4A3BI

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3bI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3bI02
3S14I 3PO3I 2JA6I 1TWAI 1VLAA 3RZDI 4A3GI 2E2HI 2P3YA 1ZB9A 1R9TI 3HOZI 3M3YI 3H0GI 2VUMI 3GCFA 3S1QI 3S17I 2JA5I 1ML8A 4QTTA 1X3ZA 2DE6A 1N2FA 2JS4A 3GTJI 5CM2M 4NB8A 1Y1VS 3GTMI 3HOUI 3S2DI 4A3KI 2RBLA 3RZOI 4A3FI 4NBGA 3GTKI 3Q87A 2DE5A 2YU9I 3GKQA 1SFOI 1NUIA 2NVTI 1I50I 1WCMI 2BJOA 4A3II 3K7AI 4A3EI 4BY1I 3S1NI 1YUAA 2NVYI 3GTGI 2NVXI 4QTUA 4MH4A 3S16I 4Y52I 3GTLI 4BY7I 2JA8I 1TWFI 4NBBA 1Y1WI 4BXXI 1Y1VI 4NBFA 5C44I 1K83I 3I4MI 1I6HI 3GTOI 2F4MA 3HOVI 3ESWA 1ZB8A 2E2II 1X3WA 3FKII 1USPB 4NBDA 1TWHI 2HF1A 1TWGI 3VMIA 4BBSI 2KPIA 5IP7I 5FLMI 4A3MI 4NBAA 3GTPI 2R7ZI 5C3EI 5C4JI 3VB9A 3U50C 2J6AA 3D6WA 2R92I 3VMGA 1QYPA 3GTQI 2R93I 5C4XI 1TFIA 1USPA 2K5RA 3HOWI 3S1RI 2B63I 4A3DI 2DE7A 3PO2I 2JNYA 2JA7I 3PO3S 1RO4A 4A3JI 4BBRI 1DL6A 3CQZI 2AKLA 3S15I 1L1OC 4A3BI 3HOXI 3S1MI 1LQLA 3EERA 2F4OA 4NOZA 3I4NI 4X6AI 1WW9A 4XX2A 2NVQI 4A3LI 2E2JI 4Y7NI 3VMHA 2JR6A 1RLYA 4NB9A 1I3QI 3LUSA 4NBCA 4NBHA 4NBEA 5IP9I 3GTMS 3HOYI 1TWCI 1PFTA 4A3CI 4A93I 2PK7A 3I07A 3M4OI 3H3VJ 3S2HI
chains in the Genus database with same CATH superfamily
4DGLA 1YJ9Z 3CCV1 3CMEZ 2JA6I 3CC41 5A2Qb 1VLAA 1VQOZ 3CCQ1 3NH5A 1Q811 2E2HI 2RHBA 2RPRA 5FLXb 1VQ7Z 3GCFA 2WAQA 3IF8A 1N2FA 3F3PC 3HOUI 3GTMI 3CCRZ 2IZ3A 2NAPA 1Z02A 1YHQZ 2V3VA 1SIWA 3CMAZ 1VQP1 1RO0A 1K732 5D1OB 2BJOA 2K3RA 1KQSZ 4BY1I 3S1NI 1YUAA 2KI7B 1Z03A 1S7MA 2NVXI 4Y52I 3S16I 1M901 3KIFA 1Y1WI 4MD9A 1VQO1 4MRIA 2P28A 1I6HI 2F4MA 3ESWA 1Q861 4MONA 2E2II 2M6NA 1VQ71 1JJ2Y 1TWGI 3VMIA 5FLMI 3EEDA 3CCR1 5C3EI 3CCMZ 3CC7Z 3QWUA 3VB9A 1QYPA 2JIQA 3MZKB 2JIMA 2K5RA 1NJI1 3CMA1 3S1RI 1YUKA 1FDOA 2JNYA 1K9M2 1Y8CA 4DK1A 5IT9f 1VQMZ 3HOXI 3EERA 4RVGA 4NOZA 2QR1B 2NVQI 1QVGZ 4NB9A 1I3QI 2LEXA 3F3FC 3LUSA 4NBCA 4NBHA 2QKDA 3CCQZ 3HKZA 2JMOA 5T64A 3I07A 3FQQA 3CCEZ 3I56Z 3H3VJ 3BG0B 2V8IA 1VQ8Z 3G4SZ 1KQSY 2Q51A 1TWAI 3CCM1 3CCUZ 3CC71 1S72Z 4E30A 2P3YA 2LFUA 3IR7A 1ZB9A 3M3YI 3H0GI 3J81f 2WB1A 2JIOA 4RVDA 1VQPZ 1JWHC 3S17I 1Q822 2JA5I 1ML8A 2IZ4A 1Q7Y1 2DE6A 1YJWZ 2JS4A 3GTJI 2VPWA 2HU9A 4NB8A 1VQM1 4NFRA 4A3KI 