1VQ5Z

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq5Z00
1K8A2 1VQPZ 1YJW1 1YHQZ 1YI21 3G71Z 3CC21 1VQO1 1S72Z 3CCU1 3CCLZ 1JJ2Y 3CPWZ 1Q861 1QVGZ 3CCQ1 3CCEZ 3CC4Z 1Q7Y1 3G6EZ 3CCJZ 3I551 3CME1 1VQLZ 1VQN1 1YJ91 1NJI1 3CCM1 1VQ9Z 2QA4Z 3CCV1 1VQ5Z 1KQSZ 1M1K2 1YJN1 1KC81 3CXCZ 3CMAZ 1K9M1 1VQ8Z 1VQ6Z 1VQMZ 1K731 3CCE1 1Q811 3OW2Y 1M901 1JJ2Z 1Q821 1YIJ1 3CC7Z 1VQP1 3G4SZ 1YHQ1 3I56Z 1VQKZ 1VQM1 2OTLZ 3CCRZ 1Q862 1Q7Y2 3G711 3CD6Z 1VQ7Z 3OW2Z 1S721 1W2BY 3CCSZ 3CCL1 3CC41 1YJWZ 3G6E1 1KD11 3CCJ1 1YI2Z 1KC82 1K9M2 1VQL1 1N8R1 1VQK1 2OTJZ 3CC2Z 1K732 1M1K1 1VQ91 2QA41 1QVGY 1K8A1 1VQOZ 3CCUZ 1VQ51 1QVFY 3CCQZ 1YITZ 3CMA1 1VQ81 1VQ61 2QEXZ 3I55Z 3CMEZ 1W2BZ 1VQNZ 1YJ9Z 3CCMZ 1KQSY 2OTJ1 3CXCY 1VQ4Z 1NJI2 3CCVZ 1YJNZ 3CC71 1YIT1 3G4S1 3I561 2OTL1 2QEX1 3CCR1 1QVFZ 3CPWY 1Q812 1M902 1KD12 3CD61 1VQ71 1N8R2 1VQ41 1YIJZ 3CCS1 1Q822
chains in the Genus database with same CATH superfamily
4NOZA 4RVFA 2IZ3A 3S17I 3H3VJ 1YHQZ 1QYPA 1YI21 4NB8A 1N2FA 1Z02A 2VPWA 3CCLZ 3PO3I 2P3YA 4NBGA 1Q861 4NBDA 3CCEZ 5C44I 5A2Qb 3GTLI 5A2Qf 3CME1 1YJ91 5FLMI 4A93I 1ZB9A 4E31A 5D1OA 3GKQA 1YJN1 3NDIA 2R92I 3VB9A 3IFUA 4MH4A 3OW2Y 2PMZA 2OOXB 3TE5B 3VMHA 4A3KI 1YIJ1 1Y8CA 3FQMA 2NVYI 2JUBA 3GTGI 1RLYA 1YHQ1 1VQKZ 2H85A 1Q862 3RZDI 4A3JI 4NBBA 3H0GI 1VQ7Z 3MZKB 3MONA 2VUMI 2GTIA 3CCL1 2NVXI 4DK1A 1KD11 2OOYB 3IF8A 1N8R1 2DE7A 3CC2Z 1M1K1 2P28A 4RVDA 1RNIA 3CCUZ 4E32A 1YITZ 2LIYA 2QEXZ 2BJOA 2V45A 3IR7A 1FDOA 3GTJI 4NH1C 1VQ4Z 3CCVZ 1SFOI 3S14I 4A3BI 3KIHA 3HOZI 3M3YI 1L1OC 3HOXI 4NBEA 1QVFZ 5AN9F 1KD12 5IT9b 1VQ71 4A3MI 4A3EI 2IZ4A 2DE5A 1N8R2 2HU9A 3EEDA 4HH4A 2OZKA 2JA8I 3I07A 2O53A 3I4MI 3G71Z 2Q4ZA 1WIIA 2WB1A 3P5JB 3CC21 2QLVB 3GCFA 1S72Z 3S1NI 1S7MA 3CCU1 2NVTI 4E2ZA 5D1PA 4E33A 2O4HA 4A3GI 3F3PC 2YU9I 3T4NB 4E2XA 2E9HA 1NJI1 2IV2X 2QA4Z 1Q16A 3CCV1 1VQ5Z 2GU2A 3HKZA 1KC81 4EWCA 1VQ8Z 1VQ6Z 3I4NI 3J7A4 3JAMb 2NVQI 2Y0SA 1Q811 3JAMf 2K5RA 2M48A 3PO3S 2W03A 1DL6A 1Q821 1ZH1A 3EERA 2E2II 2JNYA 3F3FC 4QTTA 3S1QI 5T6BA 3HOWI 1X3WA 2K3RA 1P9NA 2E7ZA 1Z03A 3G711 4NBFA 4MD8A 3NDJA 1S721 2JS4A 2RHBA 