4A3BI

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3bI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3bI02
4X6AI 3HOWI 2DE7A 1X3WA 5IP7I 3GTGI 4A3FI 3S1QI 2PK7A 2JNYA 2K5RA 3EERA 1I6HI 2VUMI 3S17I 3GTMI 1PFTA 4Y7NI 1LQLA 4QTUA 3S16I 1N2FA 5C3EI 4A3GI 3VMIA 2J6AA 4BBRI 1SFOI 1VLAA 1TWGI 3S2HI 2DE6A 3RZDI 1I3QI 1ML8A 4NBDA 1YUAA 2NVYI 2JA8I 2JA7I 4BXXI 3U50C 2E2HI 4NB9A 3M4OI 1L1OC 5C4JI 1TWAI 1RO4A 2DE5A 3GTOI 2JR6A 2P3YA 1Y1VS 4NBBA 4NOZA 3PO3S 3H0GI 3HOUI 2BJOA 4NBHA 4A3KI 3S1RI 2B63I 4NBCA 3CQZI 3K7AI 4XX2A 2R93I 2YU9I 1USPA 3S1NI 1NUIA 4A3BI 3PO2I 3GTLI 4NBEA 4A3DI 2HF1A 2E2II 3I4MI 2JS4A 3ESWA 3S2DI 3M3YI 1DL6A 4NBFA 5C4XI 4BBSI 3VB9A 2NVQI 3GTQI 4BY7I 2F4MA 5CM2M 1Y1WI 1ZB9A 3HOYI 3H3VJ 1TWFI 3HOXI 2E2JI 2R92I 3GTMS 4NBAA 2JA6I 1ZB8A 1R9TI 2NVXI 4A3II 4QTTA 5FLMI 4A93I 2JA5I 4A3LI 3HOZI 3I4NI 3S14I 2R7ZI 1TWCI 3GTJI 4MH4A 2AKLA 4A3CI 1Y1VI 4Y52I 1X3ZA 4BY1I 4NBGA 3PO3I 2F4OA 3GKQA 3GTKI 3Q87A 3S1MI 3VMHA 3GCFA 1TWHI 4A3EI 1QYPA 3I07A 4A3MI 1WCMI 1I50I 2RBLA 3GTPI 1RLYA 3D6WA 1K83I 5C44I 3S15I 2NVTI 3VMGA 3RZOI 3HOVI 4A3JI 3FKII 5IP9I 2KPIA 1WW9A 1USPB 1TFIA 3LUSA 4NB8A
chains in the Genus database with same CATH superfamily
3J80b 4X6AI 3HOWI 2DE7A 3TDHB 3I55Z 1I6HI 4TNUA 1N2FA 2OOYB 5FLXf 1SFOI 3IR7A 1VLAA 3J81f 1Z01A 2IZ4A 2JMOA 1VQL1 2JA8I 4NB9A 1TWAI 2O4HA 1VQLZ 3JAMf 3EEDA 2P3YA 4MD9A 4E2WA 1WZNA 3CXCY 3H0GI 2BJOA 3CC71 4NBHA 2P28A 2B63I 4XX2A 3CC7Z 1USPA 3S1NI 4E32A 4E2YA 3GTLI 2OTL1 2GTIA 1VQP1 1K8A2 4MONA 3CD61 1SIWA 2OTLZ 1DL6A 4NBFA 3OW2Y 4BBSI 1AA6A 3GTQI 5CM2M 4RVHA 1VQPZ 1ZB9A 3CC4Z 3CD6Z 1FDIA 1YI21 2WB1A 1TWFI 3HOXI 2E2JI 4NBAA 1K732 5LL6f 1ZB8A 2O53A 2RPRA 1YI2Z 2NVXI 2V3VA 1QF8A 4MXUA 2JA5I 1Z03A 4A3LI 1KQSZ 2OOXB 1K9M1 3I4NI 2EGTA 2R6MA 2R7ZI 1WIIA 1W2BY 2AKLA 4DQYB 4BY1I 1ZH1A 4NBGA 3PO3I 2PMZA 2F4OA 3GKQA 3FQQA 3S1MI 1YIT1 2V45A 3GTPI 1RLYA 2VPZA 3NDJA 1Q7Y2 1Q811 1YITZ 5D1PA 2QEX1 1S721 3RZOI 1NJI2 5IP9I 3NDIA 2V8JA 3CCE1 1USPB 2JIRA 2QEXZ 1TFIA 5AN9F 4E33A 1Q822 2QRCB 1X3WA 3NH5A 3CCEZ 3GTGI 4A3FI 2PK7A 3EERA 3CCL1 3GTMI 4Y7NI 1LQLA 2QR1B 2V8KA 2JUBA 1KC82 4RVDA 3HKZA 3VMIA 3CCLZ 1YJ91 2QKDA 3S2HI 1W2BZ 1I3QI 