4X6AI 1KC81 5C4XI 3FQQA 2RIQA 1M1K2 3CC41 4HH4A 1NJI2 1VQ5Z 1VQ81 3CCJZ 1YHQZ 3M3YI 4A3CI 2LIYA 1K83I 3CCVZ 1JJ2Y 2PM9A 4A93I 2P28A 4MD8A 3U50C 1VQ51 5T64A 1YHQ1 4A3JI 3G6EZ 2M6NA 3G711 3F3PC 2BJOA 3CCV1 5D1OA 1TWCI 4A3II 4NBDA 3G6E1 2NVXI 2K3RA 1Q822 3S2DI 1KQSY 1PFTA 3CPWY 2PK7A 1QF8A 1DL6A 1VQ41 3I4MI 1WIIA 4BY1I 3BG0B 3EERA 1N8R2 3NH4A 2JUBA 1RNIA 3IX0A 3GTLI 3TDHB 1YJ91 1K8A2 5IP9I 4A3KI 3S1NI 1VQ6Z 3PO3I 4E31A 4DQYB 2RBLA 2RPRA 3CCL1 2GTIA 2HF1A 2GU2A 2J6AA 5CM2M 1I50I 1M1K1 1VQ61 3PO2I 1K732 1RLYA 2NVTI 2QA4Z 4RVGA 2O4HA 1VQ7Z 4HGZA 3S1MI 2VF1A 4NOZA 2PMZA 3CMAZ 2QA41 1VQP1 1VQ71 3CCMZ 3I4NI 4NBGA 5A2Qf 3GTMI 1Q811 1VQ9Z 3CC2Z 2R6MA 3CCM1 4A3LI 2NVYI 3T4NB 5IT9b 4DK1A 4NBBA 3S15I 1TWGI 1VQ91 3Q87A 2M48A 3CCEZ 4A3DI 1Y1VI 2RHBA 4NBFA 5D1PA 1KD12 1K8A1 3KIHA 5C44I 1QVFY 3CCE1 2W03A 4E30A 2NVQI 4MD7A 4A3MI 3G4SZ 3CCSZ 1S7MA 2V8IA 1Z02A 2E2JI 3PO3S 1K731 1ZH1A 1WCMI 1ML8A 3GCFA 3G4S1 3CCS1 4E2WA 1R9TI 3S1RI 1NP6A 2YU9I 3CMEZ 2G2KA 3D6WA 2GTHA 5LL6f 1Z01A 3MONA 1LQLA 1VLAA 3JAMf 2F4OA 5C4JI 3CCJ1 4NH1C 1RQFA 4MONA 3S16I 2E2HI 3QWUA 4A3EI 4RV9A 1Q812 2WB1A 4NBCA 2EGTA 2JA7I 5C3EI 1Q7Y2 1VQLZ 3S17I 1W2BY 2B63I 3GTPI 4A3GI 3GTMS 2JR6A 1QVGY 1USPB 4NBHA 4NBEA 3GTJI 1X0TA 1KD11 2Y0SA 4E33A 1M901 5T6BA 2H85A 2QREB 1VQMZ 3HOWI 4E32A 1RO2A 1Y1VS 3FKII 2HU9A 1YITZ 3GTOI 3CCRZ 2I3CA 3OW2Y 2E9HA 3HOXI 4MH4A 1X3WA 2OZKA 1KQSZ 4BY7I 3CPWZ 2QKDA 4XX2A 3CCR1 2JA6I 5A2Qb 2OTLZ 1ZB9A 1WW9A 2IZ4A 2JS4A 2OTL1 4A3FI 3GKQA 2E2II 3EEDA 3VB9A 4EWCA 3VTNA 3CMA1 1Q861 2VUGA 1Q7Y1 1ZB8A 3K7AI 3S14I 2OTJZ 3J80f 4CL1A 1VQKZ 5AN9F 2AKLA 3J81f 1X3ZA 4A3BI 4RS4A 2KPIA 2LFUA 4S1TA 3CC21 4NB9A 4AYBA 1VQK1 5FLXf 3CCUZ 1M902 4Y52I 2JA8I 2QR1B 3TE5B 4MXUA 2DE5A 1Y1WI 2OOYB 3P5JB 3ESWA 3JAMb 1YJNZ 4MRIA 3RZOI 4NB8A 3CQZI 3NFZA 1NUIA 3D9XA 1I3QI 3GTGI 3M4OI 1YJN1 3LUSA 3CC4Z 1N2FA 3HOYI 4QTUA 3CME1 1K9M2 1QVFZ 3NH8A 3H0GI 2K5RA 3F3FC 1KRLA 4MD9A 3CXCZ 2R7ZI 3NH5A 3GTQI 4RVDA 1RO4A 3G71Z 1Q862 3CC7Z 2QRDB 1VQNZ 3RZDI 2WAQA 4BBRI 1JWHC 2O53A 1VQOZ 2YADA 2V8KA 1JJ2Z 3MZKB 4E2XA 3CC71 1Z03A 1VQL1 2P3YA 2ZAEB 3I56Z 