2J6AA

Crystal structure of s. cerevisiae ynr046w, a zinc finger protein from the erf1 methyltransferase complex.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
136
Chain Sequence
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN TRM112
publication title The Zinc Finger Protein Ynr046W is Plurifunctional and a Component of the Erf1 Methyltransferase in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 136
sequence length 136
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2j6aA00
2F4OA 2E2II 3GTGI 3K7AI 3GCFA 1WCMI 1I6HI 3GTLI 3Q87A 1ZB8A 4NBHA 1SFOI 3HOUI 4Y52I 2NVTI 3I4NI 4X6AI 2F4MA 1QYPA 2P3YA 1YUAA 5FLMI 1I50I 4A3CI 1DL6A 3GTOI 1TWFI 1L1OC 1X3WA 2VUMI 5IP7I 3GTMI 4A3FI 3S15I 1RO4A 3GTMS 4NBDA 5C44I 2JR6A 2JA8I 4NBCA 4BY7I 4A3EI 2NVQI 1ZB9A 5C4XI 4BXXI 4NBBA 3RZOI 3S2DI 2DE5A 4A93I 1NUIA 3EERA 2E2HI 2DE6A 3CQZI 4NOZA 4A3GI 3H3VJ 4A3DI 3PO3S 4NB8A 2NVYI 3VB9A 4A3KI 3HOXI 4A3II 2AKLA 4BBSI 4NBEA 2HF1A 2YU9I 1I3QI 3GTPI 3S1NI 3M3YI 3S16I 3S1QI 3VMGA 4XX2A 2JNYA 1USPA 5C4JI 5IP9I 2JA7I 3HOVI 3FKII 3GTKI 2K5RA 1TWHI 1LQLA 4A3LI 4NBGA 3M4OI 1X3ZA 1Y1VI 1Y1WI 3I4MI 3VMIA 4A3MI 1Y1VS 3LUSA 2JA5I 1RLYA 3PO2I 3D6WA 2JA6I 4NBAA 1TFIA 3PO3I 3S1MI 3S1RI 2E2JI 4BBRI 1N2FA 3I07A 1ML8A 1R9TI 2PK7A 1TWGI 1WW9A 5C3EI 1VLAA 3H0GI 3GTQI 3S14I 2RBLA 3RZDI 4Y7NI 2NVXI 3HOWI 4A3BI 3S2HI 4QTTA 3VMHA 2R92I 3HOZI 5CM2M 3HOYI 2J6AA 4MH4A 2KPIA 3GKQA 1TWCI 2DE7A 1USPB 4NB9A 4A3JI 1PFTA 3ESWA 3S17I 4QTUA 4BY1I 1TWAI 2R93I 1K83I 2R7ZI 2B63I 3GTJI 2JS4A 4NBFA 3U50C 2BJOA
chains in the Genus database with same CATH superfamily
3GTGI 4RVFA 3GTLI 3Q87A 4NBHA 1VQO1 1ZH1A 3CC2Z 1Q16A 3FQMA 1VQP1 4X6AI 3JAMf 2F4MA 2RIQA 2O4HA 2OOXB 2QEXZ 3CCJ1 3I561 2OOYB 1VQ8Z 2QLVB 4MD8A 3CCM1 1K8A2 2VUMI 3G4S1 1VQ91 2G2KA 2GTHA 3GTMS 3CC4Z 3VTNA 3CXCY 4NBCA 2JA8I 4A3EI 1QVGY 2NVQI 1K731 4NBBA 1Y8CA 3RZOI 1S72Z 4RVDA 3EEDA 3BG1B 4A3DI 4E2WA 2JIOA 2Y0SA 5D1OA 1NJI2 1I3QI 1JWHC 2AYDA 3M3YI 3S1QI 3VMGA 2QKDA 3J80b 1USPA 5C4JI 3CCQ1 1VQ6Z 2K5RA 4RV9A 1TWHI 2WAQA 2JMOA 3OW2Z 1Q861 2QRCB 1QVFY 3J81f 4NBAA 2KI7B 2LIYA 3J80f 1N2FA 1ML8A 4RVHA 4DK1A 4HGZA 1RO0A 1TWGI 3D9XA 4HGYA 5C3EI 1N8R2 3S14I 2RBLA 3RZDI 4A3BI 