1VQ5Z

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq5Z00
1VQOZ 1M902 2QA4Z 3OW2Y 1Q821 1VQ4Z 2OTJ1 1QVGY 1VQO1 1M1K2 1Q812 3I56Z 1VQN1 3CCLZ 1M1K1 1VQMZ 1KQSY 3CCEZ 3CCSZ 1KQSZ 1K9M2 3CCRZ 3CXCZ 1Q822 2OTL1 1S72Z 1NJI2 1YHQZ 3CCM1 3G4S1 3CCR1 1VQKZ 1YIJZ 1YIT1 1S721 3CCJZ 1VQ81 3I55Z 3CMA1 1N8R2 1KD11 3G4SZ 1VQ61 1YJW1 1VQK1 1QVFZ 1YITZ 3CCVZ 1VQ91 1YJ91 3CCJ1 1VQ8Z 3CC21 1Q861 2QEX1 2QA41 1YJN1 1Q7Y2 3G6E1 3CXCY 1JJ2Y 1W2BY 2QEXZ 1VQLZ 1M901 1VQNZ 3G6EZ 1VQ41 3CC4Z 1KD12 1Q862 3G711 1VQM1 3CCE1 3CCS1 1VQPZ 3I561 1K9M1 1Q811 1VQL1 3CCL1 3CC41 1YI21 3G71Z 3OW2Z 1N8R1 1YHQ1 1VQP1 1K731 1K8A2 1Q7Y1 2OTLZ 1K732 3CME1 1YIJ1 1KC82 1VQ5Z 1KC81 1YI2Z 1W2BZ 3CCMZ 3CPWY 3CMAZ 1K8A1 3CC71 1NJI1 3CD6Z 1JJ2Z 1YJWZ 3CMEZ 3CCQ1 3CCU1 1QVGZ 1VQ51 1VQ9Z 3I551 1VQ7Z 3CC7Z 3CD61 1VQ6Z 3CPWZ 1YJNZ 3CCQZ 3CCUZ 3CCV1 1YJ9Z 1QVFY 3CC2Z 1VQ71 2OTJZ
chains in the Genus database with same CATH superfamily
2JIRA 2JS4A 5C3EI 4E33A 2LIYA 3EERA 1RO4A 4TNUA 2E2II 1M1K2 2V8KA 1NP6A 4MD8A 1SFOI 1M1K1 3D2LA 1TWGI 4EWCA 3GTJI 3CCRZ 2VF1A 3CXCZ 2VPXA 1S72Z 3J81b 3GTOI 3CCM1 2K5RA 4RVGA 3G4S1 4NBEA 1VQKZ 2QRCB 3CCJZ 5FLXf 3I55Z 1I6HI 3CMA1 1N8R2 1RNIA 1VQ61 4MD9A 4NBAA 1QVFZ 3RZDI 1TWHI 1YITZ 4NB9A 3CCVZ 1RQFA 1VQ91 2I3CA 2JIQA 4E2YA 2R6MA 1ZH1A 2QA41 1QYPA 3KIFA 3FQMA 3HOVI 4MH4A 2QLVB 1VQLZ 3S15I 4HH4A 4NBDA 1N2FA 1S7MA 2NVXI 2AKLA 5IP9I 2OOXB 1I3QI 5T64A 3HOYI 3G711 3CCS1 2O53A 1Y1WI 3I561 3VB9A 1K9M1 4NBFA 2KPIA 4A3KI 2JIMA 3OW2Z 4A3FI 3S1MI 4A3CI 1Y1VS 3HOUI 1FDIA 3CME1 4NH1C 2HF1A 3JAMb 3CCMZ 2P28A 3CC71 1QXFA 1TWFI 1JJ2Z 2J6AA 3RZOI 3CCU1 2W04A 4NFRA 3CD61 1VQ6Z 4S1TA 1X0TA 5FLMI 1YJ9Z 2VPWA 2QRDB 4NBBA 1VQ71 1Y8CA 2OTJZ 3S1NI 1VQOZ 2QA4Z 4DK1A 2IV2X 3OW2Y 2R93I 3U50C 2P3YA 2QR1B 1VQ4Z 1NUIA 1RO0A 2E7ZA 3T4NB 3S2HI 2EGTA 4BBSI 2RBLA 1Q812 5A2Qb 1VQN1 1ZB9A 5T6BA 2JUBA 1ZB8A 4NB8A 1KQSY 5IP7I 2Y0SA 3H3VJ 3CCEZ 1KQSZ 1K9M2 3NFZA 2VUGA 1YHQZ 3F3FC 3J81f 1WJ2A 2OZKA 2JA6I 3MONA 4RVHA 4E32A 1YIT1 4X6AI 4A3JI 3HOWI 1KD11 3J7A4 2YADA 2E2HI 2W03A 3ESWA 2GTHA 1VQ8Z 4QTTA 4BY7I 2V3VA 1Q861 4A3GI 2QEX1 3TDHB 