2OTJ1

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otj100
2QEXZ 2OTJ1 3CCR1 1VQK1 1QVGY 1W2BZ 1Q811 1VQOZ 1VQ9Z 3CPWZ 1VQKZ 3CCUZ 3CCRZ 3G71Z 3G711 2QEX1 3CCU1 1VQ91 1VQO1 1Q7Y1 1K731 1YJ9Z 1KQSZ 1YJWZ 2OTJZ 3CCQ1 1YIT1 3CC4Z 1YHQ1 3OW2Z 1VQN1 1VQ41 1VQ7Z 3CCVZ 3CMAZ 1KC81 3CCSZ 1S721 2QA41 1Q812 3CCJZ 1KD12 1M1K2 3OW2Y 3G4SZ 2OTLZ 1VQPZ 3CC2Z 1M1K1 1VQM1 1YI21 1VQL1 3I55Z 1VQ81 3CCMZ 3CCEZ 3CCL1 1Q861 3CMEZ 3CD6Z 3I56Z 1Q822 1KD11 1YJNZ 1VQ6Z 1VQ51 1K8A1 1JJ2Y 1KQSY 3CC7Z 3CC71 1N8R1 3G6E1 1W2BY 1K9M2 1VQ61 1YIJ1 3CXCY 3I561 1YIJZ 3CME1 1K9M1 3CD61 3G6EZ 1QVFY 1VQ5Z 1YJN1 3CCM1 1VQ8Z 1VQLZ 1YI2Z 1VQMZ 3CXCZ 1K732 1VQP1 3CCLZ 1Q862 3CCE1 3I551 1S72Z 3CCS1 1NJI2 3CMA1 1Q7Y2 1K8A2 1JJ2Z 3CC21 3G4S1 2OTL1 1NJI1 1KC82 3CCJ1 2QA4Z 3CCQZ 1YITZ 1N8R2 1M902 3CPWY 3CCV1 1Q821 1QVGZ 1YJW1 1YJ91 1VQ71 1M901 1VQ4Z 1QVFZ 1VQNZ 1YHQZ 3CC41
chains in the Genus database with same CATH superfamily
2H85A 3H3VJ 3J81f 3S16I 4MXUA 3KIFA 2VF1A 1QXFA 2JMOA 2JNYA 2LEXA 2WAQA 3G711 3CCU1 3HOUI 1Q7Y1 3FKII 4DGLA 1Y1WI 1KQSZ 2PM9A 3CC4Z 2JIPA 1Z01A 1YHQ1 1I50I 1VQN1 1VQ7Z 4RS4A 2KI7B 3CCVZ 1KC81 3CCSZ 5LL6f 3CCJZ 4RV9A 1KD12 1NP6A 3MZLB 3ESWA 2OTLZ 1VQPZ 1M1K1 3GTGI 3NH4A 3HOXI 4AYBA 3CCEZ 1TWGI 4MD8A 3CCL1 1X0TA 1Q861 2QLVB 3I56Z 1KD11 2W03A 3IFUA 2VPXA 2V8KA 2M6NA 3G6E1 4RVDA 1K9M2 2Q51A 2O4HA 3Q87A 3FQQA 3S2DI 1PFTA 1Z03A 2NVYI 3VMHA 3CD61 1K9M1 2YADA 5D1OB 1QVFY 2EGTA 2OZKA 5C44I 1YJN1 1VQLZ 1VQMZ 3CCLZ 2R92I 3S17I 2NVXI 3JAMf 4Y52I 4BY1I 5D1PA 3D2LA 1Q7Y2 3QWUA 1JJ2Z 4NBHA 4HGYA 2OTL1 2ZAEB 3J80f 1KC82 3MONA 4E30A 1N2FA 1N8R2 2JA7I 3CCV1 3H0GI 4BBRI 2V8IA 1YJ91 1VQ71 1M901 1VQ4Z 1RO0A 2KPIA 3S14I 1TWCI 5CM2M 4E33A 3GTMS 4RVHA 2OTJ1 5T64A 3CCR1 1VQK1 4QTUA 1X3ZA 5A2Qb 1FDOA 2E2II 1VQKZ 3CCRZ 3G71Z 4DQYB 3HOYI 3FQMA 4MONA 3KIHA 2IZ4A 4BXXI 1QYPA 2VPWA 1ZH1A 1USPB 1L1OC 2NAPA 2JA8I 1SFOI 3GTJI 1WW9A 4A3II 3M3YI 2QA41 1Q812 2DE5A 4A93I 5C4JI 1TWFI 5IP9I 2B63I 4MD7A 3CC2Z 3T4NB 2GTIA 4NBCA 1VQL1 3GTKI 4TNUA 3I55Z 4X6AI 1RLYA 2E2JI 3CD6Z 5C3EI 2VUGA 4E2ZA 1VQ51 3GTQI 3P5JB 2JIQA 3CC71 3MZKB 4NB8A 