2RBLA 2QLVB 3RZOI 4A3FI 4NBGA 2GU2A 3CCJZ 2OTJZ 1VQ9Z 2YU9I 1N8R1 3VTNA 1SFOI 1M1K2 1NUIA 3G6EZ 1WCMI 1K8A2 1KC82 4RV9A 4A3EI 4E32A 5LL6f 3FQMA 2VPXA 3CCE1 3I561 1VQ81 3CD6Z 3G4S1 4BY7I 1K731 3CCU1 1K83I 1QVGY 2E7ZA 1S721 3HOVI 2QRCB 1TWHI 3MZLB 3NDIA 2Y0SA 2KPIA 5IP7I 4NH1C 2QEXZ 3CCL1 4NBAA 1YJW1 1ZH1A 5IT9b 1Q812 2J6AA 2ZAEB 1NP6A 4E2XA 2R93I 5C4XI 1W2BZ 3CCJ1 1TFIA 1USPA 3HOWI 2OTJ1 1VQ91 4RVFA 4A3DI 3PO2I 2LIYA 3S2HI 2JA7I 3PO3S 3G6E1 4BBRI 2PM9A 3J7A4 1LQLA 2F4OA 4X6AI 4HGZA 3CD61 4Y7NI 4E33A 2JIPA 1RQFA 3I55Z 3NDJA 3P5JB 1KD12 2I3CA 2VPYA 1K9M1 3JAMf 1YIJZ 1PFTA 5A2Qf 4A93I 2PK7A 1QVFZ 2QREB 2YADA 3OW2Z 5FLXf 4EWCA 2QEX1 1RO2A 4DQYB 2R6MA 1R9TI 3HOZI 1YJNZ 3S1QI 2OOYB 2JUBA 5T6BA 2VUGA 3G71Z 1Y1VS 2QA4Z 1VQ4Z 2PMZA 3GTKI 3Q87A 3I551 1YITZ 2O53A 3GKQA 1Q821 3CC2Z 2W04A 1W2BY 2NVTI 1I50I 2JIRA 4E2WA 1YIJ1 3NH4A 2NVYI 4QTUA 1AA6A 4MH4A 1KD11 2EGTA 3CCLZ 3GTLI 2JA8I 1TWFI 4NBBA 5D1OA 4BXXI 4NBFA 3I4MI 3GTOI 2QRDB 1VQLZ 1Q16A 1KC81 1YJN1 2W03A 3FKII 3CXCZ 2RIQA 2HF1A 2V8KA 4BBSI 4A3MI 1QF8A 1QVFY 3G711 3GTPI 1WZNA 2R7ZI 1VQ6Z 1WIIA 2QA41 3OW2Y 3U50C 1VQ41 2R92I 1WJ2A 4E2ZA 3KIHA 2B63I 2DE7A 1YIT1 1P9NA 3IFUA 3CC21 2E9HA 3JAMb 3CQZI 1FDIA 2AKLA 1L1OC 3S1MI 1WW9A 2AYDA 4XX2A 1VQK1 3TDHB 3VMHA 2G2KA 4CL1A 5AN9F 1N8R2 3D2LA 5IP9I 3GTMS 1VQL1 4S1TA 3IX0A 3S14I 3PO3I 1VQ61 4A3GI 3RZDI 3MONA 3J80f 2VUMI 2H85A 4QTTA 1X3ZA 1YJ91 3CXCY 3CME1 4AYBA 5CM2M 4E31A 3J81b 3S2DI 4HH4A 1VQ5Z 3CCSZ 5T67A 3BG1B 1M902 2DE5A 3NFZA 2M48A 2GTIA 2OTLZ 1Q862 3NH8A 4A3II 3CPWZ 3K7AI 1YI2Z 1YHQ1 1X0TA 3GTGI 1VQNZ 3T4NB 2VF1A 1Y1VI 5C44I 2GTHA 1ZB8A 1X3WA 1NJI2 2Q4ZA 1USPB 4NBDA 4RVHA 3CCVZ 3TE5B 3CC4Z 4MXUA 5C4JI 4E2YA 1VQ51 3D6WA 3CCS1 3VMGA 3GTQI 3D9XA 1VQKZ 4RS4A 1RO4A 4A3JI 2OTL1 1M1K1 1YI21 1K8A1 1DL6A 4MD8A 3S15I 2VPZA 4MD7A 4A3BI 1Z01A 2V45A 3I4NI 1VQN1 4A3LI 1KRLA 1QXFA 2E2JI 2JR6A 1RLYA 1RNIA 2O4HA 1JJ2Z 4NBEA 3J80b 5D1PA 2OOXB 3HOYI 1TWCI 2IV2X 4A3CI 4HGYA 2V8JA 3M4OI 4TNUA 1Q7Y2 3CPWY 2OZKA 2RT9A
chains in the Genus database with same CATH topology