1YUAA 2G2KA 2E2HI 1L1OC 2OZKA 4NH1C 1YJ9Z 2JIOA 4NBBA 5IT9b 4NOZA 3CMA1 3G6E1 4A3KI 1NP6A 2GTHA 3MZLB 2JIPA 2QREB 1Y8CA 1QVGY 3G6EZ 1NUIA 3IF8A 2IZ3A 3MZKB 4A3DI 2E2II 1KD12 4DGLA 3ESWA 3CCS1 4BY7I 5T67A 1M902 5D1OA 3HOYI 1YJW1 1VQM1 3IFUA 3CCSZ 1JJ2Y 3NFZA 2R92I 3TE5B 1YJWZ 1VQMZ 2JA6I 2RHBA 4QTTA 5FLMI 1KRLA 2QA41 1VQ61 4A93I 4MD7A 1TWCI 4MD8A 2QA4Z 1VQ6Z 3CPWY 1K731 4AYBA 4RV9A 4A3CI 2AYDA 3CCR1 1QVFY 2Y0SA 1QVGZ 4DK1A 2YADA 3VMHA 3I561 1TWHI 4A3EI 3CCRZ 3CCQ1 1RO2A 3CCU1 2LIYA 3VTNA 3I56Z 3S15I 2NVTI 1RNIA 3CCQZ 4MRIA 3CCUZ 4A3JI 2LFUA 3FKII 1QXFA 1JJ2Z 1WW9A 3CXCZ 4NB8A 1VQ41 2W03A 5IP7I 1Q7Y1 1N8R2 2VUMI 1VQ4Z 4QTUA 3S16I 5C3EI 4A3GI 4RVGA 5D1OB 2W04A 3OW2Z 1TWGI 3CPWZ 3CCV1 3RZDI 1Q821 3IX0A 2JA7I 3M4OI 1QVFZ 5C4JI 4NFRA 4HH4A 3CCVZ 2WAQA 2DE5A 1S72Z 3D2LA 2JR6A 1Y1VS 3CC21 3HOUI 3J80f 1VQ71 5IT9f 3S1RI 2PM9A 3CQZI 3CC2Z 1YUKA 1VQ7Z 4A3BI 3PO2I 1Z02A 3KIHA 2HF1A 3I4MI 2JS4A 5A2Qb 3S2DI 3M3YI 3P5JB 5C4XI 4RVFA 3BG1B 1M1K2 1RQFA 2RT9A 2VPXA 3QWUA 1KD11 4E30A 3CMAZ 3D9XA 1S7MA 5T6BA 4RS4A 3HOZI 1VQ81 3NH4A 1X3ZA 2Q51A 1Q862 4E2XA 3GTKI 2RIQA 1VQ8Z 1QYPA 3I07A 4A3MI 2M6NA 1K8A1 1JWHC 1K83I 2NAPA 5C44I 3J7A4 1X0TA 3HOVI 1RO0A 1KQSY 1YJN1 3CME1 3S1QI 3G711 2JNYA 2K5RA 3S17I 5FLXb 1PFTA 2QRDB 1YJNZ 3CMEZ 3G71Z 3J81b 2J6AA 4BBRI 1VQ91 1P9NA 2DE6A 1ML8A 4NBDA 2NVYI 4BXXI 3T4NB 1VQ9Z 3U50C 3CC41 3JAMb 2VF1A 3MONA 1N8R1 1RO4A 2JIQA 3GTOI 2VUGA 2VPWA 3PO3S 3CCM1 1YHQ1 4NBCA 3K7AI 2KI7B 3G4S1 2R93I 2YU9I 3NH8A 1NJI1 3CCMZ 2VPYA 2E7ZA 1YHQZ 1Q16A 4NBEA 3G4SZ 5T64A 1VQO1 2LEXA 3VB9A 2NVQI 3F3FC 2F4MA 5A2Qf 2JIMA 1Y1WI 2ZAEB 3KIFA 1KC81 1YIJ1 1VQOZ 1K9M2 3H3VJ 1FDOA 1VQN1 3GTMS 1YIJZ 2Q4ZA 1R9TI 1VQNZ 4A3II 2V8IA 3CCJ1 4CL1A 1M1K1 4S1TA 2M48A 3S14I 1Q812 3CCJZ 4HGYA 2H85A 3GTJI 3FQMA 2OTJ1 2E9HA 2HU9A 4MH4A 3BG0B 4Y52I 1Y1VI 4HGZA 1VQ51 4E2ZA 1VQK1 2OTJZ 3Q87A 2GU2A 3GCFA 1WJ2A 2IV2X 4EWCA 1WCMI 1I50I 2RBLA 1VQ5Z 3D6WA 1VQKZ 4E31A 3F3PC 3VMGA 2QLVB 1M901 2KPIA 2I3CA 1Q861 2K3RA 3I551 3LUSA
chains in the Genus database with same CATH topology