4DK1A 3VMGA 3CME1 3VB9A 2RBLA 4RVGA 1ZB8A 2RPRA 4CL1A 2OOXB 1WCMI 4EWCA 1NUIA 4HGZA 3CXCZ 1AA6A 4E32A 2JA5I 1VQP1 4A3BI 2P3YA 1I6HI 3I551 2K3RA 1NJI2 3CCS1 3NDJA 2R93I 1K8A2 3JAMb 4NBGA 2RIQA 4A3LI 4E31A 2E9HA 1RQFA 3U50C 2QA4Z 4A3DI 3CCQZ 1TWAI 5IP7I 3LUSA 1QVFZ 2DE6A 3NH5A 5T67A 3GTOI 3GKQA 2M48A 5AN9F 3NFZA 1Q811 2PK7A 1VQOZ 1LQLA 2V8JA 3VTNA 3HOWI 1Z02A 2P28A 1DL6A 1VQ91 2AYDA 2E7ZA 4BBSI 3S15I 3I4MI 2OTJZ 1YUKA 1VLAA 3CCQ1 2I3CA 4Y7NI 3OW2Z 1P9NA 1VQ41 2Q4ZA 3S1QI 3IR7A 4E2YA 3IF8A 3CMAZ 2J6AA 1Q16A 2RT9A 3J81b 4NH1C 1X3WA 3OW2Y 3TDHB 4A3MI 4NOZA 2RHBA 3S1RI 1S7MA 3GTLI 3BG1B 1FDIA 1YI21 2JA6I 3CCMZ 2V3VA 3F3PC 3S2HI 3PO2I 3CMEZ 2NVTI 2GTHA 3HOZI 1YJNZ 1VQ6Z 2O53A 3D9XA 1K8A1 1KQSY 2IV2X 4NBFA 3CC7Z 4A3EI 1N8R1 1RO4A 1Y1VS 1RO2A 3NH8A 3EERA 3G6EZ 4A3KI 1VQ8Z 3I4NI 3K7AI 4RVFA 4NBAA 1K732 3CCE1 3S1MI 3VMIA 1USPA 1TWHI 1TFIA 1S72Z 5IT9f 2QRDB 5D1OA 4S1TA 2WB1A 2QRCB 5A2Qf 3CCJ1 1YITZ 5FLMI 1Y1VI 2R6MA 4QTTA 1QVGZ 4XX2A 1YJW1 1VQNZ 2HU9A 4A3GI 1YHQZ 5IT9b 2E2HI 3CC41 2NVQI 2QEXZ 5FLXf 2VPYA 3PO3I 1QVGY 1W2BZ 2W04A 5T6BA 1VQ9Z 2PMZA 3CPWZ 4BY7I 3CCUZ 2QEX1 2VUMI 3F3FC 1KRLA 2VPZA 4A3CI 1VQO1 1K731 2QKDA 1YJ9Z 3HKZA 1YJWZ 1RNIA 2IZ3A 1R9TI 1YIT1 2LIYA 2JS4A 4E2XA 3EEDA 4A3JI 3GCFA 1QF8A 2QREB 2GU2A 1ZB9A 1S721 4NBBA 3M4OI 2G2KA 1M1K2 4A3FI 1YUAA 3G4SZ 3PO3S 4NBDA 2V45A 3GTMI 3RZOI 1VQM1 3BG0B 3HOVI 1VQ81 4MD9A 3IX0A 4NBEA 2JIOA 1Q822 1ML8A 2JUBA 3CQZI 2QR1B 3I07A 1JJ2Y 4NB9A 1W2BY 4MH4A 1VQ61 1YIJ1 4NFRA 5FLXb 3CXCY 2AKLA 4E2WA 3I561 1YIJZ 1WJ2A 2JR6A 2YU9I 2K5RA 1VQ5Z 3CCM1 3J7A4 1SIWA 2OOYB 1YI2Z 2JIRA 3S1NI 1I3QI 2LFUA 1Q862 2DE7A 1K83I 3TE5B 3CMA1 1WZNA 3D6WA 3CC21 4HH4A 3G4S1 1NJI1 3RZDI 1WIIA 3NDIA 3GTPI 1Y8CA 2JIMA 3CPWY 1M902 2R7ZI 1JWHC 1Q821 2F4MA 3J80b 5C4XI 2Y0SA 2BJOA 2HF1A 4MRIA 2F4OA
chains in the Genus database with same CATH topology
