2OTJ1

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otj100
1M1K1 3G711 3CC2Z 1Q812 1YI2Z 1YIT1 3CCR1 3CCE1 1NJI2 1KD11 1YJN1 1YJ9Z 3CC21 1YI21 1VQ71 1YJW1 1VQ8Z 2QEX1 1QVGZ 3CC4Z 1S72Z 1QVGY 1KQSZ 3CCQZ 1KQSY 1YJ91 1VQK1 1K731 1VQ81 1Q811 1K9M2 3CCQ1 1YITZ 3CCRZ 1YJNZ 1VQ7Z 1YJWZ 1Q862 2QEXZ 2QA4Z 3G6E1 3CME1 1VQKZ 1Q821 2QA41 3G4SZ 1K8A2 1W2BZ 1KC82 1W2BY 3I551 1VQN1 3G4S1 1Q861 1VQ4Z 3OW2Z 1YHQZ 1M902 3G6EZ 3OW2Y 3CCM1 1NJI1 1VQ51 3CMEZ 3CD61 3CPWZ 1VQO1 3CPWY 2OTL1 1VQ41 1YHQ1 1K8A1 1KC81 3CC7Z 3I55Z 1KD12 1VQ61 1N8R2 3I56Z 1K9M1 2OTJZ 1Q7Y2 3CC71 1M901 3CCMZ 1VQL1 1VQ5Z 1VQ91 1JJ2Z 3CD6Z 1VQOZ 3I561 1YIJ1 3CCS1 1JJ2Y 3CMAZ 3CXCZ 2OTLZ 2OTJ1 3CXCY 1VQM1 3CCVZ 3CCLZ 3CCJ1 3CCU1 3CCJZ 1VQPZ 1M1K2 3CMA1 1VQ6Z 3CCV1 1N8R1 1QVFZ 3CCL1 1QVFY 1Q7Y1 1VQP1 1VQLZ 1VQNZ 1VQ9Z 1Q822 3CCSZ 1YIJZ 3G71Z 3CC41 1S721 1VQMZ 3CCEZ 3CCUZ 1K732
chains in the Genus database with same CATH superfamily
2E9HA 2VPYA 1WCMI 3G711 2K3RA 3CC2Z 2QKDA 2B63I 3S2HI 4E30A 4NBCA 2ZAEB 1KD11 1RNIA 3S16I 3CC21 3QWUA 2QEX1 1QVGZ 3CC4Z 1S72Z 3J80f 2LEXA 3CCQZ 1KQSY 2J6AA 3CCQ1 1YITZ 2W04A 1RLYA 4E33A 2NVYI 4Y7NI 2OOXB 1Q862 3S1QI 4S1TA 3D6WA 3HOXI 2JS4A 3GKQA 2VPWA 3CME1 2BJOA 3H0GI 4A3EI 1VQKZ 3T4NB 5T6BA 1Q821 2VF1A 2V8IA 4RV9A 3D2LA 5T64A 3NH4A 3HKZA 1W2BY 4E31A 2IV2X 3CCM1 1Q16A 2VPXA 4MRIA 3CD61 2DE6A 4NB9A 2OTL1 4DGLA 1PFTA 3I55Z 1NUIA 4A3II 3HOWI 1DL6A 4NBHA 2QR1B 3VMHA 2GTHA 2JA5I 2HF1A 5D1OA 1R9TI 3CCS1 1JJ2Y 3CXCY 1ML8A 1Y1VS 3CCU1 2R93I 4AYBA 5A2Qf 2I3CA 3S1MI 3PO3I 1QVFY 2E2HI 5C4XI 4MD9A 3ESWA 1SFOI 3HOZI 1VQ9Z 3Q87A 1TWGI 4HH4A 3CCEZ 5FLXf 2DE7A 1Z01A 4HGZA 1YI2Z 3GTKI 3CCR1 3CCE1 4MXUA 5LL6f 4A3DI 1YJ9Z 3GTMS 3GTOI 3J81b 1YI21 5C4JI 1YJW1 3HOYI 1WW9A 2Q51A 2KPIA 1QVGY 4BXXI 2RIQA 4QTTA 1RO2A 1YJ91 2OOYB 5IP9I 2O53A 3I07A 3U50C 3F3PC 3JAMb 1K9M2 1TWCI 2NVXI 3VMGA 4CL1A 2AYDA 3EEDA 2QEXZ 4RVGA 3G6E1 3BG1B 2G2KA 2R92I 4E2WA 4DQYB 2JIRA 2VUGA 4Y52I 4E2ZA 4XX2A 4NBDA 4E32A 3MONA 3OW2Z 4RVFA 2JIQA 3S1NI 1VQ51 3CMEZ 2JR6A 2NVQI 5IT9b 1K8A1 3CQZI 2PMZA 4NOZA 1TFIA 3HOVI 1L1OC 2VUMI 2RHBA 2W03A 3HOUI 