3J80b 4X6AI 3HOWI 2DE7A 3TDHB 3I55Z 1I6HI 4TNUA 1N2FA 2OOYB 5FLXf 1SFOI 1VLAA 3J81f 1Z01A 2IZ4A 2JMOA 1VQL1 2JA8I 4NB9A 1TWAI 2O4HA 1VQLZ 3JAMf 3EEDA 2P3YA 4MD9A 4E2WA 3CXCY 3H0GI 2BJOA 3CC71 4NBHA 2P28A 2B63I 4XX2A 3CC7Z 1USPA 3S1NI 4E32A 4E2YA 3GTLI 2OTL1 2GTIA 1VQP1 1K8A2 4MONA 3CD61 2OTLZ 1DL6A 4NBFA 3OW2Y 4BBSI 3GTQI 5CM2M 4RVHA 1VQPZ 1ZB9A 3CC4Z 3CD6Z 1YI21 2WB1A 1TWFI 3HOXI 2E2JI 4NBAA 1K732 5LL6f 1ZB8A 2O53A 2RPRA 1YI2Z 2NVXI 1QF8A 4MXUA 2JA5I 1Z03A 4A3LI 1KQSZ 2OOXB 1K9M1 3I4NI 2EGTA 2R6MA 2R7ZI 1WIIA 1W2BY 2AKLA 4DQYB 4BY1I 1ZH1A 4NBGA 3PO3I 2PMZA 2F4OA 3GKQA 3FQQA 3S1MI 1YIT1 3GTPI 1RLYA 3NDJA 1Q7Y2 1Q811 1YITZ 5D1PA 2QEX1 1S721 3RZOI 1NJI2 5IP9I 3NDIA 2V8JA 3CCE1 1USPB 2QEXZ 1TFIA 5AN9F 4E33A 1Q822 2QRCB 1X3WA 3NH5A 3CCEZ 3GTGI 4A3FI 2PK7A 3EERA 3CCL1 3GTMI 4Y7NI 1LQLA 2QR1B 2V8KA 2JUBA 1KC82 4RVDA 3HKZA 3VMIA 3CCLZ 1YJ91 2QKDA 3S2HI 1W2BZ 1I3QI 1YUAA 2G2KA 2E2HI 1L1OC 2OZKA 4NH1C 1YJ9Z 4NBBA 5IT9b 4NOZA 3CMA1 3G6E1 4A3KI 1NP6A 2GTHA 3MZLB 2QREB 1QVGY 3G6EZ 1NUIA 3IF8A 2IZ3A 3MZKB 4A3DI 2E2II 1KD12 4DGLA 3ESWA 3CCS1 4BY7I 5T67A 1M902 5D1OA 3HOYI 1YJW1 1VQM1 3IFUA 3CCSZ 1JJ2Y 3NFZA 2R92I 3TE5B 1YJWZ 1VQMZ 2JA6I 2RHBA 4QTTA 5FLMI 1KRLA 2QA41 1VQ61 4A93I 4MD7A 1TWCI 4MD8A 2QA4Z 1VQ6Z 3CPWY 1K731 4AYBA 4RV9A 4A3CI 3CCR1 1QVFY 2Y0SA 1QVGZ 4DK1A 2YADA 3VMHA 3I561 1TWHI 4A3EI 3CCRZ 3CCQ1 1RO2A 3CCU1 2LIYA 3VTNA 3I56Z 3S15I 2NVTI 1RNIA 3CCQZ 4MRIA 3CCUZ 4A3JI 2LFUA 3FKII 1JJ2Z 1WW9A 3CXCZ 4NB8A 1VQ41 2W03A 5IP7I 1Q7Y1 1N8R2 2VUMI 1VQ4Z 4QTUA 3S16I 5C3EI 4A3GI 4RVGA 5D1OB 2W04A 3OW2Z 1TWGI 3CPWZ 3CCV1 3RZDI 1Q821 3IX0A 2JA7I 3M4OI 1QVFZ 5C4JI 4NFRA 4HH4A 3CCVZ 2WAQA 2DE5A 1S72Z 2JR6A 1Y1VS 3CC21 3HOUI 3J80f 1VQ71 5IT9f 3S1RI 2PM9A 3CQZI 3CC2Z 1YUKA 1VQ7Z 4A3BI 3PO2I 1Z02A 3KIHA 2HF1A 3I4MI 2JS4A 5A2Qb 3S2DI 3M3YI 3P5JB 5C4XI 4RVFA 3BG1B 1M1K2 1RQFA 2RT9A 3QWUA 1KD11 4E30A 3CMAZ 3D9XA 1S7MA 5T6BA 4RS4A 3HOZI 1VQ81 3NH4A 1X3ZA 2Q51A 1Q862 4E2XA 3GTKI 2RIQA 1VQ8Z 1QYPA 3I07A 4A3MI 2M6NA 1K8A1 1K83I 1JWHC 5C44I 3J7A4 1X0TA 3HOVI 1RO0A 1KQSY 1YJN1 3CME1 3S1QI 3G711 2JNYA 2K5RA 3S17I 5FLXb 1PFTA 2QRDB 1YJNZ 3CMEZ 3G71Z 3J81b 2J6AA 4BBRI 1VQ91 1P9NA 2DE6A 1ML8A 4NBDA 2NVYI 4BXXI 3T4NB 1VQ9Z 3U50C 3CC41 3JAMb 2VF1A 3MONA 1N8R1 1RO4A 3GTOI 2VUGA 3PO3S 3CCM1 1YHQ1 4NBCA 