2H85A 3H3VJ 3J81f 3S16I 4MXUA 3KIFA 2VF1A 2JMOA 2JNYA 2WAQA 3G711 3CCU1 3HOUI 1Q7Y1 3FKII 4DGLA 1Y1WI 1KQSZ 2PM9A 3CC4Z 1Z01A 1YHQ1 1I50I 1VQN1 1VQ7Z 4RS4A 2KI7B 3CCVZ 1KC81 3CCSZ 5LL6f 3CCJZ 4RV9A 1KD12 1NP6A 3MZLB 3ESWA 2OTLZ 1VQPZ 1M1K1 3GTGI 3NH4A 3HOXI 4AYBA 3CCEZ 1TWGI 4MD8A 3CCL1 1X0TA 1Q861 2QLVB 3I56Z 1KD11 2W03A 3IFUA 2V8KA 2M6NA 3G6E1 4RVDA 1K9M2 2Q51A 2O4HA 3Q87A 3FQQA 3S2DI 1PFTA 1Z03A 2NVYI 3VMHA 3CD61 1K9M1 2YADA 5D1OB 1QVFY 2EGTA 2OZKA 5C44I 1YJN1 1VQLZ 1VQMZ 3CCLZ 2R92I 3S17I 2NVXI 3JAMf 4Y52I 4BY1I 5D1PA 1Q7Y2 3QWUA 1JJ2Z 4NBHA 4HGYA 2OTL1 2ZAEB 3J80f 1KC82 3MONA 4E30A 1N2FA 1N8R2 2JA7I 3CCV1 3H0GI 4BBRI 2V8IA 1YJ91 1VQ71 1M901 1VQ4Z 1RO0A 2KPIA 3S14I 1TWCI 5CM2M 4E33A 3GTMS 4RVHA 2OTJ1 5T64A 3CCR1 1VQK1 4QTUA 1X3ZA 5A2Qb 2E2II 1VQKZ 3CCRZ 3G71Z 4DQYB 3HOYI 3FQMA 4MONA 3KIHA 2IZ4A 4BXXI 1QYPA 1ZH1A 1USPB 1L1OC 2JA8I 1SFOI 3GTJI 1WW9A 4A3II 3M3YI 2QA41 1Q812 2DE5A 4A93I 5C4JI 1TWFI 5IP9I 2B63I 4MD7A 3CC2Z 3T4NB 2GTIA 4NBCA 1VQL1 3GTKI 4TNUA 3I55Z 4X6AI 1RLYA 2E2JI 3CD6Z 5C3EI 2VUGA 4E2ZA 1VQ51 3GTQI 3P5JB 3CC71 3MZKB 4NB8A 4DK1A 3VMGA 3CME1 3VB9A 2RBLA 4RVGA 1ZB8A 2RPRA 4CL1A 2OOXB 1WCMI 4EWCA 1NUIA 4HGZA 3CXCZ 4E32A 2JA5I 1VQP1 4A3BI 2P3YA 1I6HI 3I551 2K3RA 1NJI2 3CCS1 3NDJA 2R93I 1K8A2 3JAMb 4NBGA 2RIQA 4A3LI 4E31A 2E9HA 1RQFA 3U50C 2QA4Z 4A3DI 3CCQZ 1TWAI 5IP7I 3LUSA 1QVFZ 2DE6A 3NH5A 5T67A 3GTOI 3GKQA 2M48A 5AN9F 3NFZA 1Q811 2PK7A 1VQOZ 1LQLA 2V8JA 3VTNA 3HOWI 1Z02A 2P28A 1DL6A 1VQ91 4BBSI 3S15I 3I4MI 2OTJZ 1YUKA 1VLAA 3CCQ1 2I3CA 4Y7NI 3OW2Z 1P9NA 1VQ41 2Q4ZA 3S1QI 4E2YA 3IF8A 3CMAZ 2J6AA 2RT9A 3J81b 4NH1C 1X3WA 3OW2Y 3TDHB 4A3MI 4NOZA 2RHBA 3S1RI 1S7MA 3GTLI 3BG1B 1YI21 2JA6I 3CCMZ 3F3PC 3S2HI 3PO2I 3CMEZ 2NVTI 2GTHA 3HOZI 1YJNZ 1VQ6Z 2O53A 3D9XA 1K8A1 1KQSY 4NBFA 3CC7Z 4A3EI 1N8R1 1RO4A 1Y1VS 1RO2A 3NH8A 3EERA 3G6EZ 4A3KI 1VQ8Z 3I4NI 3K7AI 4RVFA 4NBAA 1K732 3CCE1 3S1MI 3VMIA 1USPA 1TWHI 1TFIA 1S72Z 5IT9f 2QRDB 5D1OA 4S1TA 2WB1A 2QRCB 5A2Qf 3CCJ1 1YITZ 5FLMI 1Y1VI 2R6MA 4QTTA 1QVGZ 4XX2A 1YJW1 1VQNZ 2HU9A 4A3GI 1YHQZ 5IT9b 2E2HI 3CC41 2NVQI 2QEXZ 5FLXf 3PO3I 1QVGY 1W2BZ 2W04A 5T6BA 1VQ9Z 2PMZA 3CPWZ 4BY7I 3CCUZ 2QEX1 2VUMI 3F3FC 1KRLA 4A3CI 1VQO1 1K731 2QKDA 1YJ9Z 3HKZA 1YJWZ 1RNIA 2IZ3A 1R9TI 1YIT1 2LIYA 2JS4A 4E2XA 3EEDA 4A3JI 3GCFA 1QF8A 2QREB 2GU2A 1ZB9A 1S721 4NBBA 3M4OI 2G2KA 1M1K2 