1K9M1 1N2FA 2QLVB 1M901 1S7MA 3CCMZ 3J7A4 4A3BI 1VQL1 3M4OI 3CD6Z 2NAPA 1I50I 1YIJ1 2OTLZ 3CMAZ 2E2JI 3D9XA 1TWAI 1VQM1 4MD8A 3CCLZ 5AN9F 1YUKA 3CCJ1 5IP7I 1KRLA 3JAMf 2O4HA 3CMA1 3IX0A 1ZH1A 1N8R1 3S2DI 3CCL1 2YU9I 5T67A 5C3EI 3S15I 2JA6I 3S17I 2Q4ZA 4NFRA 3CCSZ 1JWHC 2RT9A 4X6AI 3CCUZ 3MZLB 1P9NA 1M1K1 1TWHI 2JMOA 3RZDI 1Y1WI 4NBBA 1NJI2 1TWFI 1YJN1 1VQ71 1USPA 3TDHB 3FQQA 2OZKA 3GTJI 1Y1VI 4BBRI 1X3ZA 2IZ4A 1I6HI 1K731 5C44I 3GTPI 2JIMA 1Q811 4QTUA 3CCRZ 4BY7I 4RVHA 2RPRA 2E7ZA 2QREB 3J80b 1YJWZ 4A93I 3KIHA 3EERA 3TE5B 3FKII 2PM9A 3LUSA 3IF8A 4A3KI 2V45A 2JIPA 1K8A2 3P5JB 4A3CI 1RQFA 2F4OA 3NFZA 1NP6A 4NBEA 3GTMI 3KIFA 4RS4A 4TNUA 2E2II 2QRDB 4NBAA 1YHQZ 1M902 3G6EZ 3OW2Y 1NJI1 3NDJA 3CPWZ 1VQO1 2GU2A 5FLMI 3GTGI 3F3FC 1YHQ1 5D1OB 1YUAA 3GTLI 3I4MI 1KC81 2H85A 4BY1I 2YADA 1VQ61 2V3VA 2P3YA 1N8R2 1QYPA 2OTJZ 5D1PA 1VQ5Z 3RZOI 4A3LI 2OTJ1 3FQMA 1QXFA 2JUBA 1VQPZ 2LFUA 1M1K2 4A3FI 1FDOA 1Q7Y1 2NVTI 1VQP1 2LIYA 3IR7A 4NBFA 5CM2M 1VQLZ 2WAQA 1YIJZ 3NH5A 3CC41 4RVDA 1X0TA 1S721 3J81f 1VQMZ 4NBGA 4A3MI 4DK1A 3CCJZ 5A2Qb 1K732 4MONA 1Q812 2KI7B 3VB9A 3GCFA 3VTNA 1YIT1 4A3JI 2R7ZI 4E2XA 2JIOA 1FDIA 1WJ2A 1VQ8Z 2DE5A 5FLXb 1Z02A 4MH4A 1KQSZ 1I3QI 1VQK1 1SIWA 2PK7A 1VQ81 4MD7A 3S14I 2F4MA 3M3YI 3IFUA 2Y0SA 2V8KA 1YJNZ 1VQ7Z 4BBSI 2QA4Z 1Z03A 4EWCA 1ZB9A 3H3VJ 2JA7I 5IT9f 2QA41 3G4SZ 2V8JA 1RO0A 1W2BZ 1KC82 3I551 1X3WA 3G4S1 1VLAA 1Y8CA 1Q861 1VQ4Z 3PO3S 2WB1A 1LQLA 1AA6A 2M48A 3GTQI 2R6MA 3CPWY 1VQ41 4NH1C 2JA8I 2HU9A 2M6NA 2K5RA 3CC7Z 2P28A 2QRCB 3I4NI 3MZKB 4E2YA 1KD12 1RO4A 4A3GI 3I56Z 3NH8A 1WIIA 1Q7Y2 3CC71 3BG0B 3PO2I 1VQ91 1JJ2Z 3NDIA 1VQOZ 1ZB8A 3I561 3CXCZ 3CCVZ 3K7AI 3S1RI 2IZ3A 2RBLA 3VMIA 1VQ6Z 1WZNA 3CCV1 1QVFZ 4NB8A 1QF8A 2JNYA 1VQNZ 2GTIA 1Q822 1K83I 3G71Z 2VPZA 4HGYA 1USPB 2EGTA 1VQN1 2AKLA
chains in the Genus database with same CATH topology