3K7AI 2KI7B 3G4S1 2R93I 2YU9I 3NH8A 1NJI1 3CCMZ 1YHQZ 4NBEA 3G4SZ 5T64A 1VQO1 3VB9A 2NVQI 3F3FC 2F4MA 5A2Qf 1Y1WI 2ZAEB 3KIFA 1KC81 1YIJ1 1VQOZ 1K9M2 3H3VJ 1VQN1 3GTMS 1YIJZ 2Q4ZA 1R9TI 1VQNZ 4A3II 2V8IA 3CCJ1 4CL1A 1M1K1 4S1TA 2M48A 3S14I 1Q812 3CCJZ 4HGYA 2H85A 3GTJI 3FQMA 2OTJ1 2E9HA 2HU9A 4MH4A 3BG0B 4Y52I 1Y1VI 4HGZA 1VQ51 4E2ZA 1VQK1 2OTJZ 3Q87A 2GU2A 3GCFA 4EWCA 1WCMI 1I50I 2RBLA 1VQ5Z 3D6WA 1VQKZ 4E31A 3F3PC 3VMGA 2QLVB 1M901 2KPIA 2I3CA 1Q861 2K3RA 3I551 3LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6A I;  3HOW I;  2DE7 A;  1X3W A;  5IP7 I;  3GTG I;  4A3F I;  3S1Q I;  2PK7 A;  2JNY A;  2K5R A;  3EER A;  1I6H I;  2VUM I;  3S17 I;  3GTM I;  1PFT A;  4Y7N I;  1LQL A;  4QTU A;  3S16 I;  1N2F A;  5C3E I;  4A3G I;  3VMI A;  2J6A A;  4BBR I;  1SFO I;  1VLA A;  1TWG I;  3S2H I;  2DE6 A;  3RZD I;  1I3Q I;  1ML8 A;  4NBD A;  1YUA A;  2NVY I;  2JA8 I;  2JA7 I;  4BXX I;  3U50 C;  2E2H I;  4NB9 A;  3M4O I;  1L1O C;  5C4J I;  1TWA I;  1RO4 A;  2DE5 A;  3GTO I;  2JR6 A;  2P3Y A;  1Y1V S;  4NBB A;  4NOZ A;  3PO3 S;  3H0G I;  3HOU I;  2BJO A;  4NBH A;  4A3K I;  3S1R I;  2B63 I;  4NBC A;  3CQZ I;  3K7A I;  4XX2 A;  2R93 I;  2YU9 I;  1USP A;  3S1N I;  1NUI A;  4A3B I;  3PO2 I;  3GTL I;  4NBE A;  4A3D I;  2HF1 A;  2E2I I;  3I4M I;  2JS4 A;  3ESW A;  3S2D I;  3M3Y I;  1DL6 A;  4NBF A;  5C4X I;  4BBS I;  3VB9 A;  2NVQ I;  3GTQ I;  4BY7 I;  2F4M A;  5CM2 M;  1Y1W I;  1ZB9 A;  3HOY I;  3H3V J;  1TWF I;  3HOX I;  2E2J I;  2R92 I;  3GTM S;  4NBA A;  2JA6 I;  1ZB8 A;  1R9T I;  2NVX I;  4A3I I;  4QTT A;  5FLM I;  4A93 I;  2JA5 I;  4A3L I;  3HOZ I;  3I4N I;  3S14 I;  2R7Z I;  1TWC I;  3GTJ I;  4MH4 A;  2AKL A;  4A3C I;  1Y1V I;  4Y52 I;  1X3Z A;  4BY1 I;  4NBG A;  3PO3 I;  2F4O A;  3GKQ A;  3GTK I;  3Q87 A;  3S1M I;  3VMH A;  3GCF A;  1TWH I;  4A3E I;  1QYP A;  3I07 A;  4A3M I;  1WCM I;  1I50 I;  2RBL A;  3GTP I;  1RLY A;  3D6W A;  1K83 I;  5C44 I;  3S15 I;  2NVT I;  3VMG A;  3RZO I;  3HOV I;  4A3J I;  3FKI I;  5IP9 I;  2KPI A;  1WW9 A;  1USP B;  1TFI A;  3LUS A;  4NB8 A; 
#chains in the Genus database with same CATH topology