4A3FI 1YUAA 3G4SZ 3PO3S 4NBDA 3GTMI 3RZOI 1VQM1 3BG0B 3HOVI 1VQ81 4MD9A 3IX0A 4NBEA 1Q822 1ML8A 2JUBA 3CQZI 2QR1B 3I07A 1JJ2Y 4NB9A 1W2BY 4MH4A 1VQ61 1YIJ1 4NFRA 5FLXb 3CXCY 2AKLA 4E2WA 3I561 1YIJZ 2JR6A 2YU9I 2K5RA 1VQ5Z 3CCM1 3J7A4 2OOYB 1YI2Z 3S1NI 1I3QI 2LFUA 1Q862 2DE7A 1K83I 3TE5B 3CMA1 3D6WA 3CC21 4HH4A 3G4S1 1NJI1 3RZDI 1WIIA 3NDIA 3GTPI 3CPWY 1M902 2R7ZI 1JWHC 1Q821 2F4MA 3J80b 5C4XI 2Y0SA 2BJOA 2HF1A 4MRIA 2F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  2OTJ 1;  3CCR 1;  1VQK 1;  1QVG Y;  1W2B Z;  1Q81 1;  1VQO Z;  1VQ9 Z;  3CPW Z;  1VQK Z;  3CCU Z;  3CCR Z;  3G71 Z;  3G71 1;  2QEX 1;  3CCU 1;  1VQ9 1;  1VQO 1;  1Q7Y 1;  1K73 1;  1YJ9 Z;  1KQS Z;  1YJW Z;  2OTJ Z;  3CCQ 1;  1YIT 1;  3CC4 Z;  1YHQ 1;  3OW2 Z;  1VQN 1;  1VQ4 1;  1VQ7 Z;  3CCV Z;  3CMA Z;  1KC8 1;  3CCS Z;  1S72 1;  2QA4 1;  1Q81 2;  3CCJ Z;  1KD1 2;  1M1K 2;  3OW2 Y;  3G4S Z;  2OTL Z;  1VQP Z;  3CC2 Z;  1M1K 1;  1VQM 1;  1YI2 1;  1VQL 1;  3I55 Z;  1VQ8 1;  3CCM Z;  3CCE Z;  3CCL 1;  1Q86 1;  3CME Z;  3CD6 Z;  3I56 Z;  1Q82 2;  1KD1 1;  1YJN Z;  1VQ6 Z;  1VQ5 1;  1K8A 1;  1JJ2 Y;  1KQS Y;  3CC7 Z;  3CC7 1;  1N8R 1;  3G6E 1;  1W2B Y;  1K9M 2;  1VQ6 1;  1YIJ 1;  3CXC Y;  3I56 1;  1YIJ Z;  3CME 1;  1K9M 1;  3CD6 1;  3G6E Z;  1QVF Y;  1VQ5 Z;  1YJN 1;  3CCM 1;  1VQ8 Z;  1VQL Z;  1YI2 Z;  1VQM Z;  3CXC Z;  1K73 2;  1VQP 1;  3CCL Z;  1Q86 2;  3CCE 1;  3I55 1;  1S72 Z;  3CCS 1;  1NJI 2;  3CMA 1;  1Q7Y 2;  1K8A 2;  1JJ2 Z;  3CC2 1;  3G4S 1;  2OTL 1;  1NJI 1;  1KC8 2;  3CCJ 1;  2QA4 Z;  3CCQ Z;  1YIT Z;  1N8R 2;  1M90 2;  3CPW Y;  3CCV 1;  1Q82 1;  1QVG Z;  1YJW 1;  1YJ9 1;  1VQ7 1;  1M90 1;  1VQ4 Z;  1QVF Z;  1VQN Z;  1YHQ Z;  3CC4 1; 
#chains in the Genus database with same CATH topology
 2H85 A;  3H3V J;  3J81 f;  3S16 I;  4MXU A;  3KIF A;  2VF1 A;  1QXF A;  2JMO A;  2JNY A;  2LEX A;  2WAQ A;  3G71 1;  3CCU 1;  3HOU I;  1Q7Y 1;  3FKI I;  4DGL A;  1Y1W I;  1KQS Z;  2PM9 A;  3CC4 Z;  2JIP A;  1Z01 A;  1YHQ 1;  1I50 I;  1VQN 1;  1VQ7 Z;  4RS4 A;  2KI7 B;  3CCV Z;  1KC8 1;  3CCS Z;  5LL6 f;  3CCJ Z;  4RV9 