3CCSZ 5T67A 2QKDA 2VF1A 3GTOI 1R9TI 3QWUA 1KC82 1WW9A 4NBHA 2QA41 3CQZI 1K8A1 1VQ51 2JIOA 1QVFY 3GTQI 1VQ81 1VQ61 1W2BZ 4NBCA 3CCMZ 1RO4A 1KQSY 3NH8A 3J81b 1Z01A 2OTJ1 3J81f 2V8KA 1TWGI 1JWHC 1LQLA 1AA6A 3Q87A 4DGLA 1USPB 2JIPA 2V8JA 1QF8A 3GTMI 1YUAA 2B63I 3CCS1 1K8A2 1TFIA 2JMOA 3M4OI 2RPRA 4Y7NI 1ML8A 4MONA 3S2HI 1VLAA 4MRIA 2LEXA 3CPWZ 4AYBA 2JIRA 2W04A 3PO2I 1Q7Y1 2JA6I 3RZOI 3CCJZ 1TWCI 2YADA 4E30A 3CCM1 1QXFA 5IT9f 1VQ9Z 2AKLA 2QRDB 2RIQA 1KQSZ 1M1K2 2JIQA 3CMAZ 1I3QI 1TWHI 3K7AI 1K731 1M901 1JJ2Z 1SIWA 4S1TA 1K83I 3VTNA 3NFZA 2LFUA 4E2YA 3VMIA 3KIFA 3D6WA 2WAQA 3I56Z 1VQM1 4A3DI 1Q7Y2 2V3VA 4NBAA 3CD6Z 5FLXb 4QTUA 4MXUA 2QR1B 1W2BY 4BBSI 4RS4A 3U50C 2V8IA 1Y1VI 1YJWZ 5C3EI 3CCJ1 3S1MI 1X3ZA 3MZLB 2VPYA 1NP6A 3BG1B 2OTJZ 3HOYI 3LUSA 1K732 1VQ91 2R7ZI 1QVGY 4NB9A 1VQOZ 4BY7I 3CCQZ 3CMA1 2EGTA 3I55Z 4HGYA 1VQNZ 4HGZA 4X6AI 2F4MA 3CXCY 1NJI2 3IX0A 4NFRA 2JA5I 2VPXA 3S1RI 4A3LI 2RBLA 3J80b 4XX2A 3I561 2M6NA 3J80f 3CPWY 3FKII 4TNUA 1Q812 2R6MA 4RVHA 3CD61 5T64A 1Q822 5D1OB 3HOVI 4A3II 1VQPZ 1YJW1 4MD9A 3BG0B 2PM9A 2G2KA 3HOUI 2J6AA 2KPIA 3D9XA 1VQO1 4RV9A 3S16I 1JJ2Y 1RQFA 1USPA 2QREB 2VPZA 2AYDA 3CCQ1 1QVGZ 3CC4Z 3G6EZ 3GTMS 3NH4A 3I551 4CL1A 1VQLZ 1VQN1 5C4XI 4BY1I 1PFTA 5IP9I 1Y1WI 2HF1A 2JA7I 2R93I 2VUGA 3CXCZ 1K9M1 2DE6A 1VQMZ 1WZNA 2NAPA 3D2LA 2JR6A 3CCE1 4A3FI 2KI7B 1NUIA 1I6HI 1RO2A 5C4JI 4Y52I 3GTPI 2F4OA 3CC7Z 1TWAI 1TWFI 3ESWA 1VQP1 4BBRI 2QRCB 1RO0A 3G4SZ 2OTLZ 3CCRZ 4MD7A 1WJ2A 3NH5A 3OW2Z 2GTHA 3S2DI 2JIMA 3CC41 3GTKI 3G6E1 1YUKA 1YI2Z 1K9M2 1VQL1 1VQK1 1I50I 2E2HI 1X0TA 2ZAEB 5CM2M 4RVGA 4DQYB 4BXXI 2RT9A 3VMGA 1FDIA 2I3CA 3CMEZ 1YJ9Z 2E2JI 1KRLA 1WCMI 5FLXf 1Y1VS 2PK7A 3TDHB 2Q51A 1YJNZ 4E2WA 3CC71 5IP7I 1YIT1 3S15I 5LL6f 3G4S1 2OTL1 2QEX1 3CCR1 3FQQA 1M902 4A3CI 1ZB8A 1VQ41 1YIJZ
chains in the Genus database with same CATH topology