 3J80 b;  4X6A I;  3HOW I;  2DE7 A;  3TDH B;  3I55 Z;  1I6H I;  4TNU A;  1N2F A;  2OOY B;  5FLX f;  1SFO I;  3IR7 A;  1VLA A;  3J81 f;  1Z01 A;  2IZ4 A;  2JMO A;  1VQL 1;  2JA8 I;  4NB9 A;  1TWA I;  2O4H A;  1VQL Z;  3JAM f;  3EED A;  2P3Y A;  4MD9 A;  4E2W A;  1WZN A;  3CXC Y;  3H0G I;  2BJO A;  3CC7 1;  4NBH A;  2P28 A;  2B63 I;  4XX2 A;  3CC7 Z;  1USP A;  3S1N I;  4E32 A;  4E2Y A;  3GTL I;  2OTL 1;  2GTI A;  1VQP 1;  1K8A 2;  4MON A;  3CD6 1;  1SIW A;  2OTL Z;  1DL6 A;  4NBF A;  3OW2 Y;  4BBS I;  1AA6 A;  3GTQ I;  5CM2 M;  4RVH A;  1VQP Z;  1ZB9 A;  3CC4 Z;  3CD6 Z;  1FDI A;  1YI2 1;  2WB1 A;  1TWF I;  3HOX I;  2E2J I;  4NBA A;  1K73 2;  5LL6 f;  1ZB8 A;  2O53 A;  2RPR A;  1YI2 Z;  2NVX I;  2V3V A;  1QF8 A;  4MXU A;  2JA5 I;  1Z03 A;  4A3L I;  1KQS Z;  2OOX B;  1K9M 1;  3I4N I;  2EGT A;  2R6M A;  2R7Z I;  1WII A;  1W2B Y;  2AKL A;  4DQY B;  4BY1 I;  1ZH1 A;  4NBG A;  3PO3 I;  2PMZ A;  2F4O A;  3GKQ A;  3FQQ A;  3S1M I;  1YIT 1;  2V45 A;  3GTP I;  1RLY A;  2VPZ A;  3NDJ A;  1Q7Y 2;  1Q81 1;  1YIT Z;  5D1P A;  2QEX 1;  1S72 1;  3RZO I;  1NJI 2;  5IP9 I;  3NDI A;  2V8J A;  3CCE 1;  1USP B;  2JIR A;  2QEX Z;  1TFI A;  5AN9 F;  4E33 A;  1Q82 2;  2QRC B;  1X3W A;  3NH5 A;  3CCE Z;  3GTG I;  4A3F I;  2PK7 A;  3EER A;  3CCL 1;  3GTM I;  4Y7N I;  1LQL A;  2QR1 B;  2V8K A;  2JUB A;  1KC8 2;  4RVD A;  3HKZ A;  3VMI A;  3CCL Z;  1YJ9 1;  2QKD A;  3S2H I;  1W2B Z;  1I3Q I;  1YUA A;  2G2K A;  2E2H I;  1L1O C;  2OZK A;  4NH1 C;  1YJ9 Z;  2JIO A;  4NBB A;  5IT9 b;  4NOZ A;  3CMA 1;  3G6E 1;  4A3K I;  1NP6 A;  2GTH A;  3MZL B;  2JIP A;  2QRE B;  1Y8C A;  1QVG Y;  3G6E Z;  1NUI A;  3IF8 A;  2IZ3 A;  3MZK B;  4A3D I;  2E2I I;  1KD1 2;  4DGL A;  3ESW A;  3CCS 1;  4BY7 I;  5T67 A;  1M90 2;  5D1O A;  3HOY I;  1YJW 1;  1VQM 1;  3IFU A;  3CCS Z;  1JJ2 Y;  3NFZ A;  2R92 I;  3TE5 B;  1YJW Z;  1VQM Z;  2JA6 I;  2RHB A;  4QTT A;  5FLM I;  1KRL A;  2QA4 1;  1VQ6 1;  4A93 I;  4MD7 A;  1TWC I;  4MD8 A;  2QA4 Z;  1VQ6 Z;  3CPW Y;  1K73 1;  4AYB A;  4RV9 A;  4A3C I;  2AYD A;  3CCR 1;  1QVF Y;  2Y0S A;  1QVG Z;  4DK1 A;  2YAD A;  3VMH A;  3I56 1;  1TWH I;  4A3E I;  3CCR Z;  3CCQ 1;  1RO2 A;  3CCU 1;  2LIY A;  3VTN