A;  1KD1 2;  1NP6 A;  3MZL B;  3ESW A;  2OTL Z;  1VQP Z;  1M1K 1;  3GTG I;  3NH4 A;  3HOX I;  4AYB A;  3CCE Z;  1TWG I;  4MD8 A;  3CCL 1;  1X0T A;  1Q86 1;  2QLV B;  3I56 Z;  1KD1 1;  2W03 A;  3IFU A;  2VPX A;  2V8K A;  2M6N A;  3G6E 1;  4RVD A;  1K9M 2;  2Q51 A;  2O4H A;  3Q87 A;  3FQQ A;  3S2D I;  1PFT A;  1Z03 A;  2NVY I;  3VMH A;  3CD6 1;  1K9M 1;  2YAD A;  5D1O B;  1QVF Y;  2EGT A;  2OZK A;  5C44 I;  1YJN 1;  1VQL Z;  1VQM Z;  3CCL Z;  2R92 I;  3S17 I;  2NVX I;  3JAM f;  4Y52 I;  4BY1 I;  5D1P A;  3D2L A;  1Q7Y 2;  3QWU A;  1JJ2 Z;  4NBH A;  4HGY A;  2OTL 1;  2ZAE B;  3J80 f;  1KC8 2;  3MON A;  4E30 A;  1N2F A;  1N8R 2;  2JA7 I;  3CCV 1;  3H0G I;  4BBR I;  2V8I A;  1YJ9 1;  1VQ7 1;  1M90 1;  1VQ4 Z;  1RO0 A;  2KPI A;  3S14 I;  1TWC I;  5CM2 M;  4E33 A;  3GTM S;  4RVH A;  2OTJ 1;  5T64 A;  3CCR 1;  1VQK 1;  4QTU A;  1X3Z A;  5A2Q b;  1FDO A;  2E2I I;  1VQK Z;  3CCR Z;  3G71 Z;  4DQY B;  3HOY I;  3FQM A;  4MON A;  3KIH A;  2IZ4 A;  4BXX I;  1QYP A;  2VPW A;  1ZH1 A;  1USP B;  1L1O C;  2NAP A;  2JA8 I;  1SFO I;  3GTJ I;  1WW9 A;  4A3I I;  3M3Y I;  2QA4 1;  1Q81 2;  2DE5 A;  4A93 I;  5C4J I;  1TWF I;  5IP9 I;  2B63 I;  4MD7 A;  3CC2 Z;  3T4N B;  2GTI A;  4NBC A;  1VQL 1;  3GTK I;  4TNU A;  3I55 Z;  4X6A I;  1RLY A;  2E2J I;  3CD6 Z;  5C3E I;  2VUG A;  4E2Z A;  1VQ5 1;  3GTQ I;  3P5J B;  2JIQ A;  3CC7 1;  3MZK B;  4NB8 A;  4DK1 A;  3VMG A;  3CME 1;  3VB9 A;  2RBL A;  4RVG A;  1ZB8 A;  2RPR A;  4CL1 A;  2OOX B;  1WCM I;  4EWC A;  1NUI A;  4HGZ A;  3CXC Z;  1AA6 A;  4E32 A;  2JA5 I;  1VQP 1;  4A3B I;  2P3Y A;  1I6H I;  3I55 1;  2K3R A;  1NJI 2;  3CCS 1;  3NDJ A;  2R93 I;  1K8A 2;  3JAM b;  4NBG A;  2RIQ A;  4A3L I;  4E31 A;  2E9H A;  1RQF A;  3U50 C;  2QA4 Z;  4A3D I;  3CCQ Z;  1TWA I;  5IP7 I;  3LUS A;  1QVF Z;  2DE6 A;  3NH5 A;  5T67 A;  3GTO I;  3GKQ A;  2M48 A;  5AN9 F;  3NFZ A;  1Q81 1;  2PK7 A;  1VQO Z;  1LQL A;  2V8J A;  3VTN A;  3HOW I;  1Z02 A;  2P28 A;  1DL6 A;  1VQ9 1;  2AYD A;  2E7Z A;  4BBS I;  3S15 I;  3I4M I;  2OTJ Z;  1YUK A;  1VLA A;  3CCQ 1;  2I3C A;  4Y7N I;  