4DGLA 1YJ9Z 3CCV1 3CMEZ 2JA6I 3CC41 5A2Qb 1VLAA 1VQOZ 3CCQ1 3NH5A 1Q811 2E2HI 2RHBA 2RPRA 5FLXb 1VQ7Z 3GCFA 2WAQA 3IF8A 1N2FA 3F3PC 3HOUI 3GTMI 3CCRZ 2IZ3A 1Z02A 1YHQZ 3CMAZ 1VQP1 1RO0A 1K732 5D1OB 2BJOA 2K3RA 1KQSZ 4BY1I 3S1NI 1YUAA 2KI7B 1Z03A 1S7MA 2NVXI 4Y52I 3S16I 1M901 3KIFA 1Y1WI 4MD9A 1VQO1 4MRIA 2P28A 1I6HI 2F4MA 3ESWA 1Q861 4MONA 2E2II 2M6NA 1VQ71 1JJ2Y 1TWGI 3VMIA 5FLMI 3EEDA 3CCR1 5C3EI 3CCMZ 3CC7Z 3QWUA 3VB9A 1QYPA 3MZKB 2K5RA 1NJI1 3CMA1 3S1RI 1YUKA 2JNYA 1K9M2 4DK1A 5IT9f 1VQMZ 3HOXI 3EERA 4RVGA 4NOZA 2QR1B 2NVQI 1QVGZ 4NB9A 1I3QI 3F3FC 3LUSA 4NBCA 4NBHA 2QKDA 3CCQZ 3HKZA 2JMOA 5T64A 3I07A 3FQQA 3CCEZ 3I56Z 3H3VJ 3BG0B 1VQ8Z 2V8IA 3G4SZ 1KQSY 2Q51A 1TWAI 3CCM1 3CCUZ 3CC71 1S72Z 4E30A 2P3YA 2LFUA 1ZB9A 3M3YI 3H0GI 3J81f 2WB1A 4RVDA 1VQPZ 1JWHC 3S17I 1Q822 2JA5I 1ML8A 2IZ4A 1Q7Y1 2DE6A 1YJWZ 2JS4A 3GTJI 2HU9A 4NB8A 1VQM1 4NFRA 4A3KI 2RBLA 2QLVB 3RZOI 4A3FI 4NBGA 2GU2A 3CCJZ 2OTJZ 1VQ9Z 2YU9I 1N8R1 3VTNA 1SFOI 1M1K2 1NUIA 3G6EZ 1WCMI 1K8A2 1KC82 4RV9A 4A3EI 4E32A 5LL6f 3FQMA 3CCE1 3I561 1VQ81 3CD6Z 3G4S1 4BY7I 1K731 3CCU1 1K83I 1QVGY 1S721 3HOVI 2QRCB 1TWHI 3MZLB 3NDIA 2Y0SA 2KPIA 5IP7I 4NH1C 2QEXZ 3CCL1 4NBAA 1YJW1 1ZH1A 5IT9b 1Q812 2J6AA 2ZAEB 1NP6A 4E2XA 2R93I 5C4XI 1W2BZ 3CCJ1 1TFIA 1USPA 3HOWI 2OTJ1 1VQ91 4RVFA 4A3DI 3PO2I 2LIYA 3S2HI 2JA7I 3PO3S 3G6E1 4BBRI 2PM9A 3J7A4 1LQLA 2F4OA 4X6AI 4HGZA 3CD61 4Y7NI 4E33A 1RQFA 3I55Z 3NDJA 3P5JB 1KD12 2I3CA 1K9M1 3JAMf 1YIJZ 1PFTA 5A2Qf 4A93I 2PK7A 1QVFZ 2QREB 2YADA 3OW2Z 5FLXf 4EWCA 2QEX1 1RO2A 4DQYB 2R6MA 1R9TI 3HOZI 1YJNZ 3S1QI 2OOYB 2JUBA 5T6BA 2VUGA 3G71Z 1Y1VS 2QA4Z 1VQ4Z 2PMZA 3GTKI 3Q87A 3I551 1YITZ 2O53A 3GKQA 1Q821 3CC2Z 2W04A 1W2BY 2NVTI 1I50I 4E2WA 1YIJ1 3NH4A 2NVYI 4QTUA 4MH4A 1KD11 2EGTA 3CCLZ 3GTLI 2JA8I 1TWFI 4NBBA 5D1OA 4BXXI 4NBFA 3I4MI 3GTOI 2QRDB 1VQLZ 1KC81 1YJN1 2W03A 3FKII 3CXCZ 2RIQA 2HF1A 2V8KA 4BBSI 4A3MI 1QF8A 1QVFY 3G711 3GTPI 2R7ZI 1VQ6Z 1WIIA 2QA41 3OW2Y 3U50C 1VQ41 2R92I 4E2ZA 3KIHA 2B63I 2DE7A 1YIT1 1P9NA 3IFUA 3CC21 2E9HA 3JAMb 3CQZI 2AKLA 1L1OC 3S1MI 1WW9A 4XX2A 1VQK1 3TDHB 3VMHA 2G2KA 4CL1A 5AN9F 1N8R2 5IP9I 3GTMS 1VQL1 4S1TA 3IX0A 3S14I 3PO3I 1VQ61 4A3GI 3RZDI 3MONA 3J80f 2VUMI 2H85A 4QTTA 1X3ZA 1YJ91 3CXCY 3CME1 4AYBA 5CM2M 4E31A 3J81b 3S2DI 4HH4A 1VQ5Z 3CCSZ 5T67A 3BG1B 