4NOZA 4RVFA 2IZ3A 3S17I 3H3VJ 1YHQZ 1QYPA 1YI21 4NB8A 1N2FA 1Z02A 3CCLZ 3PO3I 2P3YA 4NBGA 1Q861 4NBDA 3CCEZ 5C44I 5A2Qb 3GTLI 5A2Qf 3CME1 1YJ91 5FLMI 4A93I 1ZB9A 4E31A 5D1OA 3GKQA 1YJN1 3NDIA 2R92I 3VB9A 3IFUA 4MH4A 3OW2Y 2PMZA 2OOXB 3TE5B 3VMHA 4A3KI 1YIJ1 3FQMA 2NVYI 2JUBA 3GTGI 1RLYA 1YHQ1 1VQKZ 2H85A 1Q862 3RZDI 4A3JI 4NBBA 3H0GI 1VQ7Z 3MZKB 3MONA 2VUMI 2GTIA 3CCL1 2NVXI 4DK1A 1KD11 2OOYB 3IF8A 1N8R1 2DE7A 3CC2Z 1M1K1 2P28A 4RVDA 1RNIA 3CCUZ 4E32A 1YITZ 2LIYA 2QEXZ 2BJOA 3GTJI 4NH1C 1VQ4Z 3CCVZ 1SFOI 3S14I 4A3BI 3KIHA 3HOZI 3M3YI 1L1OC 3HOXI 4NBEA 1QVFZ 5AN9F 1KD12 5IT9b 1VQ71 4A3MI 4A3EI 2IZ4A 2DE5A 1N8R2 2HU9A 3EEDA 4HH4A 2OZKA 2JA8I 3I07A 2O53A 3I4MI 3G71Z 2Q4ZA 1WIIA 2WB1A 3P5JB 3CC21 2QLVB 3GCFA 1S72Z 3S1NI 1S7MA 3CCU1 2NVTI 4E2ZA 5D1PA 4E33A 2O4HA 4A3GI 3F3PC 2YU9I 3T4NB 4E2XA 2E9HA 1NJI1 2QA4Z 3CCV1 1VQ5Z 2GU2A 3HKZA 1KC81 4EWCA 1VQ8Z 1VQ6Z 3I4NI 3J7A4 3JAMb 2NVQI 2Y0SA 1Q811 3JAMf 2K5RA 2M48A 3PO3S 2W03A 1DL6A 1Q821 1ZH1A 3EERA 2E2II 2JNYA 3F3FC 4QTTA 3S1QI 5T6BA 3HOWI 1X3WA 2K3RA 1P9NA 1Z03A 3G711 4NBFA 4MD8A 3NDJA 1S721 2JS4A 2RHBA 3CCSZ 5T67A 2QKDA 2VF1A 3GTOI 1R9TI 3QWUA 1KC82 1WW9A 4NBHA 2QA41 3CQZI 1K8A1 1VQ51 1QVFY 3GTQI 1VQ81 1VQ61 1W2BZ 4NBCA 3CCMZ 1RO4A 1KQSY 3NH8A 3J81b 1Z01A 2OTJ1 3J81f 2V8KA 1TWGI 1JWHC 1LQLA 3Q87A 4DGLA 1USPB 2V8JA 1QF8A 3GTMI 1YUAA 2B63I 3CCS1 1K8A2 1TFIA 2JMOA 3M4OI 2RPRA 4Y7NI 1ML8A 4MONA 3S2HI 1VLAA 4MRIA 3CPWZ 4AYBA 2W04A 3PO2I 1Q7Y1 2JA6I 3RZOI 3CCJZ 1TWCI 2YADA 4E30A 3CCM1 1VQ9Z 5IT9f 2AKLA 2QRDB 2RIQA 1KQSZ 1M1K2 3CMAZ 1I3QI 1TWHI 3K7AI 1K731 1M901 1JJ2Z 4S1TA 1K83I 3VTNA 3NFZA 2LFUA 4E2YA 3VMIA 3KIFA 3D6WA 2WAQA 3I56Z 1VQM1 4A3DI 1Q7Y2 4NBAA 3CD6Z 5FLXb 4QTUA 4MXUA 2QR1B 1W2BY 4BBSI 4RS4A 3U50C 2V8IA 1Y1VI 1YJWZ 5C3EI 3CCJ1 3S1MI 1X3ZA 3MZLB 1NP6A 3BG1B 2OTJZ 3HOYI 3LUSA 1K732 1VQ91 2R7ZI 1QVGY 4NB9A 1VQOZ 4BY7I 3CCQZ 3CMA1 2EGTA 3I55Z 4HGYA 1VQNZ 4HGZA 4X6AI 2F4MA 3CXCY 1NJI2 3IX0A 4NFRA 2JA5I 3S1RI 4A3LI 2RBLA 3J80b 4XX2A 3I561 2M6NA 3J80f 3CPWY 3FKII 4TNUA 1Q812 2R6MA 4RVHA 3CD61 5T64A 1Q822 5D1OB 3HOVI 4A3II 1VQPZ 1YJW1 4MD9A 3BG0B 2PM9A 2G2KA 3HOUI 2J6AA 2KPIA 3D9XA 1VQO1 4RV9A 3S16I 1JJ2Y 1RQFA 1USPA 2QREB 1QVGZ 3CCQ1 3CC4Z 3G6EZ 3GTMS 3NH4A 3I551 4CL1A 1VQLZ 1VQN1 5C4XI 4BY1I 1PFTA 5IP9I 1Y1WI 2HF1A 2JA7I 2R93I 2VUGA 3CXCZ 1K9M1 2DE6A 1VQMZ 3CCE1 2JR6A 