4BBSI 3MZLB 1VQN1 2R92I 1YJWZ 1VQO1 1VQ4Z 1I6HI 1P9NA 3IF8A 2W04A 3GTKI 3I561 3NDJA 1YJW1 1YJ9Z 1SFOI 4DGLA 3I07A 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I I;  3VB9 A;  1TWH I;  3U50 C;  2NVQ I;  4A3M I;  1ZB8 A;  3K7A I;  4A3J I;  3S14 I;  2BJO A;  1TWF I;  2E2J I;  2JA5 I;  1TWC I;  2AKL A;  3PO3 S;  1X3Z A;  1WCM I;  4A3B I;  1ML8 A;  3VMG A;  4A3I I;  4NBD A;  3HOU I;  3GCF A;  4A3F I;  2KPI A;  3HOZ I;  1R9T I;  3S1R I;  2NVX I;  4NB9 A;  2R93 I;  2YU9 I;  3H3V J;  3S2D I;  1QYP A;  1PFT A;  3D6W A;  4Y52 I;  2PK7 A;  1DL6 A;  3I4M I;  2JA8 I;  1YUA A;  1LQL A;  4BY1 I;  3EER A;  1VLA A;  2F4O A;  5C4J I;  2VUM I;  2DE5 A;  1Y1W I;  3GTL I;  2DE6 A;  2F4M A;  4A93 I;  3ESW A;  5IP9 I;  3S16 I;  4A3K I;  3S1N I;  2E2H I;  3PO3 I;  4A3E I;  2RBL A;  3RZO I;  3HOV I;  4NB8 A;  4NBC A;  2JA7 I;  5C3E I;  2HF1 A;  3CQZ I;  2J6A A;  4Y7N I;  4QTT A;  5CM2 M;  3S17 I;  1NUI A;  2B63 I;  1I50 I;  1I3Q I;  3GTG I;  3GTP I;  4A3G I;  3GTM S;  2JR6 A;  3PO2 I;  3M4O I;  1TWA I;  3LUS A;  1USP B;  1N2F A;  4NBH A;  4NBE A;  3GTJ I;  2DE7 A;  3HOY I;  1RLY A;  4QTU A;  3VMH A;  2NVT I;  1L1O C;  3H0G I;  2K5R A;  3S2H I;  2R7Z I;  3S1M I;  4NOZ A;  3HOW I;  3S1Q I;  1Y1V S;  3FKI I;  3GTQ I;  3GTO I;  1TFI A;  3VMI A;  4BXX I;  1RO4 A;  2JNY A;  5FLM I;  3I4N I;  3HOX I;  3RZD I;  4MH4 A;  1X3W A;  4BBR I;  4NBG A;  4NBA A;  3GTM I;  4BY7 I;  1USP A;  4XX2 A;  2P3Y A;  4X6A I;  4A3L I;  2NVY I;  2JA6 I;  4BBS I;  2R92 I;  5C4X I;  4NBB A;  3S15 I;  1TWG I;  1I6H I;  1ZB9 A;  3Q87 A;  1WW9 A;  2JS4 A;  4A3D I;  3GTK I;  1Y1V I;  4NBF A;  3M3Y I;  4A3C I;  1K83 I;  1SFO I;  3GKQ A;  5C44 I;  3I07 A;  5IP7 I; 
#chains in the Genus database with same CATH topology
 1VQM 1;  1W2B Z;  1TWH I;  4NFR A;  1YIT 1;  1QVG Z;  3CCL Z;  4E2Y A;  3I55 Z;  1TWF I;  2JA5 I;  5D1O B;  3J7A 4;  3NDI A;  3CD6 Z;  3VMG A;  5T67 A;  3J80 b;  3HOU I;  3HOZ I;  2Q4Z A;  1K9M 1;  3I55 1;  2R93 I;  4HGY A;  3H3V J;  4RVH A;  2QRC B;  4TNU A;  1QYP A;  2IZ3 A;  2OOX B;  3J81 b;  1S72 Z;  4RVF A;  4E2Z