1M902 2DE5A 3NFZA 2M48A 2GTIA 2OTLZ 1Q862 3NH8A 4A3II 3CPWZ 3K7AI 1YI2Z 1YHQ1 1X0TA 3GTGI 1VQNZ 3T4NB 2VF1A 1Y1VI 5C44I 2GTHA 1ZB8A 1X3WA 1NJI2 2Q4ZA 1USPB 4NBDA 4RVHA 3CCVZ 3TE5B 3CC4Z 4MXUA 5C4JI 4E2YA 1VQ51 3D6WA 3CCS1 3VMGA 3GTQI 3D9XA 1VQKZ 4RS4A 1RO4A 4A3JI 2OTL1 1M1K1 1YI21 1K8A1 1DL6A 4MD8A 3S15I 4A3BI 4MD7A 1Z01A 3I4NI 1VQN1 4A3LI 1KRLA 2E2JI 2JR6A 1RLYA 1RNIA 2O4HA 1JJ2Z 4NBEA 3J80b 5D1PA 2OOXB 3HOYI 1TWCI 4A3CI 4HGYA 2V8JA 3M4OI 4TNUA 1Q7Y2 3CPWY 2OZKA 2RT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 I;  3PO3 I;  2JA6 I;  1TWA I;  1VLA A;  3RZD I;  4A3G I;  2E2H I;  2P3Y A;  1ZB9 A;  1R9T I;  3HOZ I;  3M3Y I;  3H0G I;  2VUM I;  3GCF A;  3S1Q I;  3S17 I;  2JA5 I;  1ML8 A;  4QTT A;  1X3Z A;  2DE6 A;  1N2F A;  2JS4 A;  3GTJ I;  5CM2 M;  4NB8 A;  1Y1V S;  3GTM I;  3HOU I;  3S2D I;  4A3K I;  2RBL A;  3RZO I;  4A3F I;  4NBG A;  3GTK I;  3Q87 A;  2DE5 A;  2YU9 I;  3GKQ A;  1SFO I;  1NUI A;  2NVT I;  1I50 I;  1WCM I;  2BJO A;  4A3I I;  3K7A I;  4A3E I;  4BY1 I;  3S1N I;  1YUA A;  2NVY I;  3GTG I;  2NVX I;  4QTU A;  4MH4 A;  3S16 I;  4Y52 I;  3GTL I;  4BY7 I;  2JA8 I;  1TWF I;  4NBB A;  1Y1W I;  4BXX I;  1Y1V I;  4NBF A;  5C44 I;  1K83 I;  3I4M I;  1I6H I;  3GTO I;  2F4M A;  3HOV I;  3ESW A;  1ZB8 A;  2E2I I;  1X3W A;  3FKI I;  1USP B;  4NBD A;  1TWH I;  2HF1 A;  1TWG I;  3VMI A;  4BBS I;  2KPI A;  5IP7 I;  5FLM I;  4A3M I;  4NBA A;  3GTP I;  2R7Z I;  5C3E I;  5C4J I;  3VB9 A;  3U50 C;  2J6A A;  3D6W A;  2R92 I;  3VMG A;  1QYP A;  3GTQ I;  2R93 I;  5C4X I;  1TFI A;  1USP A;  2K5R A;  3HOW I;  3S1R I;  2B63 I;  4A3D I;  2DE7 A;  3PO2 I;  2JNY A;  2JA7 I;  3PO3 S;  1RO4 A;  4A3J I;  4BBR I;  1DL6 A;  3CQZ I;  2AKL A;  3S15 I;  1L1O C;  4A3B I;  3HOX I;  3S1M I;  1LQL A;  3EER A;  2F4O A;  4NOZ A;  3I4N I;  4X6A I;  1WW9 A;  4XX2 A;  2NVQ I;  4A3L I;  2E2J I;  4Y7N I;  3VMH A;  2JR6 A;  1RLY A;  4NB9 A;  1I3Q I;  3LUS A;  4NBC A;  4NBH A;  4NBE A;  5IP9 I;  3GTM S;  3HOY I;  1TWC I;  1PFT A;  4A3C I;  4A93 I;  2PK7 A;  3I07 A;  3M4O I;  3H3V J;  3S2H I; 
#chains in the Genus database with same CATH topology