A;  3I56 Z;  3S15 I;  2NVT I;  1RNI A;  3CCQ Z;  4MRI A;  3CCU Z;  4A3J I;  2LFU A;  3FKI I;  1QXF A;  1JJ2 Z;  1WW9 A;  3CXC Z;  4NB8 A;  1VQ4 1;  2W03 A;  5IP7 I;  1Q7Y 1;  1N8R 2;  2VUM I;  1VQ4 Z;  4QTU A;  3S16 I;  5C3E I;  4A3G I;  4RVG A;  5D1O B;  2W04 A;  3OW2 Z;  1TWG I;  3CPW Z;  3CCV 1;  3RZD I;  1Q82 1;  3IX0 A;  2JA7 I;  3M4O I;  1QVF Z;  5C4J I;  4NFR A;  4HH4 A;  3CCV Z;  2WAQ A;  2DE5 A;  1S72 Z;  3D2L A;  2JR6 A;  1Y1V S;  3CC2 1;  3HOU I;  3J80 f;  1VQ7 1;  5IT9 f;  3S1R I;  2PM9 A;  3CQZ I;  3CC2 Z;  1YUK A;  1VQ7 Z;  4A3B I;  3PO2 I;  1Z02 A;  3KIH A;  2HF1 A;  3I4M I;  2JS4 A;  5A2Q b;  3S2D I;  3M3Y I;  3P5J B;  5C4X I;  4RVF A;  3BG1 B;  1M1K 2;  1RQF A;  2RT9 A;  2VPX A;  3QWU A;  1KD1 1;  4E30 A;  3CMA Z;  3D9X A;  1S7M A;  5T6B A;  4RS4 A;  3HOZ I;  1VQ8 1;  3NH4 A;  1X3Z A;  2Q51 A;  1Q86 2;  4E2X A;  3GTK I;  2RIQ A;  1VQ8 Z;  1QYP A;  3I07 A;  4A3M I;  2M6N A;  1K8A 1;  1JWH C;  1K83 I;  2NAP A;  5C44 I;  3J7A 4;  1X0T A;  3HOV I;  1RO0 A;  1KQS Y;  1YJN 1;  3CME 1;  3S1Q I;  3G71 1;  2JNY A;  2K5R A;  3S17 I;  5FLX b;  1PFT A;  2QRD B;  1YJN Z;  3CME Z;  3G71 Z;  3J81 b;  2J6A A;  4BBR I;  1VQ9 1;  1P9N A;  2DE6 A;  1ML8 A;  4NBD A;  2NVY I;  4BXX I;  3T4N B;  1VQ9 Z;  3U50 C;  3CC4 1;  3JAM b;  2VF1 A;  3MON A;  1N8R 1;  1RO4 A;  2JIQ A;  3GTO I;  2VUG A;  2VPW A;  3PO3 S;  3CCM 1;  1YHQ 1;  4NBC A;  3K7A I;  2KI7 B;  3G4S 1;  2R93 I;  2YU9 I;  3NH8 A;  1NJI 1;  3CCM Z;  2VPY A;  2E7Z A;  1YHQ Z;  1Q16 A;  4NBE A;  3G4S Z;  5T64 A;  1VQO 1;  2LEX A;  3VB9 A;  2NVQ I;  3F3F C;  2F4M A;  5A2Q f;  2JIM A;  1Y1W I;  2ZAE B;  3KIF A;  1KC8 1;  1YIJ 1;  1VQO Z;  1K9M 2;  3H3V J;  1FDO A;  1VQN 1;  3GTM S;  1YIJ Z;  2Q4Z A;  1R9T I;  1VQN Z;  4A3I I;  2V8I A;  3CCJ 1;  4CL1 A;  1M1K 1;  4S1T A;  2M48 A;  3S14 I;  1Q81 2;  3CCJ Z;  4HGY A;  2H85 A;  3GTJ I;  3FQM A;  2OTJ 1;  2E9H A;  2HU9 A;  4MH4 A;  3BG0 B;  4Y52 I;  1Y1V I;  4HGZ A;  1VQ5 1;  4E2Z A;  1VQK 1;  2OTJ Z;  3Q87 A;  2GU2 A;  3GCF A;  1WJ2 A;  2IV2 X;  4EWC A;  1WCM I;  1I50 I;  2RBL A;  1VQ5 Z;  3D6W A;  1VQK Z;  4E31 A;  3F3P C;  3VMG A;  2QLV B;  1M90 1;  2KPI A;  2I3C A;  1Q86 1;  2K3R A;  3I55 1;  3LUS A; 