4A3FI 2KI7B 1NUIA 1I6HI 1RO2A 5C4JI 4Y52I 3GTPI 2F4OA 3CC7Z 1TWAI 1TWFI 3ESWA 1VQP1 4BBRI 2QRCB 1RO0A 3G4SZ 2OTLZ 3CCRZ 4MD7A 3NH5A 3OW2Z 2GTHA 3S2DI 3CC41 3GTKI 3G6E1 1YUKA 1YI2Z 1K9M2 1VQL1 1VQK1 1I50I 2E2HI 1X0TA 2ZAEB 5CM2M 4RVGA 4DQYB 4BXXI 2RT9A 3VMGA 2I3CA 3CMEZ 1YJ9Z 2E2JI 1KRLA 1WCMI 5FLXf 1Y1VS 2PK7A 3TDHB 2Q51A 1YJNZ 4E2WA 3CC71 5IP7I 1YIT1 3S15I 5LL6f 3G4S1 2OTL1 2QEX1 3CCR1 3FQQA 1M902 4A3CI 1ZB8A 1VQ41 1YIJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 2;  1VQP Z;  1YJW 1;  1YHQ Z;  1YI2 1;  3G71 Z;  3CC2 1;  1VQO 1;  1S72 Z;  3CCU 1;  3CCL Z;  1JJ2 Y;  3CPW Z;  1Q86 1;  1QVG Z;  3CCQ 1;  3CCE Z;  3CC4 Z;  1Q7Y 1;  3G6E Z;  3CCJ Z;  3I55 1;  3CME 1;  1VQL Z;  1VQN 1;  1YJ9 1;  1NJI 1;  3CCM 1;  1VQ9 Z;  2QA4 Z;  3CCV 1;  1VQ5 Z;  1KQS Z;  1M1K 2;  1YJN 1;  1KC8 1;  3CXC Z;  3CMA Z;  1K9M 1;  1VQ8 Z;  1VQ6 Z;  1VQM Z;  1K73 1;  3CCE 1;  1Q81 1;  3OW2 Y;  1M90 1;  1JJ2 Z;  1Q82 1;  1YIJ 1;  3CC7 Z;  1VQP 1;  3G4S Z;  1YHQ 1;  3I56 Z;  1VQK Z;  1VQM 1;  2OTL Z;  3CCR Z;  1Q86 2;  1Q7Y 2;  3G71 1;  3CD6 Z;  1VQ7 Z;  3OW2 Z;  1S72 1;  1W2B Y;  3CCS Z;  3CCL 1;  3CC4 1;  1YJW Z;  3G6E 1;  1KD1 1;  3CCJ 1;  1YI2 Z;  1KC8 2;  1K9M 2;  1VQL 1;  1N8R 1;  1VQK 1;  2OTJ Z;  3CC2 Z;  1K73 2;  1M1K 1;  1VQ9 1;  2QA4 1;  1QVG Y;  1K8A 1;  1VQO Z;  3CCU Z;  1VQ5 1;  1QVF Y;  3CCQ Z;  1YIT Z;  3CMA 1;  1VQ8 1;  1VQ6 1;  2QEX Z;  3I55 Z;  3CME Z;  1W2B Z;  1VQN Z;  1YJ9 Z;  3CCM Z;  1KQS Y;  2OTJ 1;  3CXC Y;  1VQ4 Z;  1NJI 2;  3CCV Z;  1YJN Z;  3CC7 1;  1YIT 1;  3G4S 1;  3I56 1;  2OTL 1;  2QEX 1;  3CCR 1;  1QVF Z;  3CPW Y;  1Q81 2;  1M90 2;  1KD1 2;  3CD6 1;  1VQ7 1;  1N8R 2;  1VQ4 1;  1YIJ Z;  3CCS 1;  1Q82 2; 
#chains in the Genus database with same CATH topology
 4NOZ A;  4RVF A;  2IZ3 A;  3S17 I;  3H3V J;  1YHQ Z;  1QYP A;  1YI2 1;  4NB8 A;  1N2F A;  1Z02 A;  2VPW A;  3CCL Z;  3PO3 I;  2P3Y A;  4NBG A;  1Q86 1;  4NBD A;  3CCE Z;  5C44 I;  5A2Q b;  3GTL I;  5A2Q f;  3CME 1;  1YJ9 1;  5FLM I;  4A93 I;  1ZB9 A;  4E31 A;  5D1O A;  3GKQ A;  1YJN 1;  3NDI A;  2R92 I;  3VB9 A;  3IFU