 4DGL A;  1YJ9 Z;  3CCV 1;  3CME Z;  2JA6 I;  3CC4 1;  5A2Q b;  1VLA A;  1VQO Z;  3CCQ 1;  3NH5 A;  1Q81 1;  2E2H I;  2RHB A;  2RPR A;  5FLX b;  1VQ7 Z;  3GCF A;  2WAQ A;  3IF8 A;  1N2F A;  3F3P C;  3HOU I;  3GTM I;  3CCR Z;  2IZ3 A;  2NAP A;  1Z02 A;  1YHQ Z;  2V3V A;  1SIW A;  3CMA Z;  1VQP 1;  1RO0 A;  1K73 2;  5D1O B;  2BJO A;  2K3R A;  1KQS Z;  4BY1 I;  3S1N I;  1YUA A;  2KI7 B;  1Z03 A;  1S7M A;  2NVX I;  4Y52 I;  3S16 I;  1M90 1;  3KIF A;  1Y1W I;  4MD9 A;  1VQO 1;  4MRI A;  2P28 A;  1I6H I;  2F4M A;  3ESW A;  1Q86 1;  4MON A;  2E2I I;  2M6N A;  1VQ7 1;  1JJ2 Y;  1TWG I;  3VMI A;  5FLM I;  3EED A;  3CCR 1;  5C3E I;  3CCM Z;  3CC7 Z;  3QWU A;  3VB9 A;  1QYP A;  2JIQ A;  3MZK B;  2JIM A;  2K5R A;  1NJI 1;  3CMA 1;  3S1R I;  1YUK A;  1FDO A;  2JNY A;  1K9M 2;  1Y8C A;  4DK1 A;  5IT9 f;  1VQM Z;  3HOX I;  3EER A;  4RVG A;  4NOZ A;  2QR1 B;  2NVQ I;  1QVG Z;  4NB9 A;  1I3Q I;  2LEX A;  3F3F C;  3LUS A;  4NBC A;  4NBH A;  2QKD A;  3CCQ Z;  3HKZ A;  2JMO A;  5T64 A;  3I07 A;  3FQQ A;  3CCE Z;  3I56 Z;  3H3V J;  3BG0 B;  2V8I A;  1VQ8 Z;  3G4S Z;  1KQS Y;  2Q51 A;  1TWA I;  3CCM 1;  3CCU Z;  3CC7 1;  1S72 Z;  4E30 A;  2P3Y A;  2LFU A;  3IR7 A;  1ZB9 A;  3M3Y I;  3H0G I;  3J81 f;  2WB1 A;  2JIO A;  4RVD A;  1VQP Z;  1JWH C;  3S17 I;  1Q82 2;  2JA5 I;  1ML8 A;  2IZ4 A;  1Q7Y 1;  2DE6 A;  1YJW Z;  2JS4 A;  3GTJ I;  2VPW A;  2HU9 A;  4NB8 A;  1VQM 1;  4NFR A;  4A3K I;  2RBL A;  2QLV B;  3RZO I;  4A3F I;  4NBG A;  2GU2 A;  3CCJ Z;  2OTJ Z;  1VQ9 Z;  2YU9 I;  1N8R 1;  3VTN A;  1SFO I;  1M1K 2;  1NUI A;  3G6E Z;  1WCM I;  1K8A 2;  1KC8 2;  4RV9 A;  4A3E I;  4E32 A;  5LL6 f;  3FQM A;  2VPX A;  3CCE 1;  3I56 1;  1VQ8 1;  3CD6 Z;  3G4S 1;  4BY7 I;  1K73 1;  3CCU 1;  1K83 I;  1QVG Y;  2E7Z A;  1S72 1;  3HOV I;  2QRC B;  1TWH I;  3MZL B;  3NDI A;  2Y0S A;  2KPI A;  5IP7 I;  4NH1 C;  2QEX Z;  3CCL 1;  4NBA A;  1YJW 1;  1ZH1 A;  5IT9 b;  1Q81 2;  2J6A A;  2ZAE B;  1NP6 A;  4E2X A;  2R93 I;  5C4X I;  1W2B Z;  3CCJ 1;  1TFI A;  1USP A;  3HOW I;  2OTJ 1;  1VQ9 1;  4RVF A;  4A3D I;  3PO2 I;  2LIY A;  3S2H I;  2JA7 I;  3PO3 S;  3G6E 1;  4BBR I;  2PM9 A;  3J7A 4;  1LQL A;  2F4O A;  4X6A I;  4HGZ A;  3CD6 