A;  1KC8 2;  3CD6 1;  3OW2 Z;  1YUA A;  1AA6 A;  3CCQ Z;  1NJI 1;  5FLX b;  1RO0 A;  2VUM I;  1VQP Z;  2QLV B;  2DE6 A;  2F4M A;  1S72 1;  2JMO A;  1YI2 Z;  3CCQ 1;  3BG1 B;  3HOV I;  2OTJ 1;  2KI7 B;  4Y7N I;  3FQM A;  4QTT A;  1YIJ Z;  1YI2 1;  1TWA I;  1Q82 1;  2DE7 A;  3VMH A;  1L1O C;  2V8J A;  1YIJ 1;  3CCU 1;  3S2H I;  1N8R 1;  3HKZ A;  3KIF A;  3S1Q I;  2Q51 A;  1TFI A;  3VMI A;  4BXX I;  2QEX Z;  2JNY A;  5FLM I;  3IFU A;  5IT9 f;  2RT9 A;  4NBA A;  2V3V A;  1YUK A;  2NAP A;  1USP A;  3CXC Y;  2QEX 1;  1VQ8 Z;  4X6A I;  1Q16 A;  1KC8 1;  5C4X I;  3FQQ A;  2RIQ A;  1M1K 2;  3CC4 1;  4HH4 A;  1NJI 2;  1VQ5 Z;  1VQ8 1;  3CCJ Z;  1YHQ Z;  3M3Y I;  4A3C I;  2LIY A;  1K83 I;  3CCV Z;  1JJ2 Y;  2PM9 A;  4A93 I;  2P28 A;  4MD8 A;  3U50 C;  1VQ5 1;  5T64 A;  1YHQ 1;  4A3J I;  3G6E Z;  2M6N A;  3G71 1;  3F3P C;  2BJO A;  3CCV 1;  5D1O A;  1TWC I;  4A3I I;  4NBD A;  3G6E 1;  2NVX I;  2K3R A;  2V45 A;  1Q82 2;  3S2D I;  1KQS Y;  1PFT A;  3CPW Y;  2PK7 A;  1QF8 A;  1DL6 A;  1VQ4 1;  3I4M I;  1WII A;  4BY1 I;  3BG0 B;  3EER A;  1N8R 2;  3NH4 A;  2JUB A;  1RNI A;  2VPW A;  3IX0 A;  3GTL I;  3TDH B;  1YJ9 1;  1K8A 2;  2VPX A;  5IP9 I;  4A3K I;  3S1N I;  1VQ6 Z;  3PO3 I;  4E31 A;  1FDI A;  4DQY B;  2RBL A;  2RPR A;  3CCL 1;  2GTI A;  2HF1 A;  2GU2 A;  2J6A A;  5CM2 M;  1I50 I;  1M1K 1;  1VQ6 1;  3PO2 I;  1K73 2;  1RLY A;  2NVT I;  2QA4 Z;  4RVG A;  2O4H A;  1VQ7 Z;  4HGZ A;  3S1M I;  2VF1 A;  4NOZ A;  2PMZ A;  3CMA Z;  2QA4 1;  1VQP 1;  1VQ7 1;  3CCM Z;  1Y8C A;  3I4N I;  4NBG A;  1SIW A;  5A2Q f;  3GTM I;  1Q81 1;  1VQ9 Z;  3CC2 Z;  2R6M A;  3CCM 1;  4A3L I;  2NVY I;  3T4N B;  5IT9 b;  4DK1 A;  4NBB A;  3S15 I;  1TWG I;  1VQ9 1;  3Q87 A;  2M48 A;  2JIM A;  3CCE Z;  4A3D I;  1Y1V I;  2RHB A;  4NBF A;  5D1P A;  1KD1 2;  1K8A 1;  3KIH A;  5C44 I;  1QVF Y;  3CCE 1;  2W03 A;  4E30 A;  2NVQ I;  4MD7 A;  4A3M I;  3G4S Z;  3CCS Z;  1S7M A;  2V8I A;  1Z02 A;  2E2J I;  1WZN A;  3PO3 S;  1K73 1;  1ZH1 A;  1WCM I;  1ML8 A;  2JIQ A;  3GCF A;  3G4S 1;  3CCS 1;  4E2W A;  1R9T I;  3S1R I;  1NP6 A;  