5D1OA 1Q7Y2 4AYBA 2DE5A 1JJ2Y 1W2BY 2LEXA 2JR6A 1M901 2O4HA 1VQ41 1ML8A 1Q862 1VQM1 2H85A 1Q811 3BG0B 3PO3S 2V45A 4A3BI 3CC41 3GTGI 1WW9A 3M4OI 1VQP1 2NAPA 2IZ3A 4DGLA 1KC82 2LFUA 5CM2M 2QREB 1YJWZ 1QVGZ 3I551 2VUMI 3FKII 1VQ7Z 3M3YI 2R92I 4HGZA 4HGYA 3CPWZ 4E2WA 3VMHA 3GTLI 2OOYB 1YJNZ 3CCQZ 3CCV1 1QVFY 2F4OA 2WB1A 1R9TI 4E30A 1M902 3GTQI 1VLAA 4MRIA 2AYDA 4NOZA 2WAQA 3K7AI 2G2KA 3S17I 3GTMI 1USPA 2PMZA 3J80b 3CCSZ 1P9NA 3IFUA 3PO2I 1SIWA 3IF8A 2GTIA 1QF8A 2OTL1 5C4XI 1NJI2 1K83I 2B63I 2K3RA 1DL6A 3NDJA 2VPZA 3CCR1 1WCMI 1WZNA 4MD7A 4CL1A 1VQ81 1YUAA 3S16I 3VMIA 4A3DI 3G4SZ 1VQK1 4QTUA 3NH4A 2YU9I 4NBGA 1Z03A 1Z02A 3NH8A 3F3PC 3CC21 4RV9A 2E9HA 4BXXI 2Q51A 3LUSA 2RT9A 3HOZI 3GTMS 1USPB 1TWAI 2ZAEB 1Z01A 2NVTI 3GTPI 5T67A 1WIIA 2JNYA 3G6EZ 3CC4Z 1KD12 3GCFA 3S1RI 3KIHA 1VQPZ 3PO3I 5A2Qf 2GU2A 2DE7A 1YUKA 1N8R1 3IX0A 4DQYB 2VPYA 5D1OB 1K8A2 1Q7Y1 2R7ZI 4A3II 2QKDA 2OTLZ 1K732 1YIJ1 3GKQA 2RPRA 1YI2Z 2JIOA 1W2BZ 4RVDA 3CMAZ 1K8A1 1NJI1 3CD6Z 1FDOA 3EEDA 3CCQ1 3CQZI 1VQ51 1VQ9Z 2RIQA 1X3WA 3CC7Z 1RLYA 2NVQI 4NBCA 4A3MI 3VTNA 3S14I 4A93I 4XX2A 3CC2Z 2V8JA 1K731 4Y52I 1X3ZA 1RO2A 5C4JI 2M6NA 3H0GI 2JIPA 1Q821 3I07A 1PFTA 3BG1B 3MZKB 2OTJ1 1QVGY 1VQO1 2JA5I 5LL6f 3I56Z 3J80f 4Y7NI 4BBRI 2PK7A 3CCLZ 2M48A 3NDIA 1TWCI 1VQMZ 4NBHA 1Q822 3TE5B 3S2DI 3QWUA 3I4MI 2BJOA 4E31A 1AA6A 1YIJZ 3MZLB 1S721 2E2JI 4MXUA 5C44I 2JA8I 1YJW1 3S1QI 5FLXb 1YJ91 1L1OC 3CCJ1 2NVYI 3JAMf 2HU9A 1YJN1 4RS4A 3G6E1 3CXCY 2IZ4A 2KI7B 4RVFA 3Q87A 2QEXZ 3NH5A 1KRLA 1VQNZ 5D1PA 4E2ZA 5IT9f 3CCE1 1VQL1 1I50I 3CCL1 2V8IA 2Q4ZA 4A3EI 3D6WA 3IR7A 1YI21 3HKZA 2PM9A 3G71Z 2DE6A 5AN9F 1YHQ1 4MONA 1Y1VI 3FQQA 2JA7I 4E2XA 1VQ5Z 1KC81 3GTKI 3CPWY 1JWHC 2JMOA 3I4NI 3VMGA 3CMEZ 3P5JB 3HOXI 2RHBA 2F4MA 4A3LI 3D9XA 1LQLA 1Q16A 5IT9b 3CCUZ 4BY1I 1TFIA
chains in the Genus database with same CATH topology