A;  4MH4 A;  3OW2 Y;  2PMZ A;  2OOX B;  3TE5 B;  3VMH A;  4A3K I;  1YIJ 1;  1Y8C A;  3FQM A;  2NVY I;  2JUB A;  3GTG I;  1RLY A;  1YHQ 1;  1VQK Z;  2H85 A;  1Q86 2;  3RZD I;  4A3J I;  4NBB A;  3H0G I;  1VQ7 Z;  3MZK B;  3MON A;  2VUM I;  2GTI A;  3CCL 1;  2NVX I;  4DK1 A;  1KD1 1;  2OOY B;  3IF8 A;  1N8R 1;  2DE7 A;  3CC2 Z;  1M1K 1;  2P28 A;  4RVD A;  1RNI A;  3CCU Z;  4E32 A;  1YIT Z;  2LIY A;  2QEX Z;  2BJO A;  2V45 A;  3IR7 A;  1FDO A;  3GTJ I;  4NH1 C;  1VQ4 Z;  3CCV Z;  1SFO I;  3S14 I;  4A3B I;  3KIH A;  3HOZ I;  3M3Y I;  1L1O C;  3HOX I;  4NBE A;  1QVF Z;  5AN9 F;  1KD1 2;  5IT9 b;  1VQ7 1;  4A3M I;  4A3E I;  2IZ4 A;  2DE5 A;  1N8R 2;  2HU9 A;  3EED A;  4HH4 A;  2OZK A;  2JA8 I;  3I07 A;  2O53 A;  3I4M I;  3G71 Z;  2Q4Z A;  1WII A;  2WB1 A;  3P5J B;  3CC2 1;  2QLV B;  3GCF A;  1S72 Z;  3S1N I;  1S7M A;  3CCU 1;  2NVT I;  4E2Z A;  5D1P A;  4E33 A;  2O4H A;  4A3G I;  3F3P C;  2YU9 I;  3T4N B;  4E2X A;  2E9H A;  1NJI 1;  2IV2 X;  2QA4 Z;  1Q16 A;  3CCV 1;  1VQ5 Z;  2GU2 A;  3HKZ A;  1KC8 1;  4EWC A;  1VQ8 Z;  1VQ6 Z;  3I4N I;  3J7A 4;  3JAM b;  2NVQ I;  2Y0S A;  1Q81 1;  3JAM f;  2K5R A;  2M48 A;  3PO3 S;  2W03 A;  1DL6 A;  1Q82 1;  1ZH1 A;  3EER A;  2E2I I;  2JNY A;  3F3F C;  4QTT A;  3S1Q I;  5T6B A;  3HOW I;  1X3W A;  2K3R A;  1P9N A;  2E7Z A;  1Z03 A;  3G71 1;  4NBF A;  4MD8 A;  3NDJ A;  1S72 1;  2JS4 A;  2RHB A;  3CCS Z;  5T67 A;  2QKD A;  2VF1 A;  3GTO I;  1R9T I;  3QWU A;  1KC8 2;  1WW9 A;  4NBH A;  2QA4 1;  3CQZ I;  1K8A 1;  1VQ5 1;  2JIO A;  1QVF Y;  3GTQ I;  1VQ8 1;  1VQ6 1;  1W2B Z;  4NBC A;  3CCM Z;  1RO4 A;  1KQS Y;  3NH8 A;  3J81 b;  1Z01 A;  2OTJ 1;  3J81 f;  2V8K A;  1TWG I;  1JWH C;  1LQL A;  1AA6 A;  3Q87 A;  4DGL A;  1USP B;  2JIP A;  2V8J A;  1QF8 A;  3GTM I;  1YUA A;  2B63 I;  3CCS 1;  1K8A 2;  1TFI A;  2JMO A;  3M4O I;  2RPR A;  4Y7N I;  1ML8 A;  4MON A;  3S2H I;  1VLA A;  4MRI A;  2LEX A;  3CPW Z;  4AYB A;  2JIR A;  2W04 A;  3PO2 I;  1Q7Y 1;  2JA6 I;  3RZO I;  3CCJ Z;  1TWC I;  2YAD A;  4E30 A;  3CCM 1;  1QXF A;  5IT9 f;  1VQ9 Z;  2AKL A;  2QRD B;  