2V8KA 1YHQZ 2GTIA 3CCUZ 3CCLZ 1AA6A 3NDIA 2J6AA 2KPIA 3GKQA 1VQKZ 4A3JI 3ESWA 3CC7Z 4BY1I 1TWAI 1M1K1 5T64A 3CCSZ 4NBFA 3U50C 2PK7A 3TE5B 1KC81 1YJWZ 1KQSZ 1I6HI 2V8JA 2JUBA 1SFOI 2JIPA 4E32A 1WJ2A 2P3YA 1I50I 3GTOI 3CPWY 3NH5A 3QWUA 1Q811 2OTJZ 1L1OC 5IT9b 2JIQA 4S1TA 3BG0B 5T6BA 2VPXA 1M901 4A3FI 1RO4A 1FDOA 3G711 1S721 3KIHA 1ZB9A 1WZNA 1Q822 2P28A 3S2DI 1NUIA 3CD6Z 2E2HI 3CQZI 4A3GI 1VQMZ 3VB9A 1VQ41 3F3PC 2HF1A 2I3CA 3CME1 1YI21 1P9NA 4E2XA 5IP9I 3FQQA 1YITZ 2QA4Z 2LEXA 1X0TA 1LQLA 4MXUA 1VQLZ 3M4OI 1K8A1 1Y1VI 3I4MI 3MONA 2QREB 1VQ51 3PO2I 1K732 3G6EZ 1KQSY 3CCE1 4BBRI 2RPRA 1R9TI 1YHQ1 1JJ2Z 1Z02A 3H0GI 1Q7Y2 4NFRA 2NVXI 2Q4ZA 2WB1A 3VMHA 1Z03A 3CC71 5T67A 4MD9A 1NJI1 1RQFA 1VQOZ 4MH4A 1VQN1 2V3VA 3NFZA 1VQPZ 1S7MA 3CCVZ 2VF1A 4QTUA 1FDIA 1Q862 1YJN1 2B63I 3GTJI 3CCJZ 2JS4A 3I56Z 1SIWA 4NH1C 2VPWA 3GCFA 3CCMZ 4DGLA 3G4SZ 1VQ9Z 1ZB8A 1QXFA 1VQ71 3HOUI 4Y52I 2NVTI 3I55Z 3I4NI 1YUKA 2OTJ1 3IFUA 1YJ9Z 1QYPA 5FLMI 1DL6A 5AN9F 3NDJA 4RVGA 1TWFI 2V8IA 3GTMI 3CC21 4MONA 2W04A 1NP6A 5C44I 4BY7I 1M1K2 5C4XI 1K9M2 2QEX1 1KC82 3CCQZ 1VQM1 3TDHB 1VQ81 3HKZA 2M6NA 3IR7A 2VPYA 3EERA 3J7A4 2E7ZA 4TNUA 1KD12 4NB8A 3CC41 2IZ4A 1KRLA 4BBSI 1YIT1 3S1NI 2M48A 2JNYA 1W2BZ 2JA7I 1Q812 3CCRZ 2OTLZ 3IF8A 3NH4A 3OW2Y 4A3LI 1X3ZA 2K3RA 5IT9f 4RS4A 3VMIA 4E2ZA 4A3MI 3LUSA 1RO2A 5A2Qb 2JA6I 3PO3I 1TFIA 3S1MI 2V45A 3MZLB 2E2JI 4AYBA 3I07A 1VQ61 1Q821 1VLAA 2JIMA 3HOWI 1YIJZ 3S2HI 3CMAZ 3CCV1 2QRDB 5A2Qf 5D1OB 2IZ3A 3HOZI 3KIFA 3HOYI 2PM9A 1QF8A 2OZKA 1USPB 4NB9A 3D2LA 2R93I 3I551 2F4OA 2O53A 2YADA 2GU2A 2E2II 3K7AI 3CCU1 1WCMI 3CCL1 1YJ91 1VQK1 2EGTA 2VUGA 3G71Z 2PMZA 5FLXb 1YUAA 4A3CI 2H85A 1Q7Y1 3CCS1 2ZAEB 4EWCA 1W2BY 1YJW1 1X3WA 3J81b 3CPWZ 4E30A 3S15I 3F3FC 4NBDA 1VQ4Z 2JR6A 4HH4A 5FLXf 4E33A 3CMEZ 1YI2Z 1Z01A 4BXXI 4E31A 2VPZA 2DE5A 4A93I 2DE6A 4NOZA 1N8R1 3H3VJ 5D1PA 2LFUA 3PO3S 2NVYI 5LL6f 2R6MA 2RHBA 3HOXI 3CCR1 4A3II 2AKLA 2OTL1 2YU9I 3IX0A 1VQ5Z 3GTPI 3S16I 4XX2A 3CCEZ 4E2YA 3HOVI 3FKII 3GTKI 4CL1A 3CD61 4NBGA 2HU9A 3CXCZ 1Y1WI 2RT9A 2Q51A 1QVGZ 1Y1VS 2JA5I 1RLYA 3D6WA 1RNIA 1JJ2Y 1VQNZ 3S1RI 1YIJ1 2JIRA 1K9M1 3CMA1 2QA41 1WW9A 2QR1B 1VQL1 3GTQI 3T4NB 4Y7NI 1YJNZ 4DQYB 2IV2X 2W03A 3NH8A 3P5JB 1KD11 1M902 4QTTA 2E9HA 2R92I 1WIIA 5CM2M 3G6E1 4MD7A 1VQ7Z 4MRIA 3MZKB 1TWCI 2DE7A 1PFTA 3S17I 3JAMb 1K83I 2R7ZI 1QVFZ 2NAPA 4A3KI 5IP7I 4NBEA 2BJOA