3OW2 Z;  1P9N A;  1VQ4 1;  2Q4Z A;  3S1Q I;  3IR7 A;  4E2Y A;  3IF8 A;  3CMA Z;  2J6A A;  1Q16 A;  2RT9 A;  3J81 b;  4NH1 C;  1X3W A;  3OW2 Y;  3TDH B;  4A3M I;  4NOZ A;  2RHB A;  3S1R I;  1S7M A;  3GTL I;  3BG1 B;  1FDI A;  1YI2 1;  2JA6 I;  3CCM Z;  2V3V A;  3F3P C;  3S2H I;  3PO2 I;  3CME Z;  2NVT I;  2GTH A;  3HOZ I;  1YJN Z;  1VQ6 Z;  2O53 A;  3D9X A;  1K8A 1;  1KQS Y;  2IV2 X;  4NBF A;  3CC7 Z;  4A3E I;  1N8R 1;  1RO4 A;  1Y1V S;  1RO2 A;  3NH8 A;  3EER A;  3G6E Z;  4A3K I;  1VQ8 Z;  3I4N I;  3K7A I;  4RVF A;  4NBA A;  1K73 2;  3CCE 1;  3S1M I;  3VMI A;  1USP A;  1TWH I;  1TFI A;  1S72 Z;  5IT9 f;  2QRD B;  5D1O A;  4S1T A;  2WB1 A;  2QRC B;  5A2Q f;  3CCJ 1;  1YIT Z;  5FLM I;  1Y1V I;  2R6M A;  4QTT A;  1QVG Z;  4XX2 A;  1YJW 1;  1VQN Z;  2HU9 A;  4A3G I;  1YHQ Z;  5IT9 b;  2E2H I;  3CC4 1;  2NVQ I;  2QEX Z;  5FLX f;  2VPY A;  3PO3 I;  1QVG Y;  1W2B Z;  2W04 A;  5T6B A;  1VQ9 Z;  2PMZ A;  3CPW Z;  4BY7 I;  3CCU Z;  2QEX 1;  2VUM I;  3F3F C;  1KRL A;  2VPZ A;  4A3C I;  1VQO 1;  1K73 1;  2QKD A;  1YJ9 Z;  3HKZ A;  1YJW Z;  1RNI A;  2IZ3 A;  1R9T I;  1YIT 1;  2LIY A;  2JS4 A;  4E2X A;  3EED A;  4A3J I;  3GCF A;  1QF8 A;  2QRE B;  2GU2 A;  1ZB9 A;  1S72 1;  4NBB A;  3M4O I;  2G2K A;  1M1K 2;  4A3F I;  1YUA A;  3G4S Z;  3PO3 S;  4NBD A;  2V45 A;  3GTM I;  3RZO I;  1VQM 1;  3BG0 B;  3HOV I;  1VQ8 1;  4MD9 A;  3IX0 A;  4NBE A;  2JIO A;  1Q82 2;  1ML8 A;  2JUB A;  3CQZ I;  2QR1 B;  3I07 A;  1JJ2 Y;  4NB9 A;  1W2B Y;  4MH4 A;  1VQ6 1;  1YIJ 1;  4NFR A;  5FLX b;  3CXC Y;  2AKL A;  4E2W A;  3I56 1;  1YIJ Z;  1WJ2 A;  2JR6 A;  2YU9 I;  2K5R A;  1VQ5 Z;  3CCM 1;  3J7A 4;  1SIW A;  2OOY B;  1YI2 Z;  2JIR A;  3S1N I;  1I3Q I;  2LFU A;  1Q86 2;  2DE7 A;  1K83 I;  3TE5 B;  3CMA 1;  1WZN A;  3D6W A;  3CC2 1;  4HH4 A;  3G4S 1;  1NJI 1;  3RZD I;  1WII A;  3NDI A;  3GTP I;  1Y8C A;  2JIM A;  3CPW Y;  1M90 2;  2R7Z I;  1JWH C;  1Q82 1;  2F4M A;  3J80 b;  5C4X I;  2Y0S A;  2BJO A;  2HF1 A;  4MRI A;  2F4O A; 
#chains in the Genus database with same CATH homology