2YU9 I;  3CME Z;  2G2K A;  3D6W A;  2GTH A;  2VPZ A;  2JIO A;  2JIP A;  5LL6 f;  1Z01 A;  3MON A;  1LQL A;  1VLA A;  3JAM f;  2F4O A;  5C4J I;  3CCJ 1;  4NH1 C;  1RQF A;  4MON A;  3S16 I;  2E2H I;  3QWU A;  4A3E I;  4RV9 A;  1Q81 2;  2WB1 A;  4NBC A;  2EGT A;  2JA7 I;  5C3E I;  1Q7Y 2;  1VQL Z;  1FDO A;  3S17 I;  1W2B Y;  2B63 I;  3GTP I;  4A3G I;  3D2L A;  3GTM S;  2JR6 A;  1QVG Y;  1USP B;  4NBH A;  4NBE A;  3GTJ I;  1X0T A;  1KD1 1;  2Y0S A;  4E33 A;  1M90 1;  5T6B A;  2H85 A;  2QRE B;  1VQM Z;  3HOW I;  4E32 A;  1RO2 A;  1Y1V S;  3FKI I;  2HU9 A;  1YIT Z;  3GTO I;  3CCR Z;  2I3C A;  3OW2 Y;  2E9H A;  3HOX I;  4MH4 A;  1X3W A;  2OZK A;  1KQS Z;  4BY7 I;  3CPW Z;  2E7Z A;  2QKD A;  4XX2 A;  3CCR 1;  2JA6 I;  5A2Q b;  2OTL Z;  1ZB9 A;  1WW9 A;  2IZ4 A;  2JS4 A;  2JIR A;  2OTL 1;  3GKQ A;  4A3F I;  2E2I I;  3EED A;  3VB9 A;  4EWC A;  3VTN A;  3CMA 1;  2VPY A;  1Q86 1;  2VUG A;  1Q7Y 1;  1ZB8 A;  3K7A I;  2IV2 X;  3S14 I;  3J80 f;  2OTJ Z;  4CL1 A;  1WJ2 A;  1VQK Z;  5AN9 F;  2AKL A;  3J81 f;  1X3Z A;  4A3B I;  4RS4 A;  2KPI A;  2LFU A;  4S1T A;  3CC2 1;  2LEX A;  4NB9 A;  4AYB A;  1VQK 1;  5FLX f;  3CCU Z;  1M90 2;  4Y52 I;  2JA8 I;  2QR1 B;  3TE5 B;  2AYD A;  4MXU A;  2DE5 A;  1Y1W I;  2OOY B;  3P5J B;  3ESW A;  3JAM b;  1YJN Z;  4MRI A;  3RZO I;  3IR7 A;  4NB8 A;  3CQZ I;  3NFZ A;  1NUI A;  3D9X A;  1I3Q I;  3GTG I;  3M4O I;  1YJN 1;  3LUS A;  3CC4 Z;  1N2F A;  3HOY I;  4QTU A;  3CME 1;  1K9M 2;  1QVF Z;  3NH8 A;  3H0G I;  2K5R A;  3F3F C;  1KRL A;  4MD9 A;  3CXC Z;  2R7Z I;  3NH5 A;  3GTQ I;  4RVD A;  1RO4 A;  3G71 Z;  1Q86 2;  3CC7 Z;  2QRD B;  1VQN Z;  3RZD I;  2WAQ A;  4BBR I;  1JWH C;  2O53 A;  1VQO Z;  2YAD A;  2V8K A;  1JJ2 Z;  3MZK B;  4E2X A;  3CC7 1;  1Z03 A;  1VQL 1;  2P3Y A;  2ZAE B;  3I56 Z;  4BBS I;  3MZL B;  1VQN 1;  2R92 I;  1YJW Z;  1VQO 1;  1VQ4 Z;  1I6H I;  1P9N A;  3IF8 A;  2W04 A;  3GTK I;  3I56 1;  3NDJ A;  1YJW 1;  1YJ9 Z;  1SFO I;  1QXF A;  4DGL A;  3I07 A;  5IP7 I; 
#chains in the Genus database with same CATH homology