2E9HA 1WCMI 3G711 2K3RA 3CC2Z 2QKDA 2B63I 3S2HI 4E30A 4NBCA 2ZAEB 1KD11 1RNIA 3S16I 3CC21 3QWUA 2QEX1 1QVGZ 3CC4Z 1S72Z 3J80f 3CCQZ 1KQSY 2J6AA 3CCQ1 1YITZ 2W04A 1RLYA 4E33A 2NVYI 4Y7NI 2OOXB 1Q862 3S1QI 4S1TA 3D6WA 3HOXI 2JS4A 3GKQA 3CME1 2BJOA 3H0GI 4A3EI 1VQKZ 3T4NB 5T6BA 1Q821 2VF1A 2V8IA 4RV9A 5T64A 3NH4A 3HKZA 1W2BY 4E31A 3CCM1 4MRIA 3CD61 2DE6A 4NB9A 2OTL1 4DGLA 1PFTA 3I55Z 1NUIA 4A3II 3HOWI 1DL6A 4NBHA 2QR1B 3VMHA 2GTHA 2JA5I 2HF1A 5D1OA 1R9TI 3CCS1 1JJ2Y 3CXCY 1ML8A 1Y1VS 3CCU1 2R93I 4AYBA 5A2Qf 2I3CA 3S1MI 3PO3I 1QVFY 2E2HI 5C4XI 4MD9A 3ESWA 1SFOI 3HOZI 1VQ9Z 3Q87A 1TWGI 4HH4A 3CCEZ 5FLXf 2DE7A 1Z01A 4HGZA 1YI2Z 3GTKI 3CCR1 3CCE1 4MXUA 5LL6f 4A3DI 1YJ9Z 3GTMS 3GTOI 3J81b 1YI21 5C4JI 1YJW1 3HOYI 1WW9A 2Q51A 2KPIA 1QVGY 4BXXI 2RIQA 4QTTA 1RO2A 1YJ91 2OOYB 5IP9I 2O53A 3I07A 3U50C 3F3PC 3JAMb 1K9M2 1TWCI 2NVXI 3VMGA 4CL1A 3EEDA 2QEXZ 4RVGA 3G6E1 3BG1B 2G2KA 2R92I 4E2WA 4DQYB 2VUGA 4Y52I 4E2ZA 4XX2A 4NBDA 4E32A 3MONA 3OW2Z 4RVFA 3S1NI 1VQ51 3CMEZ 2JR6A 2NVQI 5IT9b 1K8A1 3CQZI 2PMZA 4NOZA 1TFIA 3HOVI 1L1OC 2VUMI 2RHBA 2W03A 3HOUI 1K9M1 1N2FA 2QLVB 1M901 1S7MA 3CCMZ 3J7A4 4A3BI 1VQL1 3M4OI 3CD6Z 1I50I 1YIJ1 2OTLZ 3CMAZ 2E2JI 3D9XA 1TWAI 1VQM1 4MD8A 3CCLZ 5AN9F 1YUKA 3CCJ1 5IP7I 1KRLA 3JAMf 2O4HA 3CMA1 3IX0A 1ZH1A 1N8R1 3S2DI 3CCL1 2YU9I 5T67A 5C3EI 3S15I 2JA6I 3S17I 2Q4ZA 4NFRA 3CCSZ 1JWHC 2RT9A 4X6AI 3CCUZ 3MZLB 1P9NA 1M1K1 1TWHI 2JMOA 3RZDI 1Y1WI 4NBBA 1NJI2 1TWFI 1YJN1 1VQ71 1USPA 3TDHB 3FQQA 2OZKA 3GTJI 1Y1VI 4BBRI 1X3ZA 2IZ4A 1I6HI 1K731 5C44I 3GTPI 1Q811 4QTUA 3CCRZ 4BY7I 4RVHA 2RPRA 2QREB 3J80b 1YJWZ 4A93I 3KIHA 3EERA 3TE5B 3FKII 2PM9A 3LUSA 3IF8A 4A3KI 1K8A2 3P5JB 4A3CI 1RQFA 2F4OA 3NFZA 1NP6A 4NBEA 3GTMI 3KIFA 4RS4A 4TNUA 2E2II 2QRDB 4NBAA 1YHQZ 1M902 3G6EZ 3OW2Y 1NJI1 3NDJA 3CPWZ 1VQO1 2GU2A 5FLMI 3GTGI 3F3FC 1YHQ1 5D1OB 1YUAA 3GTLI 3I4MI 1KC81 2H85A 4BY1I 2YADA 1VQ61 2P3YA 1N8R2 1QYPA 2OTJZ 5D1PA 1VQ5Z 3RZOI 4A3LI 2OTJ1 3FQMA 2JUBA 1VQPZ 2LFUA 1M1K2 4A3FI 1Q7Y1 2NVTI 1VQP1 2LIYA 4NBFA 5CM2M 1VQLZ 2WAQA 1YIJZ 3NH5A 3CC41 4RVDA 1X0TA 1S721 3J81f 1VQMZ 4NBGA 4A3MI 4DK1A 3CCJZ 5A2Qb 1K732 4MONA 1Q812 2KI7B 3VB9A 3GCFA 3VTNA 1YIT1 4A3JI 2R7ZI 4E2XA 1VQ8Z 2DE5A 5FLXb 1Z02A 4MH4A 1KQSZ 1I3QI 1VQK1 2PK7A 1VQ81 4MD7A 3S14I 2F4MA 3M3YI 3IFUA 2Y0SA 2V8KA 1YJNZ 1VQ7Z 4BBSI 2QA4Z 1Z03A 4EWCA 1ZB9A 3H3VJ 