2JS4A 5C3EI 4E33A 2LIYA 3EERA 1RO4A 4TNUA 2E2II 1M1K2 2V8KA 1NP6A 4MD8A 1SFOI 1M1K1 1TWGI 4EWCA 3GTJI 3CCRZ 2VF1A 3CXCZ 1S72Z 3J81b 3GTOI 3CCM1 2K5RA 4RVGA 3G4S1 4NBEA 1VQKZ 2QRCB 3CCJZ 5FLXf 3I55Z 1I6HI 3CMA1 1N8R2 1RNIA 1VQ61 4MD9A 4NBAA 1QVFZ 3RZDI 1TWHI 1YITZ 4NB9A 3CCVZ 1RQFA 1VQ91 2I3CA 4E2YA 2R6MA 1ZH1A 2QA41 1QYPA 3KIFA 3FQMA 3HOVI 4MH4A 2QLVB 1VQLZ 3S15I 4HH4A 4NBDA 1N2FA 1S7MA 2NVXI 2AKLA 5IP9I 2OOXB 1I3QI 5T64A 3HOYI 3G711 3CCS1 2O53A 1Y1WI 3I561 3VB9A 1K9M1 4NBFA 2KPIA 4A3KI 3OW2Z 4A3FI 3S1MI 4A3CI 1Y1VS 3HOUI 3CME1 4NH1C 2HF1A 3JAMb 3CCMZ 2P28A 3CC71 1TWFI 1JJ2Z 2J6AA 3RZOI 3CCU1 2W04A 4NFRA 3CD61 1VQ6Z 4S1TA 1X0TA 5FLMI 1YJ9Z 2QRDB 4NBBA 1VQ71 2OTJZ 3S1NI 1VQOZ 2QA4Z 4DK1A 3OW2Y 2R93I 3U50C 2P3YA 2QR1B 1VQ4Z 1NUIA 1RO0A 3T4NB 3S2HI 2EGTA 4BBSI 2RBLA 1Q812 5A2Qb 1VQN1 1ZB9A 5T6BA 2JUBA 1ZB8A 4NB8A 1KQSY 5IP7I 2Y0SA 3H3VJ 3CCEZ 1KQSZ 1K9M2 3NFZA 2VUGA 1YHQZ 3F3FC 3J81f 2OZKA 2JA6I 3MONA 4RVHA 4E32A 1YIT1 4X6AI 4A3JI 3HOWI 1KD11 3J7A4 2YADA 2E2HI 2W03A 3ESWA 2GTHA 1VQ8Z 4QTTA 4BY7I 1Q861 4A3GI 2QEX1 3TDHB 5D1OA 1Q7Y2 4AYBA 2DE5A 1JJ2Y 1W2BY 2JR6A 1M901 2O4HA 1VQ41 1ML8A 1Q862 1VQM1 2H85A 1Q811 3BG0B 3PO3S 4A3BI 3CC41 3GTGI 1WW9A 3M4OI 1VQP1 2IZ3A 4DGLA 1KC82 2LFUA 5CM2M 2QREB 1YJWZ 1QVGZ 3I551 2VUMI 3FKII 1VQ7Z 3M3YI 2R92I 4HGZA 4HGYA 3CPWZ 4E2WA 3VMHA 3GTLI 2OOYB 1YJNZ 3CCQZ 3CCV1 1QVFY 2F4OA 2WB1A 1R9TI 4E30A 1M902 3GTQI 1VLAA 4MRIA 4NOZA 2WAQA 3K7AI 2G2KA 3S17I 3GTMI 1USPA 2PMZA 3J80b 3CCSZ 1P9NA 3IFUA 3PO2I 3IF8A 2GTIA 1QF8A 2OTL1 5C4XI 1NJI2 1K83I 2B63I 2K3RA 1DL6A 3NDJA 3CCR1 1WCMI 4MD7A 4CL1A 1VQ81 1YUAA 3S16I 3VMIA 4A3DI 3G4SZ 1VQK1 4QTUA 3NH4A 2YU9I 4NBGA 1Z03A 1Z02A 3NH8A 3F3PC 3CC21 4RV9A 2E9HA 4BXXI 2Q51A 3LUSA 2RT9A 3HOZI 3GTMS 1USPB 1TWAI 2ZAEB 1Z01A 2NVTI 3GTPI 5T67A 1WIIA 2JNYA 3G6EZ 3CC4Z 1KD12 3GCFA 3S1RI 3KIHA 1VQPZ 3PO3I 5A2Qf 2GU2A 2DE7A 1YUKA 1N8R1 3IX0A 4DQYB 5D1OB 1K8A2 1Q7Y1 2R7ZI 4A3II 2QKDA 2OTLZ 1K732 1YIJ1 3GKQA 2RPRA 1YI2Z 1W2BZ 4RVDA 3CMAZ 1K8A1 1NJI1 3CD6Z 3EEDA 3CCQ1 3CQZI 1VQ51 1VQ9Z 2RIQA 1X3WA 3CC7Z 1RLYA 2NVQI 4NBCA 4A3MI 3VTNA 3S14I 4A93I 4XX2A 3CC2Z 1K731 2V8JA 4Y52I 1X3ZA 1RO2A 5C4JI 2M6NA 3H0GI 1Q821 3I07A 1PFTA 3BG1B 3MZKB 2OTJ1 1QVGY 1VQO1 2JA5I 5LL6f 3I56Z 3J80f 4Y7NI 4BBRI 2PK7A 3CCLZ 2M48A 3NDIA 1TWCI 1VQMZ 4NBHA 1Q822 3TE5B 3S2DI 3QWUA 3I4MI 2BJOA 