1;  4Y7N I;  4E33 A;  2JIP A;  1RQF A;  3I55 Z;  3NDJ A;  3P5J B;  1KD1 2;  2I3C A;  2VPY A;  1K9M 1;  3JAM f;  1YIJ Z;  1PFT A;  5A2Q f;  4A93 I;  2PK7 A;  1QVF Z;  2QRE B;  2YAD A;  3OW2 Z;  5FLX f;  4EWC A;  2QEX 1;  1RO2 A;  4DQY B;  2R6M A;  1R9T I;  3HOZ I;  1YJN Z;  3S1Q I;  2OOY B;  2JUB A;  5T6B A;  2VUG A;  3G71 Z;  1Y1V S;  2QA4 Z;  1VQ4 Z;  2PMZ A;  3GTK I;  3Q87 A;  3I55 1;  1YIT Z;  2O53 A;  3GKQ A;  1Q82 1;  3CC2 Z;  2W04 A;  1W2B Y;  2NVT I;  1I50 I;  2JIR A;  4E2W A;  1YIJ 1;  3NH4 A;  2NVY I;  4QTU A;  1AA6 A;  4MH4 A;  1KD1 1;  2EGT A;  3CCL Z;  3GTL I;  2JA8 I;  1TWF I;  4NBB A;  5D1O A;  4BXX I;  4NBF A;  3I4M I;  3GTO I;  2QRD B;  1VQL Z;  1Q16 A;  1KC8 1;  1YJN 1;  2W03 A;  3FKI I;  3CXC Z;  2RIQ A;  2HF1 A;  2V8K A;  4BBS I;  4A3M I;  1QF8 A;  1QVF Y;  3G71 1;  3GTP I;  1WZN A;  2R7Z I;  1VQ6 Z;  1WII A;  2QA4 1;  3OW2 Y;  3U50 C;  1VQ4 1;  2R92 I;  1WJ2 A;  4E2Z A;  3KIH A;  2B63 I;  2DE7 A;  1YIT 1;  1P9N A;  3IFU A;  3CC2 1;  2E9H A;  3JAM b;  3CQZ I;  1FDI A;  2AKL A;  1L1O C;  3S1M I;  1WW9 A;  2AYD A;  4XX2 A;  1VQK 1;  3TDH B;  3VMH A;  2G2K A;  4CL1 A;  5AN9 F;  1N8R 2;  3D2L A;  5IP9 I;  3GTM S;  1VQL 1;  4S1T A;  3IX0 A;  3S14 I;  3PO3 I;  1VQ6 1;  4A3G I;  3RZD I;  3MON A;  3J80 f;  2VUM I;  2H85 A;  4QTT A;  1X3Z A;  1YJ9 1;  3CXC Y;  3CME 1;  4AYB A;  5CM2 M;  4E31 A;  3J81 b;  3S2D I;  4HH4 A;  1VQ5 Z;  3CCS Z;  5T67 A;  3BG1 B;  1M90 2;  2DE5 A;  3NFZ A;  2M48 A;  2GTI A;  2OTL Z;  1Q86 2;  3NH8 A;  4A3I I;  3CPW Z;  3K7A I;  1YI2 Z;  1YHQ 1;  1X0T A;  3GTG I;  1VQN Z;  3T4N B;  2VF1 A;  1Y1V I;  5C44 I;  2GTH A;  1ZB8 A;  1X3W A;  1NJI 2;  2Q4Z A;  1USP B;  4NBD A;  4RVH A;  3CCV Z;  3TE5 B;  3CC4 Z;  4MXU A;  5C4J I;  4E2Y A;  1VQ5 1;  3D6W A;  3CCS 1;  3VMG A;  3GTQ I;  3D9X A;  1VQK Z;  4RS4 A;  1RO4 A;  4A3J I;  2OTL 1;  1M1K 1;  1YI2 1;  1K8A 1;  1DL6 A;  4MD8 A;  3S15 I;  2VPZ A;  4MD7 A;  4A3B I;  1Z01 A;  2V45 A;  3I4N I;  1VQN 1;  4A3L I;  1KRL A;  1QXF A;  2E2J I;  2JR6 A;  1RLY A;  1RNI A;  2O4H A;  1JJ2 Z;  4NBE A;  3J80 b;  5D1P A;  2OOX B;  3HOY I;  1TWC I;  2IV2 X;  4A3C I;  4HGY A;  2V8J A;  3M4O I;  4TNU A;  1Q7Y 2;  3CPW Y;  2OZK A;  2RT9 A; 