2RIQ A;  1KQS Z;  1M1K 2;  2JIQ A;  3CMA Z;  1I3Q I;  1TWH I;  3K7A I;  1K73 1;  1M90 1;  1JJ2 Z;  1SIW A;  4S1T A;  1K83 I;  3VTN A;  3NFZ A;  2LFU A;  4E2Y A;  3VMI A;  3KIF A;  3D6W A;  2WAQ A;  3I56 Z;  1VQM 1;  4A3D I;  1Q7Y 2;  2V3V A;  4NBA A;  3CD6 Z;  5FLX b;  4QTU A;  4MXU A;  2QR1 B;  1W2B Y;  4BBS I;  4RS4 A;  3U50 C;  2V8I A;  1Y1V I;  1YJW Z;  5C3E I;  3CCJ 1;  3S1M I;  1X3Z A;  3MZL B;  2VPY A;  1NP6 A;  3BG1 B;  2OTJ Z;  3HOY I;  3LUS A;  1K73 2;  1VQ9 1;  2R7Z I;  1QVG Y;  4NB9 A;  1VQO Z;  4BY7 I;  3CCQ Z;  3CMA 1;  2EGT A;  3I55 Z;  4HGY A;  1VQN Z;  4HGZ A;  4X6A I;  2F4M A;  3CXC Y;  1NJI 2;  3IX0 A;  4NFR A;  2JA5 I;  2VPX A;  3S1R I;  4A3L I;  2RBL A;  3J80 b;  4XX2 A;  3I56 1;  2M6N A;  3J80 f;  3CPW Y;  3FKI I;  4TNU A;  1Q81 2;  2R6M A;  4RVH A;  3CD6 1;  5T64 A;  1Q82 2;  5D1O B;  3HOV I;  4A3I I;  1VQP Z;  1YJW 1;  4MD9 A;  3BG0 B;  2PM9 A;  2G2K A;  3HOU I;  2J6A A;  2KPI A;  3D9X A;  1VQO 1;  4RV9 A;  3S16 I;  1JJ2 Y;  1RQF A;  1USP A;  2QRE B;  2VPZ A;  2AYD A;  3CCQ 1;  1QVG Z;  3CC4 Z;  3G6E Z;  3GTM S;  3NH4 A;  3I55 1;  4CL1 A;  1VQL Z;  1VQN 1;  5C4X I;  4BY1 I;  1PFT A;  5IP9 I;  1Y1W I;  2HF1 A;  2JA7 I;  2R93 I;  2VUG A;  3CXC Z;  1K9M 1;  2DE6 A;  1VQM Z;  1WZN A;  2NAP A;  3D2L A;  2JR6 A;  3CCE 1;  4A3F I;  2KI7 B;  1NUI A;  1I6H I;  1RO2 A;  5C4J I;  4Y52 I;  3GTP I;  2F4O A;  3CC7 Z;  1TWA I;  1TWF I;  3ESW A;  1VQP 1;  4BBR I;  2QRC B;  1RO0 A;  3G4S Z;  2OTL Z;  3CCR Z;  4MD7 A;  1WJ2 A;  3NH5 A;  3OW2 Z;  2GTH A;  3S2D I;  2JIM A;  3CC4 1;  3GTK I;  3G6E 1;  1YUK A;  1YI2 Z;  1K9M 2;  1VQL 1;  1VQK 1;  1I50 I;  2E2H I;  1X0T A;  2ZAE B;  5CM2 M;  4RVG A;  4DQY B;  4BXX I;  2RT9 A;  3VMG A;  1FDI A;  2I3C A;  3CME Z;  1YJ9 Z;  2E2J I;  1KRL A;  1WCM I;  5FLX f;  1Y1V S;  2PK7 A;  3TDH B;  2Q51 A;  1YJN Z;  4E2W A;  3CC7 1;  5IP7 I;  1YIT 1;  3S15 I;  5LL6 f;  3G4S 1;  2OTL 1;  2QEX 1;  3CCR 1;  3FQQ A;  1M90 2;  4A3C I;  1ZB8 A;  1VQ4 1;  1YIJ Z; 
#chains in the Genus database with same CATH homology