4E31A 1YIJZ 3MZLB 1S721 2E2JI 4MXUA 5C44I 2JA8I 1YJW1 3S1QI 5FLXb 1YJ91 1L1OC 3CCJ1 2NVYI 3JAMf 2HU9A 1YJN1 4RS4A 3G6E1 3CXCY 2IZ4A 2KI7B 4RVFA 3Q87A 2QEXZ 3NH5A 1KRLA 1VQNZ 5D1PA 4E2ZA 5IT9f 3CCE1 1VQL1 1I50I 3CCL1 2V8IA 2Q4ZA 4A3EI 3D6WA 1YI21 3HKZA 2PM9A 3G71Z 2DE6A 5AN9F 1YHQ1 4MONA 1Y1VI 3FQQA 2JA7I 4E2XA 1VQ5Z 1KC81 3GTKI 3CPWY 1JWHC 2JMOA 3I4NI 3VMGA 3CMEZ 3P5JB 3HOXI 2RHBA 2F4MA 4A3LI 3D9XA 1LQLA 5IT9b 3CCUZ 4BY1I 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  1M90 2;  2QA4 Z;  3OW2 Y;  1Q82 1;  1VQ4 Z;  2OTJ 1;  1QVG Y;  1VQO 1;  1M1K 2;  1Q81 2;  3I56 Z;  1VQN 1;  3CCL Z;  1M1K 1;  1VQM Z;  1KQS Y;  3CCE Z;  3CCS Z;  1KQS Z;  1K9M 2;  3CCR Z;  3CXC Z;  1Q82 2;  2OTL 1;  1S72 Z;  1NJI 2;  1YHQ Z;  3CCM 1;  3G4S 1;  3CCR 1;  1VQK Z;  1YIJ Z;  1YIT 1;  1S72 1;  3CCJ Z;  1VQ8 1;  3I55 Z;  3CMA 1;  1N8R 2;  1KD1 1;  3G4S Z;  1VQ6 1;  1YJW 1;  1VQK 1;  1QVF Z;  1YIT Z;  3CCV Z;  1VQ9 1;  1YJ9 1;  3CCJ 1;  1VQ8 Z;  3CC2 1;  1Q86 1;  2QEX 1;  2QA4 1;  1YJN 1;  1Q7Y 2;  3G6E 1;  3CXC Y;  1JJ2 Y;  1W2B Y;  2QEX Z;  1VQL Z;  1M90 1;  1VQN Z;  3G6E Z;  1VQ4 1;  3CC4 Z;  1KD1 2;  1Q86 2;  3G71 1;  1VQM 1;  3CCE 1;  3CCS 1;  1VQP Z;  3I56 1;  1K9M 1;  1Q81 1;  1VQL 1;  3CCL 1;  3CC4 1;  1YI2 1;  3G71 Z;  3OW2 Z;  1N8R 1;  1YHQ 1;  1VQP 1;  1K73 1;  1K8A 2;  1Q7Y 1;  2OTL Z;  1K73 2;  3CME 1;  1YIJ 1;  1KC8 2;  1VQ5 Z;  1KC8 1;  1YI2 Z;  1W2B Z;  3CCM Z;  3CPW Y;  3CMA Z;  1K8A 1;  3CC7 1;  1NJI 1;  3CD6 Z;  1JJ2 Z;  1YJW Z;  3CME Z;  3CCQ 1;  3CCU 1;  1QVG Z;  1VQ5 1;  1VQ9 Z;  3I55 1;  1VQ7 Z;  3CC7 Z;  3CD6 1;  1VQ6 Z;  3CPW Z;  1YJN Z;  3CCQ Z;  3CCU Z;  3CCV 1;  1YJ9 Z;  1QVF Y;  3CC2 Z;  1VQ7 1;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 2JIR A;  2JS4 A;  5C3E I;  4E33 A;  2LIY A;  3EER A;  1RO4 A;  4TNU A;  2E2I I;  1M1K 2;  2V8K A;  1NP6 A;  4MD8 A;  1SFO I;  1M1K 1;  3D2L A;  1TWG I;  4EWC A;  3GTJ I;  3CCR Z;  2VF1 A;  3CXC Z;  2VPX A;  1S72 Z;  3J81 b;  3GTO I;  3CCM 1;  2K5R A;  4RVG A;  3G4S 1;  4NBE A;  1VQK Z;  2QRC B;  3CCJ Z;  5FLX f;  3I55 Z;  