 1VQM 1;  1W2B Z;  1TWH I;  4NFR A;  1YIT 1;  1QVG Z;  3CCL Z;  4E2Y A;  3I55 Z;  1TWF I;  2JA5 I;  5D1O B;  3J7A 4;  3NDI A;  3CD6 Z;  3VMG A;  5T67 A;  3J80 b;  3HOU I;  3HOZ I;  2Q4Z A;  1K9M 1;  3I55 1;  2R93 I;  4HGY A;  3H3V J;  4RVH A;  2QRC B;  4TNU A;  1QYP A;  2IZ3 A;  2OOX B;  3J81 b;  1S72 Z;  4RVF A;  4E2Z A;  1KC8 2;  3CD6 1;  3OW2 Z;  1YUA A;  3CCQ Z;  1NJI 1;  5FLX b;  1RO0 A;  2VUM I;  1VQP Z;  2QLV B;  2DE6 A;  2F4M A;  1S72 1;  2JMO A;  1YI2 Z;  3CCQ 1;  3BG1 B;  3HOV I;  2OTJ 1;  2KI7 B;  4Y7N I;  3FQM A;  4QTT A;  1YIJ Z;  1YI2 1;  1TWA I;  1Q82 1;  2DE7 A;  3VMH A;  1L1O C;  2V8J A;  1YIJ 1;  3CCU 1;  3S2H I;  1N8R 1;  3HKZ A;  3KIF A;  3S1Q I;  2Q51 A;  1TFI A;  3VMI A;  4BXX I;  2QEX Z;  2JNY A;  5FLM I;  3IFU A;  5IT9 f;  2RT9 A;  4NBA A;  1YUK A;  1USP A;  3CXC Y;  2QEX 1;  1VQ8 Z;  4X6A I;  1KC8 1;  5C4X I;  3FQQ A;  2RIQ A;  1M1K 2;  3CC4 1;  4HH4 A;  1NJI 2;  1VQ5 Z;  1VQ8 1;  3CCJ Z;  1YHQ Z;  3M3Y I;  4A3C I;  2LIY A;  1K83 I;  3CCV Z;  1JJ2 Y;  2PM9 A;  4A93 I;  2P28 A;  4MD8 A;  3U50 C;  1VQ5 1;  5T64 A;  1YHQ 1;  4A3J I;  3G6E Z;  2M6N A;  3G71 1;  3F3P C;  2BJO A;  3CCV 1;  5D1O A;  1TWC I;  4A3I I;  4NBD A;  3G6E 1;  2NVX I;  2K3R A;  1Q82 2;  3S2D I;  1KQS Y;  1PFT A;  3CPW Y;  2PK7 A;  1QF8 A;  1DL6 A;  1VQ4 1;  3I4M I;  1WII A;  4BY1 I;  3BG0 B;  3EER A;  1N8R 2;  3NH4 A;  2JUB A;  1RNI A;  3IX0 A;  3GTL I;  3TDH B;  1YJ9 1;  1K8A 2;  5IP9 I;  4A3K I;  3S1N I;  1VQ6 Z;  3PO3 I;  4E31 A;  4DQY B;  2RBL A;  2RPR A;  3CCL 1;  2GTI A;  2HF1 A;  2GU2 A;  2J6A A;  5CM2 M;  1I50 I;  1M1K 1;  1VQ6 1;  3PO2 I;  1K73 2;  1RLY A;  2NVT I;  2QA4 Z;  4RVG A;  2O4H A;  1VQ7 Z;  4HGZ A;  3S1M I;  2VF1 A;  4NOZ A;  2PMZ A;  3CMA Z;  2QA4 1;  1VQP 1;  1VQ7 1;  3CCM Z;  3I4N I;  4NBG A;  5A2Q f;  3GTM I;  1Q81 1;  1VQ9 Z;  3CC2 Z;  2R6M A;  3CCM 1;  4A3L I;  2NVY I;  3T4N B;  5IT9 b;  4DK1 A;  4NBB A;  3S15 I;  1TWG I;  1VQ9 1;  3Q87 A;  2M48 A;  3CCE Z;  4A3D I;  1Y1V I;  2RHB A;  4NBF A;  5D1P A;  1KD1 2;  1K8A 1;  3KIH A;  5C44 I;  1QVF Y;  3CCE 1;  2W03 A;  4E30 A;  2NVQ I;  4MD7 A;  4A3M