2JA7I 5IT9f 2QA41 3G4SZ 2V8JA 1RO0A 1W2BZ 1KC82 3I551 1X3WA 3G4S1 1VLAA 1Q861 1VQ4Z 3PO3S 2WB1A 1LQLA 2M48A 3GTQI 2R6MA 3CPWY 1VQ41 4NH1C 2JA8I 2HU9A 2M6NA 2K5RA 3CC7Z 2P28A 2QRCB 3I4NI 3MZKB 4E2YA 1KD12 1RO4A 4A3GI 3I56Z 3NH8A 1WIIA 1Q7Y2 3CC71 3BG0B 3PO2I 1VQ91 1JJ2Z 3NDIA 1VQOZ 1ZB8A 3I561 3CXCZ 3CCVZ 3K7AI 3S1RI 2IZ3A 2RBLA 3VMIA 1VQ6Z 3CCV1 1QVFZ 4NB8A 1QF8A 2JNYA 1VQNZ 2GTIA 1Q822 1K83I 3G71Z 4HGYA 1USPB 2EGTA 1VQN1 2AKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 1;  3G71 1;  3CC2 Z;  1Q81 2;  1YI2 Z;  1YIT 1;  3CCR 1;  3CCE 1;  1NJI 2;  1KD1 1;  1YJN 1;  1YJ9 Z;  3CC2 1;  1YI2 1;  1VQ7 1;  1YJW 1;  1VQ8 Z;  2QEX 1;  1QVG Z;  3CC4 Z;  1S72 Z;  1QVG Y;  1KQS Z;  3CCQ Z;  1KQS Y;  1YJ9 1;  1VQK 1;  1K73 1;  1VQ8 1;  1Q81 1;  1K9M 2;  3CCQ 1;  1YIT Z;  3CCR Z;  1YJN Z;  1VQ7 Z;  1YJW Z;  1Q86 2;  2QEX Z;  2QA4 Z;  3G6E 1;  3CME 1;  1VQK Z;  1Q82 1;  2QA4 1;  3G4S Z;  1K8A 2;  1W2B Z;  1KC8 2;  1W2B Y;  3I55 1;  1VQN 1;  3G4S 1;  1Q86 1;  1VQ4 Z;  3OW2 Z;  1YHQ Z;  1M90 2;  3G6E Z;  3OW2 Y;  3CCM 1;  1NJI 1;  1VQ5 1;  3CME Z;  3CD6 1;  3CPW Z;  1VQO 1;  3CPW Y;  2OTL 1;  1VQ4 1;  1YHQ 1;  1K8A 1;  1KC8 1;  3CC7 Z;  3I55 Z;  1KD1 2;  1VQ6 1;  1N8R 2;  3I56 Z;  1K9M 1;  2OTJ Z;  1Q7Y 2;  3CC7 1;  1M90 1;  3CCM Z;  1VQL 1;  1VQ5 Z;  1VQ9 1;  1JJ2 Z;  3CD6 Z;  1VQO Z;  3I56 1;  1YIJ 1;  3CCS 1;  1JJ2 Y;  3CMA Z;  3CXC Z;  2OTL Z;  2OTJ 1;  3CXC Y;  1VQM 1;  3CCV Z;  3CCL Z;  3CCJ 1;  3CCU 1;  3CCJ Z;  1VQP Z;  1M1K 2;  3CMA 1;  1VQ6 Z;  3CCV 1;  1N8R 1;  1QVF Z;  3CCL 1;  1QVF Y;  1Q7Y 1;  1VQP 1;  1VQL Z;  1VQN Z;  1VQ9 Z;  1Q82 2;  3CCS Z;  1YIJ Z;  3G71 Z;  3CC4 1;  1S72 1;  1VQM Z;  3CCE Z;  3CCU Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 2E9H A;  2VPY A;  1WCM I;  3G71 1;  2K3R A;  3CC2 Z;  2QKD A;  2B63 I;  3S2H I;  4E30 A;  4NBC A;  2ZAE B;  1KD1 1;  1RNI A;  3S16 I;  3CC2 1;  3QWU A;  2QEX 1;  1QVG Z;  3CC4 Z;  1S72 Z;  3J80 f;  2LEX A;  3CCQ Z;  1KQS Y;  2J6A A;  3CCQ 1;  1YIT Z;  2W04 A;  1RLY A;  4E33 A;  2NVY I;  4Y7N I;  2OOX B;  1Q86 2;  3S1Q I;  