 4NOZ A;  4RVF A;  2IZ3 A;  3S17 I;  3H3V J;  1YHQ Z;  1QYP A;  1YI2 1;  4NB8 A;  1N2F A;  1Z02 A;  3CCL Z;  3PO3 I;  2P3Y A;  4NBG A;  1Q86 1;  4NBD A;  3CCE Z;  5C44 I;  5A2Q b;  3GTL I;  5A2Q f;  3CME 1;  1YJ9 1;  5FLM I;  4A93 I;  1ZB9 A;  4E31 A;  5D1O A;  3GKQ A;  1YJN 1;  3NDI A;  2R92 I;  3VB9 A;  3IFU A;  4MH4 A;  3OW2 Y;  2PMZ A;  2OOX B;  3TE5 B;  3VMH A;  4A3K I;  1YIJ 1;  3FQM A;  2NVY I;  2JUB A;  3GTG I;  1RLY A;  1YHQ 1;  1VQK Z;  2H85 A;  1Q86 2;  3RZD I;  4A3J I;  4NBB A;  3H0G I;  1VQ7 Z;  3MZK B;  3MON A;  2VUM I;  2GTI A;  3CCL 1;  2NVX I;  4DK1 A;  1KD1 1;  2OOY B;  3IF8 A;  1N8R 1;  2DE7 A;  3CC2 Z;  1M1K 1;  2P28 A;  4RVD A;  1RNI A;  3CCU Z;  4E32 A;  1YIT Z;  2LIY A;  2QEX Z;  2BJO A;  3GTJ I;  4NH1 C;  1VQ4 Z;  3CCV Z;  1SFO I;  3S14 I;  4A3B I;  3KIH A;  3HOZ I;  3M3Y I;  1L1O C;  3HOX I;  4NBE A;  1QVF Z;  5AN9 F;  1KD1 2;  5IT9 b;  1VQ7 1;  4A3M I;  4A3E I;  2IZ4 A;  2DE5 A;  1N8R 2;  2HU9 A;  3EED A;  4HH4 A;  2OZK A;  2JA8 I;  3I07 A;  2O53 A;  3I4M I;  3G71 Z;  2Q4Z A;  1WII A;  2WB1 A;  3P5J B;  3CC2 1;  2QLV B;  3GCF A;  1S72 Z;  3S1N I;  1S7M A;  3CCU 1;  2NVT I;  4E2Z A;  5D1P A;  4E33 A;  2O4H A;  4A3G I;  3F3P C;  2YU9 I;  3T4N B;  4E2X A;  2E9H A;  1NJI 1;  2QA4 Z;  3CCV 1;  1VQ5 Z;  2GU2 A;  3HKZ A;  1KC8 1;  4EWC A;  1VQ8 Z;  1VQ6 Z;  3I4N I;  3J7A 4;  3JAM b;  2NVQ I;  2Y0S A;  1Q81 1;  3JAM f;  2K5R A;  2M48 A;  3PO3 S;  2W03 A;  1DL6 A;  1Q82 1;  1ZH1 A;  3EER A;  2E2I I;  2JNY A;  3F3F C;  4QTT A;  3S1Q I;  5T6B A;  3HOW I;  1X3W A;  2K3R A;  1P9N A;  1Z03 A;  3G71 1;  4NBF A;  4MD8 A;  3NDJ A;  1S72 1;  2JS4 A;  2RHB A;  3CCS Z;  5T67 A;  2QKD A;  2VF1 A;  3GTO I;  1R9T I;  3QWU A;  1KC8 2;  1WW9 A;  4NBH A;  2QA4 1;  3CQZ I;  1K8A 1;  1VQ5 1;  1QVF Y;  3GTQ I;  1VQ8 1;  1VQ6 1;  1W2B Z;  4NBC A;  3CCM Z;  1RO4 A;  1KQS Y;  3NH8 A;  3J81 b;  1Z01 A;  2OTJ 1;  3J81 f;  2V8K A;  1TWG I;  1JWH C;  1LQL A;  3Q87 A;  4DGL A;  1USP B;  2V8J A;  1QF8 A;  3GTM I;  1YUA A;  2B63 I;  3CCS 1;  1K8A 2;  1TFI A;  2JMO A;  3M4O I;  2RPR A;  4Y7N I;  1ML8 A;  4MON A;  3S2H I;  1VLA A;  