1I6H I;  3CMA 1;  1N8R 2;  1RNI A;  1VQ6 1;  4MD9 A;  4NBA A;  1QVF Z;  3RZD I;  1TWH I;  1YIT Z;  4NB9 A;  3CCV Z;  1RQF A;  1VQ9 1;  2I3C A;  2JIQ A;  4E2Y A;  2R6M A;  1ZH1 A;  2QA4 1;  1QYP A;  3KIF A;  3FQM A;  3HOV I;  4MH4 A;  2QLV B;  1VQL Z;  3S15 I;  4HH4 A;  4NBD A;  1N2F A;  1S7M A;  2NVX I;  2AKL A;  5IP9 I;  2OOX B;  1I3Q I;  5T64 A;  3HOY I;  3G71 1;  3CCS 1;  2O53 A;  1Y1W I;  3I56 1;  3VB9 A;  1K9M 1;  4NBF A;  2KPI A;  4A3K I;  2JIM A;  3OW2 Z;  4A3F I;  3S1M I;  4A3C I;  1Y1V S;  3HOU I;  1FDI A;  3CME 1;  4NH1 C;  2HF1 A;  3JAM b;  3CCM Z;  2P28 A;  3CC7 1;  1QXF A;  1TWF I;  1JJ2 Z;  2J6A A;  3RZO I;  3CCU 1;  2W04 A;  4NFR A;  3CD6 1;  1VQ6 Z;  4S1T A;  1X0T A;  5FLM I;  1YJ9 Z;  2VPW A;  2QRD B;  4NBB A;  1VQ7 1;  1Y8C A;  2OTJ Z;  3S1N I;  1VQO Z;  2QA4 Z;  4DK1 A;  2IV2 X;  3OW2 Y;  2R93 I;  3U50 C;  2P3Y A;  2QR1 B;  1VQ4 Z;  1NUI A;  1RO0 A;  2E7Z A;  3T4N B;  3S2H I;  2EGT A;  4BBS I;  2RBL A;  1Q81 2;  5A2Q b;  1VQN 1;  1ZB9 A;  5T6B A;  2JUB A;  1ZB8 A;  4NB8 A;  1KQS Y;  5IP7 I;  2Y0S A;  3H3V J;  3CCE Z;  1KQS Z;  1K9M 2;  3NFZ A;  2VUG A;  1YHQ Z;  3F3F C;  3J81 f;  1WJ2 A;  2OZK A;  2JA6 I;  3MON A;  4RVH A;  4E32 A;  1YIT 1;  4X6A I;  4A3J I;  3HOW I;  1KD1 1;  3J7A 4;  2YAD A;  2E2H I;  2W03 A;  3ESW A;  2GTH A;  1VQ8 Z;  4QTT A;  4BY7 I;  2V3V A;  1Q86 1;  4A3G I;  2QEX 1;  3TDH B;  5D1O A;  1Q7Y 2;  4AYB A;  2DE5 A;  1JJ2 Y;  1W2B Y;  2LEX A;  2JR6 A;  1M90 1;  2O4H A;  1VQ4 1;  1ML8 A;  1Q86 2;  1VQM 1;  2H85 A;  1Q81 1;  3BG0 B;  3PO3 S;  2V45 A;  4A3B I;  3CC4 1;  3GTG I;  1WW9 A;  3M4O I;  1VQP 1;  2NAP A;  2IZ3 A;  4DGL A;  1KC8 2;  2LFU A;  5CM2 M;  2QRE B;  1YJW Z;  1QVG Z;  3I55 1;  2VUM I;  3FKI I;  1VQ7 Z;  3M3Y I;  2R92 I;  4HGZ A;  4HGY A;  3CPW Z;  4E2W A;  3VMH A;  3GTL I;  2OOY B;  1YJN Z;  3CCQ Z;  3CCV 1;  1QVF Y;  2F4O A;  2WB1 A;  1R9T I;  4E30 A;  1M90 2;  3GTQ I;  1VLA A;  4MRI A;  2AYD A;  4NOZ A;  2WAQ A;  3K7A I;  2G2K A;  3S17 I;  3GTM I;  1USP A;  2PMZ A;  3J80 b;  3CCS Z;  1P9N A;  3IFU A;  3PO2 I;  1SIW A;  3IF8 