4S1T A;  3D6W A;  3HOX I;  2JS4 A;  3GKQ A;  2VPW A;  3CME 1;  2BJO A;  3H0G I;  4A3E I;  1VQK Z;  3T4N B;  5T6B A;  1Q82 1;  2VF1 A;  2V8I A;  4RV9 A;  3D2L A;  5T64 A;  3NH4 A;  3HKZ A;  1W2B Y;  4E31 A;  2IV2 X;  3CCM 1;  1Q16 A;  2VPX A;  4MRI A;  3CD6 1;  2DE6 A;  4NB9 A;  2OTL 1;  4DGL A;  1PFT A;  3I55 Z;  1NUI A;  4A3I I;  3HOW I;  1DL6 A;  4NBH A;  2QR1 B;  3VMH A;  2GTH A;  2JA5 I;  2HF1 A;  5D1O A;  1R9T I;  3CCS 1;  1JJ2 Y;  3CXC Y;  1ML8 A;  1Y1V S;  3CCU 1;  2R93 I;  4AYB A;  5A2Q f;  2I3C A;  3S1M I;  3PO3 I;  1QVF Y;  2E2H I;  5C4X I;  4MD9 A;  3ESW A;  1SFO I;  3HOZ I;  1VQ9 Z;  3Q87 A;  1TWG I;  4HH4 A;  3CCE Z;  5FLX f;  2DE7 A;  1Z01 A;  4HGZ A;  1YI2 Z;  3GTK I;  3CCR 1;  3CCE 1;  4MXU A;  5LL6 f;  4A3D I;  1YJ9 Z;  3GTM S;  3GTO I;  3J81 b;  1YI2 1;  5C4J I;  1YJW 1;  3HOY I;  1WW9 A;  2Q51 A;  2KPI A;  1QVG Y;  4BXX I;  2RIQ A;  4QTT A;  1RO2 A;  1YJ9 1;  2OOY B;  5IP9 I;  2O53 A;  3I07 A;  3U50 C;  3F3P C;  3JAM b;  1K9M 2;  1TWC I;  2NVX I;  3VMG A;  4CL1 A;  2AYD A;  3EED A;  2QEX Z;  4RVG A;  3G6E 1;  3BG1 B;  2G2K A;  2R92 I;  4E2W A;  4DQY B;  2JIR A;  2VUG A;  4Y52 I;  4E2Z A;  4XX2 A;  4NBD A;  4E32 A;  3MON A;  3OW2 Z;  4RVF A;  2JIQ A;  3S1N I;  1VQ5 1;  3CME Z;  2JR6 A;  2NVQ I;  5IT9 b;  1K8A 1;  3CQZ I;  2PMZ A;  4NOZ A;  1TFI A;  3HOV I;  1L1O C;  2VUM I;  2RHB A;  2W03 A;  3HOU I;  1K9M 1;  1N2F A;  2QLV B;  1M90 1;  1S7M A;  3CCM Z;  3J7A 4;  4A3B I;  1VQL 1;  3M4O I;  3CD6 Z;  2NAP A;  1I50 I;  1YIJ 1;  2OTL Z;  3CMA Z;  2E2J I;  3D9X A;  1TWA I;  1VQM 1;  4MD8 A;  3CCL Z;  5AN9 F;  1YUK A;  3CCJ 1;  5IP7 I;  1KRL A;  3JAM f;  2O4H A;  3CMA 1;  3IX0 A;  1ZH1 A;  1N8R 1;  3S2D I;  3CCL 1;  2YU9 I;  5T67 A;  5C3E I;  3S15 I;  2JA6 I;  3S17 I;  2Q4Z A;  4NFR A;  3CCS Z;  1JWH C;  2RT9 A;  4X6A I;  3CCU Z;  3MZL B;  1P9N A;  1M1K 1;  1TWH I;  2JMO A;  3RZD I;  1Y1W I;  4NBB A;  1NJI 2;  1TWF I;  1YJN 1;  1VQ7 1;  1USP A;  3TDH B;  3FQQ A;  2OZK A;  3GTJ I;  1Y1V I;  4BBR I;  1X3Z A;  2IZ4 A;  1I6H I;  1K73 1;  5C44 I;  3GTP I;  2JIM A;  1Q81 