 2H85 A;  3H3V J;  3J81 f;  3S16 I;  4MXU A;  3KIF A;  2VF1 A;  2JMO A;  2JNY A;  2WAQ A;  3G71 1;  3CCU 1;  3HOU I;  1Q7Y 1;  3FKI I;  4DGL A;  1Y1W I;  1KQS Z;  2PM9 A;  3CC4 Z;  1Z01 A;  1YHQ 1;  1I50 I;  1VQN 1;  1VQ7 Z;  4RS4 A;  2KI7 B;  3CCV Z;  1KC8 1;  3CCS Z;  5LL6 f;  3CCJ Z;  4RV9 A;  1KD1 2;  1NP6 A;  3MZL B;  3ESW A;  2OTL Z;  1VQP Z;  1M1K 1;  3GTG I;  3NH4 A;  3HOX I;  4AYB A;  3CCE Z;  1TWG I;  4MD8 A;  3CCL 1;  1X0T A;  1Q86 1;  2QLV B;  3I56 Z;  1KD1 1;  2W03 A;  3IFU A;  2V8K A;  2M6N A;  3G6E 1;  4RVD A;  1K9M 2;  2Q51 A;  2O4H A;  3Q87 A;  3FQQ A;  3S2D I;  1PFT A;  1Z03 A;  2NVY I;  3VMH A;  3CD6 1;  1K9M 1;  2YAD A;  5D1O B;  1QVF Y;  2EGT A;  2OZK A;  5C44 I;  1YJN 1;  1VQL Z;  1VQM Z;  3CCL Z;  2R92 I;  3S17 I;  2NVX I;  3JAM f;  4Y52 I;  4BY1 I;  5D1P A;  1Q7Y 2;  3QWU A;  1JJ2 Z;  4NBH A;  4HGY A;  2OTL 1;  2ZAE B;  3J80 f;  1KC8 2;  3MON A;  4E30 A;  1N2F A;  1N8R 2;  2JA7 I;  3CCV 1;  3H0G I;  4BBR I;  2V8I A;  1YJ9 1;  1VQ7 1;  1M90 1;  1VQ4 Z;  1RO0 A;  2KPI A;  3S14 I;  1TWC I;  5CM2 M;  4E33 A;  3GTM S;  4RVH A;  2OTJ 1;  5T64 A;  3CCR 1;  1VQK 1;  4QTU A;  1X3Z A;  5A2Q b;  2E2I I;  1VQK Z;  3CCR Z;  3G71 Z;  4DQY B;  3HOY I;  3FQM A;  4MON A;  3KIH A;  2IZ4 A;  4BXX I;  1QYP A;  1ZH1 A;  1USP B;  1L1O C;  2JA8 I;  1SFO I;  3GTJ I;  1WW9 A;  4A3I I;  3M3Y I;  2QA4 1;  1Q81 2;  2DE5 A;  4A93 I;  5C4J I;  1TWF I;  5IP9 I;  2B63 I;  4MD7 A;  3CC2 Z;  3T4N B;  2GTI A;  4NBC A;  1VQL 1;  3GTK I;  4TNU A;  3I55 Z;  4X6A I;  1RLY A;  2E2J I;  3CD6 Z;  5C3E I;  2VUG A;  4E2Z A;  1VQ5 1;  3GTQ I;  3P5J B;  3CC7 1;  3MZK B;  4NB8 A;  4DK1 A;  3VMG A;  3CME 1;  3VB9 A;  2RBL A;  4RVG A;  1ZB8 A;  2RPR A;  4CL1 A;  2OOX B;  1WCM I;  4EWC A;  1NUI A;  4HGZ A;  3CXC Z;  4E32 A;  2JA5 I;  1VQP 1;  4A3B I;  2P3Y A;  1I6H I;  3I55 1;  2K3R A;  1NJI 2;  3CCS 1;  3NDJ A;  2R93 I;  1K8A 2;  3JAM b;  4NBG A;  2RIQ A;  4A3L I;  4E31 A;  2E9H A;  1RQF A;  3U50 C;  2QA4 Z;  4A3D I;  3CCQ Z;  1TWA I;  5IP7 I;  3LUS A;  1QVF Z;  2DE6 A;  3NH5 A;  5T67 A;  3GTO I;  3GKQ A;  2M48 A;  5AN9 F;  3NFZ A;  1Q81 