A;  2GTI A;  1QF8 A;  2OTL 1;  5C4X I;  1NJI 2;  1K83 I;  2B63 I;  2K3R A;  1DL6 A;  3NDJ A;  2VPZ A;  3CCR 1;  1WCM I;  1WZN A;  4MD7 A;  4CL1 A;  1VQ8 1;  1YUA A;  3S16 I;  3VMI A;  4A3D I;  3G4S Z;  1VQK 1;  4QTU A;  3NH4 A;  2YU9 I;  4NBG A;  1Z03 A;  1Z02 A;  3NH8 A;  3F3P C;  3CC2 1;  4RV9 A;  2E9H A;  4BXX I;  2Q51 A;  3LUS A;  2RT9 A;  3HOZ I;  3GTM S;  1USP B;  1TWA I;  2ZAE B;  1Z01 A;  2NVT I;  3GTP I;  5T67 A;  1WII A;  2JNY A;  3G6E Z;  3CC4 Z;  1KD1 2;  3GCF A;  3S1R I;  3KIH A;  1VQP Z;  3PO3 I;  5A2Q f;  2GU2 A;  2DE7 A;  1YUK A;  1N8R 1;  3IX0 A;  4DQY B;  2VPY A;  5D1O B;  1K8A 2;  1Q7Y 1;  2R7Z I;  4A3I I;  2QKD A;  2OTL Z;  1K73 2;  1YIJ 1;  3GKQ A;  2RPR A;  1YI2 Z;  2JIO A;  1W2B Z;  4RVD A;  3CMA Z;  1K8A 1;  1NJI 1;  3CD6 Z;  1FDO A;  3EED A;  3CCQ 1;  3CQZ I;  1VQ5 1;  1VQ9 Z;  2RIQ A;  1X3W A;  3CC7 Z;  1RLY A;  2NVQ I;  4NBC A;  4A3M I;  3VTN A;  3S14 I;  4A93 I;  4XX2 A;  3CC2 Z;  2V8J A;  1K73 1;  4Y52 I;  1X3Z A;  1RO2 A;  5C4J I;  2M6N A;  3H0G I;  2JIP A;  1Q82 1;  3I07 A;  1PFT A;  3BG1 B;  3MZK B;  2OTJ 1;  1QVG Y;  1VQO 1;  2JA5 I;  5LL6 f;  3I56 Z;  3J80 f;  4Y7N I;  4BBR I;  2PK7 A;  3CCL Z;  2M48 A;  3NDI A;  1TWC I;  1VQM Z;  4NBH A;  1Q82 2;  3TE5 B;  3S2D I;  3QWU A;  3I4M I;  2BJO A;  4E31 A;  1AA6 A;  1YIJ Z;  3MZL B;  1S72 1;  2E2J I;  4MXU A;  5C44 I;  2JA8 I;  1YJW 1;  3S1Q I;  5FLX b;  1YJ9 1;  1L1O C;  3CCJ 1;  2NVY I;  3JAM f;  2HU9 A;  1YJN 1;  4RS4 A;  3G6E 1;  3CXC Y;  2IZ4 A;  2KI7 B;  4RVF A;  3Q87 A;  2QEX Z;  3NH5 A;  1KRL A;  1VQN Z;  5D1P A;  4E2Z A;  5IT9 f;  3CCE 1;  1VQL 1;  1I50 I;  3CCL 1;  2V8I A;  2Q4Z A;  4A3E I;  3D6W A;  3IR7 A;  1YI2 1;  3HKZ A;  2PM9 A;  3G71 Z;  2DE6 A;  5AN9 F;  1YHQ 1;  4MON A;  1Y1V I;  3FQQ A;  2JA7 I;  4E2X A;  1VQ5 Z;  1KC8 1;  3GTK I;  3CPW Y;  1JWH C;  2JMO A;  3I4N I;  3VMG A;  3CME Z;  3P5J B;  3HOX I;  2RHB A;  2F4M A;  4A3L I;  3D9X A;  1LQL A;  1Q16 A;  5IT9 b;  3CCU Z;  4BY1 I;  1TFI A; 
#chains in the Genus database with same CATH homology