1;  4QTU A;  3CCR Z;  4BY7 I;  4RVH A;  2RPR A;  2E7Z A;  2QRE B;  3J80 b;  1YJW Z;  4A93 I;  3KIH A;  3EER A;  3TE5 B;  3FKI I;  2PM9 A;  3LUS A;  3IF8 A;  4A3K I;  2V45 A;  2JIP A;  1K8A 2;  3P5J B;  4A3C I;  1RQF A;  2F4O A;  3NFZ A;  1NP6 A;  4NBE A;  3GTM I;  3KIF A;  4RS4 A;  4TNU A;  2E2I I;  2QRD B;  4NBA A;  1YHQ Z;  1M90 2;  3G6E Z;  3OW2 Y;  1NJI 1;  3NDJ A;  3CPW Z;  1VQO 1;  2GU2 A;  5FLM I;  3GTG I;  3F3F C;  1YHQ 1;  5D1O B;  1YUA A;  3GTL I;  3I4M I;  1KC8 1;  2H85 A;  4BY1 I;  2YAD A;  1VQ6 1;  2V3V A;  2P3Y A;  1N8R 2;  1QYP A;  2OTJ Z;  5D1P A;  1VQ5 Z;  3RZO I;  4A3L I;  2OTJ 1;  3FQM A;  1QXF A;  2JUB A;  1VQP Z;  2LFU A;  1M1K 2;  4A3F I;  1FDO A;  1Q7Y 1;  2NVT I;  1VQP 1;  2LIY A;  3IR7 A;  4NBF A;  5CM2 M;  1VQL Z;  2WAQ A;  1YIJ Z;  3NH5 A;  3CC4 1;  4RVD A;  1X0T A;  1S72 1;  3J81 f;  1VQM Z;  4NBG A;  4A3M I;  4DK1 A;  3CCJ Z;  5A2Q b;  1K73 2;  4MON A;  1Q81 2;  2KI7 B;  3VB9 A;  3GCF A;  3VTN A;  1YIT 1;  4A3J I;  2R7Z I;  4E2X A;  2JIO A;  1FDI A;  1WJ2 A;  1VQ8 Z;  2DE5 A;  5FLX b;  1Z02 A;  4MH4 A;  1KQS Z;  1I3Q I;  1VQK 1;  1SIW A;  2PK7 A;  1VQ8 1;  4MD7 A;  3S14 I;  2F4M A;  3M3Y I;  3IFU A;  2Y0S A;  2V8K A;  1YJN Z;  1VQ7 Z;  4BBS I;  2QA4 Z;  1Z03 A;  4EWC A;  1ZB9 A;  3H3V J;  2JA7 I;  5IT9 f;  2QA4 1;  3G4S Z;  2V8J A;  1RO0 A;  1W2B Z;  1KC8 2;  3I55 1;  1X3W A;  3G4S 1;  1VLA A;  1Y8C A;  1Q86 1;  1VQ4 Z;  3PO3 S;  2WB1 A;  1LQL A;  1AA6 A;  2M48 A;  3GTQ I;  2R6M A;  3CPW Y;  1VQ4 1;  4NH1 C;  2JA8 I;  2HU9 A;  2M6N A;  2K5R A;  3CC7 Z;  2P28 A;  2QRC B;  3I4N I;  3MZK B;  4E2Y A;  1KD1 2;  1RO4 A;  4A3G I;  3I56 Z;  3NH8 A;  1WII A;  1Q7Y 2;  3CC7 1;  3BG0 B;  3PO2 I;  1VQ9 1;  1JJ2 Z;  3NDI A;  1VQO Z;  1ZB8 A;  3I56 1;  3CXC Z;  3CCV Z;  3K7A I;  3S1R I;  2IZ3 A;  2RBL A;  3VMI A;  1VQ6 Z;  1WZN A;  3CCV 1;  1QVF Z;  4NB8 A;  1QF8 A;  2JNY A;  1VQN Z;  2GTI A;  1Q82 2;  1K83 I;  3G71 Z;  2VPZ A;  4HGY A;  1USP B;  2EGT A;  1VQN 1;  2AKL A; 
#chains in the Genus database with same CATH homology