#chains in the Genus database with same CATH homology
 4DGL A;  1YJ9 Z;  3CCV 1;  3CME Z;  2JA6 I;  3CC4 1;  5A2Q b;  1VLA A;  1VQO Z;  3CCQ 1;  3NH5 A;  1Q81 1;  2E2H I;  2RHB A;  2RPR A;  5FLX b;  1VQ7 Z;  3GCF A;  2WAQ A;  3IF8 A;  1N2F A;  3F3P C;  3HOU I;  3GTM I;  3CCR Z;  2IZ3 A;  1Z02 A;  1YHQ Z;  3CMA Z;  1VQP 1;  1RO0 A;  1K73 2;  5D1O B;  2BJO A;  2K3R A;  1KQS Z;  4BY1 I;  3S1N I;  1YUA A;  2KI7 B;  1Z03 A;  1S7M A;  2NVX I;  4Y52 I;  3S16 I;  1M90 1;  3KIF A;  1Y1W I;  4MD9 A;  1VQO 1;  4MRI A;  2P28 A;  1I6H I;  2F4M A;  3ESW A;  1Q86 1;  4MON A;  2E2I I;  2M6N A;  1VQ7 1;  1JJ2 Y;  1TWG I;  3VMI A;  5FLM I;  3EED A;  3CCR 1;  5C3E I;  3CCM Z;  3CC7 Z;  3QWU A;  3VB9 A;  1QYP A;  3MZK B;  2K5R A;  1NJI 1;  3CMA 1;  3S1R I;  1YUK A;  2JNY A;  1K9M 2;  4DK1 A;  5IT9 f;  1VQM Z;  3HOX I;  3EER A;  4RVG A;  4NOZ A;  2QR1 B;  2NVQ I;  1QVG Z;  4NB9 A;  1I3Q I;  3F3F C;  3LUS A;  4NBC A;  4NBH A;  2QKD A;  3CCQ Z;  3HKZ A;  2JMO A;  5T64 A;  3I07 A;  3FQQ A;  3CCE Z;  3I56 Z;  3H3V J;  3BG0 B;  1VQ8 Z;  2V8I A;  3G4S Z;  1KQS Y;  2Q51 A;  1TWA I;  3CCM 1;  3CCU Z;  3CC7 1;  1S72 Z;  4E30 A;  2P3Y A;  2LFU A;  1ZB9 A;  3M3Y I;  3H0G I;  3J81 f;  2WB1 A;  4RVD A;  1VQP Z;  1JWH C;  3S17 I;  1Q82 2;  2JA5 I;  1ML8 A;  2IZ4 A;  1Q7Y 1;  2DE6 A;  1YJW Z;  2JS4 A;  3GTJ I;  2HU9 A;  4NB8 A;  1VQM 1;  4NFR A;  4A3K I;  2RBL A;  2QLV B;  3RZO I;  4A3F I;  4NBG A;  2GU2 A;  3CCJ Z;  2OTJ Z;  1VQ9 Z;  2YU9 I;  1N8R 1;  3VTN A;  1SFO I;  1M1K 2;  1NUI A;  3G6E Z;  1WCM I;  1K8A 2;  1KC8 2;  4RV9 A;  4A3E I;  4E32 A;  5LL6 f;  3FQM A;  3CCE 1;  3I56 1;  1VQ8 1;  3CD6 Z;  3G4S 1;  4BY7 I;  1K73 1;  3CCU 1;  1K83 I;  1QVG Y;  1S72 1;  3HOV I;  2QRC B;  1TWH I;  3MZL B;  3NDI A;  2Y0S A;  2KPI A;  5IP7 I;  4NH1 C;  2QEX Z;  3CCL 1;  4NBA A;  1YJW 1;  1ZH1 A;  5IT9 b;  1Q81 2;  2J6A A;  2ZAE B;  1NP6 A;  4E2X A;  2R93 I;  5C4X I;  1W2B Z;  3CCJ 1;  1TFI A;  1USP A;  3HOW I;  2OTJ 1;  1VQ9 1;  4RVF A;  4A3D I;  3PO2 I;  2LIY A;  3S2H I;  2JA7 I;  3PO3 S;  3G6E 1;  4BBR I;  2PM9 A;  3J7A 4;  1LQL A;  2F4O A;  