1;  2PK7 A;  1VQO Z;  1LQL A;  2V8J A;  3VTN A;  3HOW I;  1Z02 A;  2P28 A;  1DL6 A;  1VQ9 1;  4BBS I;  3S15 I;  3I4M I;  2OTJ Z;  1YUK A;  1VLA A;  3CCQ 1;  2I3C A;  4Y7N I;  3OW2 Z;  1P9N A;  1VQ4 1;  2Q4Z A;  3S1Q I;  4E2Y A;  3IF8 A;  3CMA Z;  2J6A A;  2RT9 A;  3J81 b;  4NH1 C;  1X3W A;  3OW2 Y;  3TDH B;  4A3M I;  4NOZ A;  2RHB A;  3S1R I;  1S7M A;  3GTL I;  3BG1 B;  1YI2 1;  2JA6 I;  3CCM Z;  3F3P C;  3S2H I;  3PO2 I;  3CME Z;  2NVT I;  2GTH A;  3HOZ I;  1YJN Z;  1VQ6 Z;  2O53 A;  3D9X A;  1K8A 1;  1KQS Y;  4NBF A;  3CC7 Z;  4A3E I;  1N8R 1;  1RO4 A;  1Y1V S;  1RO2 A;  3NH8 A;  3EER A;  3G6E Z;  4A3K I;  1VQ8 Z;  3I4N I;  3K7A I;  4RVF A;  4NBA A;  1K73 2;  3CCE 1;  3S1M I;  3VMI A;  1USP A;  1TWH I;  1TFI A;  1S72 Z;  5IT9 f;  2QRD B;  5D1O A;  4S1T A;  2WB1 A;  2QRC B;  5A2Q f;  3CCJ 1;  1YIT Z;  5FLM I;  1Y1V I;  2R6M A;  4QTT A;  1QVG Z;  4XX2 A;  1YJW 1;  1VQN Z;  2HU9 A;  4A3G I;  1YHQ Z;  5IT9 b;  2E2H I;  3CC4 1;  2NVQ I;  2QEX Z;  5FLX f;  3PO3 I;  1QVG Y;  1W2B Z;  2W04 A;  5T6B A;  1VQ9 Z;  2PMZ A;  3CPW Z;  4BY7 I;  3CCU Z;  2QEX 1;  2VUM I;  3F3F C;  1KRL A;  4A3C I;  1VQO 1;  1K73 1;  2QKD A;  1YJ9 Z;  3HKZ A;  1YJW Z;  1RNI A;  2IZ3 A;  1R9T I;  1YIT 1;  2LIY A;  2JS4 A;  4E2X A;  3EED A;  4A3J I;  3GCF A;  1QF8 A;  2QRE B;  2GU2 A;  1ZB9 A;  1S72 1;  4NBB A;  3M4O I;  2G2K A;  1M1K 2;  4A3F I;  1YUA A;  3G4S Z;  3PO3 S;  4NBD A;  3GTM I;  3RZO I;  1VQM 1;  3BG0 B;  3HOV I;  1VQ8 1;  4MD9 A;  3IX0 A;  4NBE A;  1Q82 2;  1ML8 A;  2JUB A;  3CQZ I;  2QR1 B;  3I07 A;  1JJ2 Y;  4NB9 A;  1W2B Y;  4MH4 A;  1VQ6 1;  1YIJ 1;  4NFR A;  5FLX b;  3CXC Y;  2AKL A;  4E2W A;  3I56 1;  1YIJ Z;  2JR6 A;  2YU9 I;  2K5R A;  1VQ5 Z;  3CCM 1;  3J7A 4;  2OOY B;  1YI2 Z;  3S1N I;  1I3Q I;  2LFU A;  1Q86 2;  2DE7 A;  1K83 I;  3TE5 B;  3CMA 1;  3D6W A;  3CC2 1;  4HH4 A;  3G4S 1;  1NJI 1;  3RZD I;  1WII A;  3NDI A;  3GTP I;  3CPW Y;  1M90 2;  2R7Z I;  1JWH C;  1Q82 1;  2F4M A;  3J80 b;  5C4X I;  2Y0S A;  2BJO A;  2HF1 A;  4MRI A;  2F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...