 2E9H A;  1WCM I;  3G71 1;  2K3R A;  3CC2 Z;  2QKD A;  2B63 I;  3S2H I;  4E30 A;  4NBC A;  2ZAE B;  1KD1 1;  1RNI A;  3S16 I;  3CC2 1;  3QWU A;  2QEX 1;  1QVG Z;  3CC4 Z;  1S72 Z;  3J80 f;  3CCQ Z;  1KQS Y;  2J6A A;  3CCQ 1;  1YIT Z;  2W04 A;  1RLY A;  4E33 A;  2NVY I;  4Y7N I;  2OOX B;  1Q86 2;  3S1Q I;  4S1T A;  3D6W A;  3HOX I;  2JS4 A;  3GKQ A;  3CME 1;  2BJO A;  3H0G I;  4A3E I;  1VQK Z;  3T4N B;  5T6B A;  1Q82 1;  2VF1 A;  2V8I A;  4RV9 A;  5T64 A;  3NH4 A;  3HKZ A;  1W2B Y;  4E31 A;  3CCM 1;  4MRI A;  3CD6 1;  2DE6 A;  4NB9 A;  2OTL 1;  4DGL A;  1PFT A;  3I55 Z;  1NUI A;  4A3I I;  3HOW I;  1DL6 A;  4NBH A;  2QR1 B;  3VMH A;  2GTH A;  2JA5 I;  2HF1 A;  5D1O A;  1R9T I;  3CCS 1;  1JJ2 Y;  3CXC Y;  1ML8 A;  1Y1V S;  3CCU 1;  2R93 I;  4AYB A;  5A2Q f;  2I3C A;  3S1M I;  3PO3 I;  1QVF Y;  2E2H I;  5C4X I;  4MD9 A;  3ESW A;  1SFO I;  3HOZ I;  1VQ9 Z;  3Q87 A;  1TWG I;  4HH4 A;  3CCE Z;  5FLX f;  2DE7 A;  1Z01 A;  4HGZ A;  1YI2 Z;  3GTK I;  3CCR 1;  3CCE 1;  4MXU A;  5LL6 f;  4A3D I;  1YJ9 Z;  3GTM S;  3GTO I;  3J81 b;  1YI2 1;  5C4J I;  1YJW 1;  3HOY I;  1WW9 A;  2Q51 A;  2KPI A;  1QVG Y;  4BXX I;  2RIQ A;  4QTT A;  1RO2 A;  1YJ9 1;  2OOY B;  5IP9 I;  2O53 A;  3I07 A;  3U50 C;  3F3P C;  3JAM b;  1K9M 2;  1TWC I;  2NVX I;  3VMG A;  4CL1 A;  3EED A;  2QEX Z;  4RVG A;  3G6E 1;  3BG1 B;  2G2K A;  2R92 I;  4E2W A;  4DQY B;  2VUG A;  4Y52 I;  4E2Z A;  4XX2 A;  4NBD A;  4E32 A;  3MON A;  3OW2 Z;  4RVF A;  3S1N I;  1VQ5 1;  3CME Z;  2JR6 A;  2NVQ I;  5IT9 b;  1K8A 1;  3CQZ I;  2PMZ A;  4NOZ A;  1TFI A;  3HOV I;  1L1O C;  2VUM I;  2RHB A;  2W03 A;  3HOU I;  1K9M 1;  1N2F A;  2QLV B;  1M90 1;  1S7M A;  3CCM Z;  3J7A 4;  4A3B I;  1VQL 1;  3M4O I;  3CD6 Z;  1I50 I;  1YIJ 1;  2OTL Z;  3CMA Z;  2E2J I;  3D9X A;  1TWA I;  1VQM 1;  4MD8 A;  3CCL Z;  5AN9 F;  1YUK A;  3CCJ 1;  5IP7 I;  1KRL A;  3JAM f;  2O4H A;  3CMA 1;  3IX0 A;  1ZH1 A;  1N8R 1;  3S2D I;  3CCL 1;  2YU9 I;  5T67 A;  5C3E I;  3S15 I;  2JA6 I;  3S17 I;  2Q4Z A;  4NFR A;  3CCS Z;  1JWH C;  2RT9 A;  4X6A I;  3CCU Z;  3MZL B;  1P9N A;  1M1K 1;  1TWH I;  2JMO A;  3RZD I;  