4X6A I;  4HGZ A;  3CD6 1;  4Y7N I;  4E33 A;  1RQF A;  3I55 Z;  3NDJ A;  3P5J B;  1KD1 2;  2I3C A;  1K9M 1;  3JAM f;  1YIJ Z;  1PFT A;  5A2Q f;  4A93 I;  2PK7 A;  1QVF Z;  2QRE B;  2YAD A;  3OW2 Z;  5FLX f;  4EWC A;  2QEX 1;  1RO2 A;  4DQY B;  2R6M A;  1R9T I;  3HOZ I;  1YJN Z;  3S1Q I;  2OOY B;  2JUB A;  5T6B A;  2VUG A;  3G71 Z;  1Y1V S;  2QA4 Z;  1VQ4 Z;  2PMZ A;  3GTK I;  3Q87 A;  3I55 1;  1YIT Z;  2O53 A;  3GKQ A;  1Q82 1;  3CC2 Z;  2W04 A;  1W2B Y;  2NVT I;  1I50 I;  4E2W A;  1YIJ 1;  3NH4 A;  2NVY I;  4QTU A;  4MH4 A;  1KD1 1;  2EGT A;  3CCL Z;  3GTL I;  2JA8 I;  1TWF I;  4NBB A;  5D1O A;  4BXX I;  4NBF A;  3I4M I;  3GTO I;  2QRD B;  1VQL Z;  1KC8 1;  1YJN 1;  2W03 A;  3FKI I;  3CXC Z;  2RIQ A;  2HF1 A;  2V8K A;  4BBS I;  4A3M I;  1QF8 A;  1QVF Y;  3G71 1;  3GTP I;  2R7Z I;  1VQ6 Z;  1WII A;  2QA4 1;  3OW2 Y;  3U50 C;  1VQ4 1;  2R92 I;  4E2Z A;  3KIH A;  2B63 I;  2DE7 A;  1YIT 1;  1P9N A;  3IFU A;  3CC2 1;  2E9H A;  3JAM b;  3CQZ I;  2AKL A;  1L1O C;  3S1M I;  1WW9 A;  4XX2 A;  1VQK 1;  3TDH B;  3VMH A;  2G2K A;  4CL1 A;  5AN9 F;  1N8R 2;  5IP9 I;  3GTM S;  1VQL 1;  4S1T A;  3IX0 A;  3S14 I;  3PO3 I;  1VQ6 1;  4A3G I;  3RZD I;  3MON A;  3J80 f;  2VUM I;  2H85 A;  4QTT A;  1X3Z A;  1YJ9 1;  3CXC Y;  3CME 1;  4AYB A;  5CM2 M;  4E31 A;  3J81 b;  3S2D I;  4HH4 A;  1VQ5 Z;  3CCS Z;  5T67 A;  3BG1 B;  1M90 2;  2DE5 A;  3NFZ A;  2M48 A;  2GTI A;  2OTL Z;  1Q86 2;  3NH8 A;  4A3I I;  3CPW Z;  3K7A I;  1YI2 Z;  1YHQ 1;  1X0T A;  3GTG I;  1VQN Z;  3T4N B;  2VF1 A;  1Y1V I;  5C44 I;  2GTH A;  1ZB8 A;  1X3W A;  1NJI 2;  2Q4Z A;  1USP B;  4NBD A;  4RVH A;  3CCV Z;  3TE5 B;  3CC4 Z;  4MXU A;  5C4J I;  4E2Y A;  1VQ5 1;  3D6W A;  3CCS 1;  3VMG A;  3GTQ I;  3D9X A;  1VQK Z;  4RS4 A;  1RO4 A;  4A3J I;  2OTL 1;  1M1K 1;  1YI2 1;  1K8A 1;  1DL6 A;  4MD8 A;  3S15 I;  4A3B I;  4MD7 A;  1Z01 A;  3I4N I;  1VQN 1;  4A3L I;  1KRL A;  2E2J I;  2JR6 A;  1RLY A;  1RNI A;  2O4H A;  1JJ2 Z;  4NBE A;  3J80 b;  5D1P A;  2OOX B;  3HOY I;  1TWC I;  4A3C I;  4HGY A;  2V8J A;  3M4O I;  4TNU A;  1Q7Y 2;  3CPW Y;  2OZK A;  2RT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...