4MRI A;  3CPW Z;  4AYB A;  2W04 A;  3PO2 I;  1Q7Y 1;  2JA6 I;  3RZO I;  3CCJ Z;  1TWC I;  2YAD A;  4E30 A;  3CCM 1;  1VQ9 Z;  5IT9 f;  2AKL A;  2QRD B;  2RIQ A;  1KQS Z;  1M1K 2;  3CMA Z;  1I3Q I;  1TWH I;  3K7A I;  1K73 1;  1M90 1;  1JJ2 Z;  4S1T A;  1K83 I;  3VTN A;  3NFZ A;  2LFU A;  4E2Y A;  3VMI A;  3KIF A;  3D6W A;  2WAQ A;  3I56 Z;  1VQM 1;  4A3D I;  1Q7Y 2;  4NBA A;  3CD6 Z;  5FLX b;  4QTU A;  4MXU A;  2QR1 B;  1W2B Y;  4BBS I;  4RS4 A;  3U50 C;  2V8I A;  1Y1V I;  1YJW Z;  5C3E I;  3CCJ 1;  3S1M I;  1X3Z A;  3MZL B;  1NP6 A;  3BG1 B;  2OTJ Z;  3HOY I;  3LUS A;  1K73 2;  1VQ9 1;  2R7Z I;  1QVG Y;  4NB9 A;  1VQO Z;  4BY7 I;  3CCQ Z;  3CMA 1;  2EGT A;  3I55 Z;  4HGY A;  1VQN Z;  4HGZ A;  4X6A I;  2F4M A;  3CXC Y;  1NJI 2;  3IX0 A;  4NFR A;  2JA5 I;  3S1R I;  4A3L I;  2RBL A;  3J80 b;  4XX2 A;  3I56 1;  2M6N A;  3J80 f;  3CPW Y;  3FKI I;  4TNU A;  1Q81 2;  2R6M A;  4RVH A;  3CD6 1;  5T64 A;  1Q82 2;  5D1O B;  3HOV I;  4A3I I;  1VQP Z;  1YJW 1;  4MD9 A;  3BG0 B;  2PM9 A;  2G2K A;  3HOU I;  2J6A A;  2KPI A;  3D9X A;  1VQO 1;  4RV9 A;  3S16 I;  1JJ2 Y;  1RQF A;  1USP A;  2QRE B;  1QVG Z;  3CCQ 1;  3CC4 Z;  3G6E Z;  3GTM S;  3NH4 A;  3I55 1;  4CL1 A;  1VQL Z;  1VQN 1;  5C4X I;  4BY1 I;  1PFT A;  5IP9 I;  1Y1W I;  2HF1 A;  2JA7 I;  2R93 I;  2VUG A;  3CXC Z;  1K9M 1;  2DE6 A;  1VQM Z;  3CCE 1;  2JR6 A;  4A3F I;  2KI7 B;  1NUI A;  1I6H I;  1RO2 A;  5C4J I;  4Y52 I;  3GTP I;  2F4O A;  3CC7 Z;  1TWA I;  1TWF I;  3ESW A;  1VQP 1;  4BBR I;  2QRC B;  1RO0 A;  3G4S Z;  2OTL Z;  3CCR Z;  4MD7 A;  3NH5 A;  3OW2 Z;  2GTH A;  3S2D I;  3CC4 1;  3GTK I;  3G6E 1;  1YUK A;  1YI2 Z;  1K9M 2;  1VQL 1;  1VQK 1;  1I50 I;  2E2H I;  1X0T A;  2ZAE B;  5CM2 M;  4RVG A;  4DQY B;  4BXX I;  2RT9 A;  3VMG A;  2I3C A;  3CME Z;  1YJ9 Z;  2E2J I;  1KRL A;  1WCM I;  5FLX f;  1Y1V S;  2PK7 A;  3TDH B;  2Q51 A;  1YJN Z;  4E2W A;  3CC7 1;  5IP7 I;  1YIT 1;  3S15 I;  5LL6 f;  3G4S 1;  2OTL 1;  2QEX 1;  3CCR 1;  3FQQ A;  1M90 2;  4A3C I;  1ZB8 A;  1VQ4 1;  1YIJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...