#chains in the Genus database with same CATH homology
 3J80 b;  4X6A I;  3HOW I;  2DE7 A;  3TDH B;  3I55 Z;  1I6H I;  4TNU A;  1N2F A;  2OOY B;  5FLX f;  1SFO I;  1VLA A;  3J81 f;  1Z01 A;  2IZ4 A;  2JMO A;  1VQL 1;  2JA8 I;  4NB9 A;  1TWA I;  2O4H A;  1VQL Z;  3JAM f;  3EED A;  2P3Y A;  4MD9 A;  4E2W A;  3CXC Y;  3H0G I;  2BJO A;  3CC7 1;  4NBH A;  2P28 A;  2B63 I;  4XX2 A;  3CC7 Z;  1USP A;  3S1N I;  4E32 A;  4E2Y A;  3GTL I;  2OTL 1;  2GTI A;  1VQP 1;  1K8A 2;  4MON A;  3CD6 1;  2OTL Z;  1DL6 A;  4NBF A;  3OW2 Y;  4BBS I;  3GTQ I;  5CM2 M;  4RVH A;  1VQP Z;  1ZB9 A;  3CC4 Z;  3CD6 Z;  1YI2 1;  2WB1 A;  1TWF I;  3HOX I;  2E2J I;  4NBA A;  1K73 2;  5LL6 f;  1ZB8 A;  2O53 A;  2RPR A;  1YI2 Z;  2NVX I;  1QF8 A;  4MXU A;  2JA5 I;  1Z03 A;  4A3L I;  1KQS Z;  2OOX B;  1K9M 1;  3I4N I;  2EGT A;  2R6M A;  2R7Z I;  1WII A;  1W2B Y;  2AKL A;  4DQY B;  4BY1 I;  1ZH1 A;  4NBG A;  3PO3 I;  2PMZ A;  2F4O A;  3GKQ A;  3FQQ A;  3S1M I;  1YIT 1;  3GTP I;  1RLY A;  3NDJ A;  1Q7Y 2;  1Q81 1;  1YIT Z;  5D1P A;  2QEX 1;  1S72 1;  3RZO I;  1NJI 2;  5IP9 I;  3NDI A;  2V8J A;  3CCE 1;  1USP B;  2QEX Z;  1TFI A;  5AN9 F;  4E33 A;  1Q82 2;  2QRC B;  1X3W A;  3NH5 A;  3CCE Z;  3GTG I;  4A3F I;  2PK7 A;  3EER A;  3CCL 1;  3GTM I;  4Y7N I;  1LQL A;  2QR1 B;  2V8K A;  2JUB A;  1KC8 2;  4RVD A;  3HKZ A;  3VMI A;  3CCL Z;  1YJ9 1;  2QKD A;  3S2H I;  1W2B Z;  1I3Q I;  1YUA A;  2G2K A;  2E2H I;  1L1O C;  2OZK A;  4NH1 C;  1YJ9 Z;  4NBB A;  5IT9 b;  4NOZ A;  3CMA 1;  3G6E 1;  4A3K I;  1NP6 A;  2GTH A;  3MZL B;  2QRE B;  1QVG Y;  3G6E Z;  1NUI A;  3IF8 A;  2IZ3 A;  3MZK B;  4A3D I;  2E2I I;  1KD1 2;  4DGL A;  3ESW A;  3CCS 1;  4BY7 I;  5T67 A;  1M90 2;  5D1O A;  3HOY I;  1YJW 1;  1VQM 1;  3IFU A;  3CCS Z;  1JJ2 Y;  3NFZ A;  2R92 I;  3TE5 B;  1YJW Z;  1VQM Z;  2JA6 I;  2RHB A;  4QTT A;  5FLM I;  1KRL A;  2QA4 1;  1VQ6 1;  4A93 I;  4MD7 A;  1TWC I;  4MD8 A;  2QA4 Z;  1VQ6 Z;  3CPW Y;  1K73 1;  4AYB A;  4RV9 A;  4A3C I;  3CCR 1;  1QVF Y;  2Y0S A;  1QVG Z;  4DK1 A;  2YAD A;  3VMH A;  3I56 1;  1TWH I;  4A3E I;  3CCR Z;  3CCQ 1;  1RO2 