1Y1W I;  4NBB A;  1NJI 2;  1TWF I;  1YJN 1;  1VQ7 1;  1USP A;  3TDH B;  3FQQ A;  2OZK A;  3GTJ I;  1Y1V I;  4BBR I;  1X3Z A;  2IZ4 A;  1I6H I;  1K73 1;  5C44 I;  3GTP I;  1Q81 1;  4QTU A;  3CCR Z;  4BY7 I;  4RVH A;  2RPR A;  2QRE B;  3J80 b;  1YJW Z;  4A93 I;  3KIH A;  3EER A;  3TE5 B;  3FKI I;  2PM9 A;  3LUS A;  3IF8 A;  4A3K I;  1K8A 2;  3P5J B;  4A3C I;  1RQF A;  2F4O A;  3NFZ A;  1NP6 A;  4NBE A;  3GTM I;  3KIF A;  4RS4 A;  4TNU A;  2E2I I;  2QRD B;  4NBA A;  1YHQ Z;  1M90 2;  3G6E Z;  3OW2 Y;  1NJI 1;  3NDJ A;  3CPW Z;  1VQO 1;  2GU2 A;  5FLM I;  3GTG I;  3F3F C;  1YHQ 1;  5D1O B;  1YUA A;  3GTL I;  3I4M I;  1KC8 1;  2H85 A;  4BY1 I;  2YAD A;  1VQ6 1;  2P3Y A;  1N8R 2;  1QYP A;  2OTJ Z;  5D1P A;  1VQ5 Z;  3RZO I;  4A3L I;  2OTJ 1;  3FQM A;  2JUB A;  1VQP Z;  2LFU A;  1M1K 2;  4A3F I;  1Q7Y 1;  2NVT I;  1VQP 1;  2LIY A;  4NBF A;  5CM2 M;  1VQL Z;  2WAQ A;  1YIJ Z;  3NH5 A;  3CC4 1;  4RVD A;  1X0T A;  1S72 1;  3J81 f;  1VQM Z;  4NBG A;  4A3M I;  4DK1 A;  3CCJ Z;  5A2Q b;  1K73 2;  4MON A;  1Q81 2;  2KI7 B;  3VB9 A;  3GCF A;  3VTN A;  1YIT 1;  4A3J I;  2R7Z I;  4E2X A;  1VQ8 Z;  2DE5 A;  5FLX b;  1Z02 A;  4MH4 A;  1KQS Z;  1I3Q I;  1VQK 1;  2PK7 A;  1VQ8 1;  4MD7 A;  3S14 I;  2F4M A;  3M3Y I;  3IFU A;  2Y0S A;  2V8K A;  1YJN Z;  1VQ7 Z;  4BBS I;  2QA4 Z;  1Z03 A;  4EWC A;  1ZB9 A;  3H3V J;  2JA7 I;  5IT9 f;  2QA4 1;  3G4S Z;  2V8J A;  1RO0 A;  1W2B Z;  1KC8 2;  3I55 1;  1X3W A;  3G4S 1;  1VLA A;  1Q86 1;  1VQ4 Z;  3PO3 S;  2WB1 A;  1LQL A;  2M48 A;  3GTQ I;  2R6M A;  3CPW Y;  1VQ4 1;  4NH1 C;  2JA8 I;  2HU9 A;  2M6N A;  2K5R A;  3CC7 Z;  2P28 A;  2QRC B;  3I4N I;  3MZK B;  4E2Y A;  1KD1 2;  1RO4 A;  4A3G I;  3I56 Z;  3NH8 A;  1WII A;  1Q7Y 2;  3CC7 1;  3BG0 B;  3PO2 I;  1VQ9 1;  1JJ2 Z;  3NDI A;  1VQO Z;  1ZB8 A;  3I56 1;  3CXC Z;  3CCV Z;  3K7A I;  3S1R I;  2IZ3 A;  2RBL A;  3VMI A;  1VQ6 Z;  3CCV 1;  1QVF Z;  4NB8 A;  1QF8 A;  2JNY A;  1VQN Z;  2GTI A;  1Q82 2;  1K83 I;  3G71 Z;  4HGY A;  1USP B;  2EGT A;  1VQN 1;  2AKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...