 2JS4 A;  5C3E I;  4E33 A;  2LIY A;  3EER A;  1RO4 A;  4TNU A;  2E2I I;  1M1K 2;  2V8K A;  1NP6 A;  4MD8 A;  1SFO I;  1M1K 1;  1TWG I;  4EWC A;  3GTJ I;  3CCR Z;  2VF1 A;  3CXC Z;  1S72 Z;  3J81 b;  3GTO I;  3CCM 1;  2K5R A;  4RVG A;  3G4S 1;  4NBE A;  1VQK Z;  2QRC B;  3CCJ Z;  5FLX f;  3I55 Z;  1I6H I;  3CMA 1;  1N8R 2;  1RNI A;  1VQ6 1;  4MD9 A;  4NBA A;  1QVF Z;  3RZD I;  1TWH I;  1YIT Z;  4NB9 A;  3CCV Z;  1RQF A;  1VQ9 1;  2I3C A;  4E2Y A;  2R6M A;  1ZH1 A;  2QA4 1;  1QYP A;  3KIF A;  3FQM A;  3HOV I;  4MH4 A;  2QLV B;  1VQL Z;  3S15 I;  4HH4 A;  4NBD A;  1N2F A;  1S7M A;  2NVX I;  2AKL A;  5IP9 I;  2OOX B;  1I3Q I;  5T64 A;  3HOY I;  3G71 1;  3CCS 1;  2O53 A;  1Y1W I;  3I56 1;  3VB9 A;  1K9M 1;  4NBF A;  2KPI A;  4A3K I;  3OW2 Z;  4A3F I;  3S1M I;  4A3C I;  1Y1V S;  3HOU I;  3CME 1;  4NH1 C;  2HF1 A;  3JAM b;  3CCM Z;  2P28 A;  3CC7 1;  1TWF I;  1JJ2 Z;  2J6A A;  3RZO I;  3CCU 1;  2W04 A;  4NFR A;  3CD6 1;  1VQ6 Z;  4S1T A;  1X0T A;  5FLM I;  1YJ9 Z;  2QRD B;  4NBB A;  1VQ7 1;  2OTJ Z;  3S1N I;  1VQO Z;  2QA4 Z;  4DK1 A;  3OW2 Y;  2R93 I;  3U50 C;  2P3Y A;  2QR1 B;  1VQ4 Z;  1NUI A;  1RO0 A;  3T4N B;  3S2H I;  2EGT A;  4BBS I;  2RBL A;  1Q81 2;  5A2Q b;  1VQN 1;  1ZB9 A;  5T6B A;  2JUB A;  1ZB8 A;  4NB8 A;  1KQS Y;  5IP7 I;  2Y0S A;  3H3V J;  3CCE Z;  1KQS Z;  1K9M 2;  3NFZ A;  2VUG A;  1YHQ Z;  3F3F C;  3J81 f;  2OZK A;  2JA6 I;  3MON A;  4RVH A;  4E32 A;  1YIT 1;  4X6A I;  4A3J I;  3HOW I;  1KD1 1;  3J7A 4;  2YAD A;  2E2H I;  2W03 A;  3ESW A;  2GTH A;  1VQ8 Z;  4QTT A;  4BY7 I;  1Q86 1;  4A3G I;  2QEX 1;  3TDH B;  5D1O A;  1Q7Y 2;  4AYB A;  2DE5 A;  1JJ2 Y;  1W2B Y;  2JR6 A;  1M90 1;  2O4H A;  1VQ4 1;  1ML8 A;  1Q86 2;  1VQM 1;  2H85 A;  1Q81 1;  3BG0 B;  3PO3 S;  4A3B I;  3CC4 1;  3GTG I;  1WW9 A;  3M4O I;  1VQP 1;  2IZ3 A;  4DGL A;  1KC8 2;  2LFU A;  5CM2 M;  2QRE B;  1YJW Z;  1QVG Z;  3I55 1;  2VUM I;  3FKI I;  1VQ7 Z;  3M3Y I;  2R92 I;  4HGZ A;  4HGY A;  3CPW Z;  4E2W A;  3VMH A;  3GTL I;  2OOY B;  1YJN Z;  3CCQ Z;  3CCV 1;  1QVF Y;  2F4O A;  2WB1 A;  1R9T I;  4E30 A;  1M90 2;  3GTQ I;  1VLA A;  4MRI