A;  3CCU 1;  2LIY A;  3VTN A;  3I56 Z;  3S15 I;  2NVT I;  1RNI A;  3CCQ Z;  4MRI A;  3CCU Z;  4A3J I;  2LFU A;  3FKI I;  1JJ2 Z;  1WW9 A;  3CXC Z;  4NB8 A;  1VQ4 1;  2W03 A;  5IP7 I;  1Q7Y 1;  1N8R 2;  2VUM I;  1VQ4 Z;  4QTU A;  3S16 I;  5C3E I;  4A3G I;  4RVG A;  5D1O B;  2W04 A;  3OW2 Z;  1TWG I;  3CPW Z;  3CCV 1;  3RZD I;  1Q82 1;  3IX0 A;  2JA7 I;  3M4O I;  1QVF Z;  5C4J I;  4NFR A;  4HH4 A;  3CCV Z;  2WAQ A;  2DE5 A;  1S72 Z;  2JR6 A;  1Y1V S;  3CC2 1;  3HOU I;  3J80 f;  1VQ7 1;  5IT9 f;  3S1R I;  2PM9 A;  3CQZ I;  3CC2 Z;  1YUK A;  1VQ7 Z;  4A3B I;  3PO2 I;  1Z02 A;  3KIH A;  2HF1 A;  3I4M I;  2JS4 A;  5A2Q b;  3S2D I;  3M3Y I;  3P5J B;  5C4X I;  4RVF A;  3BG1 B;  1M1K 2;  1RQF A;  2RT9 A;  3QWU A;  1KD1 1;  4E30 A;  3CMA Z;  3D9X A;  1S7M A;  5T6B A;  4RS4 A;  3HOZ I;  1VQ8 1;  3NH4 A;  1X3Z A;  2Q51 A;  1Q86 2;  4E2X A;  3GTK I;  2RIQ A;  1VQ8 Z;  1QYP A;  3I07 A;  4A3M I;  2M6N A;  1K8A 1;  1K83 I;  1JWH C;  5C44 I;  3J7A 4;  1X0T A;  3HOV I;  1RO0 A;  1KQS Y;  1YJN 1;  3CME 1;  3S1Q I;  3G71 1;  2JNY A;  2K5R A;  3S17 I;  5FLX b;  1PFT A;  2QRD B;  1YJN Z;  3CME Z;  3G71 Z;  3J81 b;  2J6A A;  4BBR I;  1VQ9 1;  1P9N A;  2DE6 A;  1ML8 A;  4NBD A;  2NVY I;  4BXX I;  3T4N B;  1VQ9 Z;  3U50 C;  3CC4 1;  3JAM b;  2VF1 A;  3MON A;  1N8R 1;  1RO4 A;  3GTO I;  2VUG A;  3PO3 S;  3CCM 1;  1YHQ 1;  4NBC A;  3K7A I;  2KI7 B;  3G4S 1;  2R93 I;  2YU9 I;  3NH8 A;  1NJI 1;  3CCM Z;  1YHQ Z;  4NBE A;  3G4S Z;  5T64 A;  1VQO 1;  3VB9 A;  2NVQ I;  3F3F C;  2F4M A;  5A2Q f;  1Y1W I;  2ZAE B;  3KIF A;  1KC8 1;  1YIJ 1;  1VQO Z;  1K9M 2;  3H3V J;  1VQN 1;  3GTM S;  1YIJ Z;  2Q4Z A;  1R9T I;  1VQN Z;  4A3I I;  2V8I A;  3CCJ 1;  4CL1 A;  1M1K 1;  4S1T A;  2M48 A;  3S14 I;  1Q81 2;  3CCJ Z;  4HGY A;  2H85 A;  3GTJ I;  3FQM A;  2OTJ 1;  2E9H A;  2HU9 A;  4MH4 A;  3BG0 B;  4Y52 I;  1Y1V I;  4HGZ A;  1VQ5 1;  4E2Z A;  1VQK 1;  2OTJ Z;  3Q87 A;  2GU2 A;  3GCF A;  4EWC A;  1WCM I;  1I50 I;  2RBL A;  1VQ5 Z;  3D6W A;  1VQK Z;  4E31 A;  3F3P C;  3VMG A;  2QLV B;  1M90 1;  2KPI A;  2I3C A;  1Q86 1;  2K3R A;  3I55 1;  3LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...