I;  3G4S Z;  3CCS Z;  1S7M A;  2V8I A;  1Z02 A;  2E2J I;  3PO3 S;  1K73 1;  1ZH1 A;  1WCM I;  1ML8 A;  3GCF A;  3G4S 1;  3CCS 1;  4E2W A;  1R9T I;  3S1R I;  1NP6 A;  2YU9 I;  3CME Z;  2G2K A;  3D6W A;  2GTH A;  5LL6 f;  1Z01 A;  3MON A;  1LQL A;  1VLA A;  3JAM f;  2F4O A;  5C4J I;  3CCJ 1;  4NH1 C;  1RQF A;  4MON A;  3S16 I;  2E2H I;  3QWU A;  4A3E I;  4RV9 A;  1Q81 2;  2WB1 A;  4NBC A;  2EGT A;  2JA7 I;  5C3E I;  1Q7Y 2;  1VQL Z;  3S17 I;  1W2B Y;  2B63 I;  3GTP I;  4A3G I;  3GTM S;  2JR6 A;  1QVG Y;  1USP B;  4NBH A;  4NBE A;  3GTJ I;  1X0T A;  1KD1 1;  2Y0S A;  4E33 A;  1M90 1;  5T6B A;  2H85 A;  2QRE B;  1VQM Z;  3HOW I;  4E32 A;  1RO2 A;  1Y1V S;  3FKI I;  2HU9 A;  1YIT Z;  3GTO I;  3CCR Z;  2I3C A;  3OW2 Y;  2E9H A;  3HOX I;  4MH4 A;  1X3W A;  2OZK A;  1KQS Z;  4BY7 I;  3CPW Z;  2QKD A;  4XX2 A;  3CCR 1;  2JA6 I;  5A2Q b;  2OTL Z;  1ZB9 A;  1WW9 A;  2IZ4 A;  2JS4 A;  2OTL 1;  4A3F I;  3GKQ A;  2E2I I;  3EED A;  3VB9 A;  4EWC A;  3VTN A;  3CMA 1;  1Q86 1;  2VUG A;  1Q7Y 1;  1ZB8 A;  3K7A I;  3S14 I;  2OTJ Z;  3J80 f;  4CL1 A;  1VQK Z;  5AN9 F;  2AKL A;  3J81 f;  1X3Z A;  4A3B I;  4RS4 A;  2KPI A;  2LFU A;  4S1T A;  3CC2 1;  4NB9 A;  4AYB A;  1VQK 1;  5FLX f;  3CCU Z;  1M90 2;  4Y52 I;  2JA8 I;  2QR1 B;  3TE5 B;  4MXU A;  2DE5 A;  1Y1W I;  2OOY B;  3P5J B;  3ESW A;  3JAM b;  1YJN Z;  4MRI A;  3RZO I;  4NB8 A;  3CQZ I;  3NFZ A;  1NUI A;  3D9X A;  1I3Q I;  3GTG I;  3M4O I;  1YJN 1;  3LUS A;  3CC4 Z;  1N2F A;  3HOY I;  4QTU A;  3CME 1;  1K9M 2;  1QVF Z;  3NH8 A;  3H0G I;  2K5R A;  3F3F C;  1KRL A;  4MD9 A;  3CXC Z;  2R7Z I;  3NH5 A;  3GTQ I;  4RVD A;  1RO4 A;  3G71 Z;  1Q86 2;  3CC7 Z;  2QRD B;  1VQN Z;  3RZD I;  2WAQ A;  4BBR I;  1JWH C;  2O53 A;  1VQO Z;  2YAD A;  2V8K A;  1JJ2 Z;  3MZK B;  4E2X A;  3CC7 1;  1Z03 A;  1VQL 1;  2P3Y A;  2ZAE B;  3I56 Z;  4BBS I;  3MZL B;  1VQN 1;  2R92 I;  1YJW Z;  1VQO 1;  1VQ4 Z;  1I6H I;  1P9N A;  3IF8 A;  2W04 A;  3GTK I;  3I56 1;  3NDJ A;  1YJW 1;  1YJ9 Z;  1SFO I;  4DGL A;  3I07 A;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...