A;  4NOZ A;  2WAQ A;  3K7A I;  2G2K A;  3S17 I;  3GTM I;  1USP A;  2PMZ A;  3J80 b;  3CCS Z;  1P9N A;  3IFU A;  3PO2 I;  3IF8 A;  2GTI A;  1QF8 A;  2OTL 1;  5C4X I;  1NJI 2;  1K83 I;  2B63 I;  2K3R A;  1DL6 A;  3NDJ A;  3CCR 1;  1WCM I;  4MD7 A;  4CL1 A;  1VQ8 1;  1YUA A;  3S16 I;  3VMI A;  4A3D I;  3G4S Z;  1VQK 1;  4QTU A;  3NH4 A;  2YU9 I;  4NBG A;  1Z03 A;  1Z02 A;  3NH8 A;  3F3P C;  3CC2 1;  4RV9 A;  2E9H A;  4BXX I;  2Q51 A;  3LUS A;  2RT9 A;  3HOZ I;  3GTM S;  1USP B;  1TWA I;  2ZAE B;  1Z01 A;  2NVT I;  3GTP I;  5T67 A;  1WII A;  2JNY A;  3G6E Z;  3CC4 Z;  1KD1 2;  3GCF A;  3S1R I;  3KIH A;  1VQP Z;  3PO3 I;  5A2Q f;  2GU2 A;  2DE7 A;  1YUK A;  1N8R 1;  3IX0 A;  4DQY B;  5D1O B;  1K8A 2;  1Q7Y 1;  2R7Z I;  4A3I I;  2QKD A;  2OTL Z;  1K73 2;  1YIJ 1;  3GKQ A;  2RPR A;  1YI2 Z;  1W2B Z;  4RVD A;  3CMA Z;  1K8A 1;  1NJI 1;  3CD6 Z;  3EED A;  3CCQ 1;  3CQZ I;  1VQ5 1;  1VQ9 Z;  2RIQ A;  1X3W A;  3CC7 Z;  1RLY A;  2NVQ I;  4NBC A;  4A3M I;  3VTN A;  3S14 I;  4A93 I;  4XX2 A;  3CC2 Z;  1K73 1;  2V8J A;  4Y52 I;  1X3Z A;  1RO2 A;  5C4J I;  2M6N A;  3H0G I;  1Q82 1;  3I07 A;  1PFT A;  3BG1 B;  3MZK B;  2OTJ 1;  1QVG Y;  1VQO 1;  2JA5 I;  5LL6 f;  3I56 Z;  3J80 f;  4Y7N I;  4BBR I;  2PK7 A;  3CCL Z;  2M48 A;  3NDI A;  1TWC I;  1VQM Z;  4NBH A;  1Q82 2;  3TE5 B;  3S2D I;  3QWU A;  3I4M I;  2BJO A;  4E31 A;  1YIJ Z;  3MZL B;  1S72 1;  2E2J I;  4MXU A;  5C44 I;  2JA8 I;  1YJW 1;  3S1Q I;  5FLX b;  1YJ9 1;  1L1O C;  3CCJ 1;  2NVY I;  3JAM f;  2HU9 A;  1YJN 1;  4RS4 A;  3G6E 1;  3CXC Y;  2IZ4 A;  2KI7 B;  4RVF A;  3Q87 A;  2QEX Z;  3NH5 A;  1KRL A;  1VQN Z;  5D1P A;  4E2Z A;  5IT9 f;  3CCE 1;  1VQL 1;  1I50 I;  3CCL 1;  2V8I A;  2Q4Z A;  4A3E I;  3D6W A;  1YI2 1;  3HKZ A;  2PM9 A;  3G71 Z;  2DE6 A;  5AN9 F;  1YHQ 1;  4MON A;  1Y1V I;  3FQQ A;  2JA7 I;  4E2X A;  1VQ5 Z;  1KC8 1;  3GTK I;  3CPW Y;  1JWH C;  2JMO A;  3I4N I;  3VMG A;  3CME Z;  3P5J B;  3HOX I;  2RHB A;  2F4M A;  4A3L I;  3D9X A;  1LQL A;  5IT9 b;  3CCU Z;  4BY1 I;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...