chains in the Genus database with same CATH topology
3GTGI 4RVFA 3GTLI 3Q87A 4NBHA 1VQO1 1ZH1A 3CC2Z 3FQMA 1VQP1 4X6AI 3JAMf 2F4MA 2RIQA 2O4HA 2OOXB 2QEXZ 3CCJ1 3I561 2OOYB 1VQ8Z 2QLVB 4MD8A 3CCM1 1K8A2 2VUMI 3G4S1 1VQ91 2G2KA 2GTHA 3GTMS 3CC4Z 3VTNA 3CXCY 4NBCA 2JA8I 4A3EI 1QVGY 2NVQI 1K731 4NBBA 3RZOI 1S72Z 4RVDA 3EEDA 3BG1B 4A3DI 4E2WA 2Y0SA 5D1OA 1NJI2 1I3QI 1JWHC 3M3YI 3S1QI 3VMGA 2QKDA 3J80b 1USPA 5C4JI 3CCQ1 1VQ6Z 2K5RA 4RV9A 1TWHI 2WAQA 2JMOA 3OW2Z 1Q861 2QRCB 1QVFY 3J81f 4NBAA 2KI7B 2LIYA 3J80f 1N2FA 1ML8A 4RVHA 4DK1A 4HGZA 1RO0A 1TWGI 3D9XA 4HGYA 5C3EI 1N8R2 3S14I 2RBLA 3RZDI 4A3BI 2V8KA 1YHQZ 2GTIA 3CCUZ 3CCLZ 3NDIA 2J6AA 2KPIA 3GKQA 1VQKZ 4A3JI 3ESWA 3CC7Z 4BY1I 1TWAI 1M1K1 5T64A 3CCSZ 4NBFA 3U50C 2PK7A 3TE5B 1KC81 1YJWZ 1KQSZ 1I6HI 2V8JA 2JUBA 1SFOI 4E32A 2P3YA 1I50I 3GTOI 3CPWY 3NH5A 3QWUA 1Q811 2OTJZ 1L1OC 5IT9b 4S1TA 3BG0B 5T6BA 1M901 4A3FI 1RO4A 3G711 1S721 3KIHA 1ZB9A 1Q822 2P28A 3S2DI 1NUIA 3CD6Z 2E2HI 3CQZI 4A3GI 1VQMZ 3VB9A 1VQ41 3F3PC 2HF1A 2I3CA 3CME1 1YI21 1P9NA 4E2XA 5IP9I 3FQQA 1YITZ 2QA4Z 1X0TA 1LQLA 4MXUA 1VQLZ 3M4OI 1K8A1 1Y1VI 3I4MI 3MONA 2QREB 1VQ51 3PO2I 1K732 3G6EZ 1KQSY 3CCE1 4BBRI 2RPRA 1R9TI 1YHQ1 1JJ2Z 1Z02A 3H0GI 1Q7Y2 4NFRA 2NVXI 2Q4ZA 2WB1A 3VMHA 3CC71 1Z03A 5T67A 4MD9A 1NJI1 1RQFA 1VQOZ 4MH4A 1VQN1 3NFZA 1VQPZ 1S7MA 3CCVZ 2VF1A 4QTUA 1Q862 1YJN1 2B63I 3GTJI 3CCJZ 2JS4A 3I56Z 4NH1C 3GCFA 3CCMZ 4DGLA 3G4SZ 1VQ9Z 1ZB8A 3HOUI 1VQ71 4Y52I 2NVTI 3I55Z 3I4NI 1YUKA 2OTJ1 3IFUA 1YJ9Z 1QYPA 5FLMI 1DL6A 5AN9F 3NDJA 4RVGA 1TWFI 2V8IA 3GTMI 3CC21 4MONA 2W04A 1NP6A 5C44I 4BY7I 1M1K2 5C4XI 1K9M2 2QEX1 1KC82 3CCQZ 1VQM1 3TDHB 1VQ81 3HKZA 2M6NA 3EERA 3J7A4 4TNUA 1KD12 4NB8A 3CC41 2IZ4A 1KRLA 4BBSI 1YIT1 3S1NI 2M48A 2JNYA 1W2BZ 2JA7I 1Q812 3CCRZ 2OTLZ 3IF8A 3NH4A 3OW2Y 4A3LI 1X3ZA 2K3RA 5IT9f 4RS4A 3VMIA 4E2ZA 4A3MI 3LUSA 1RO2A 5A2Qb 2JA6I 3PO3I 1TFIA 3S1MI 3MZLB 2E2JI 4AYBA 3I07A 1VQ61 1Q821 1VLAA 3HOWI 1YIJZ 3S2HI 3CMAZ 3CCV1 2QRDB 5A2Qf 5D1OB 2IZ3A 3HOZI 3KIFA 3HOYI 2PM9A 1QF8A 2OZKA 1USPB 4NB9A 2R93I 3I551 2F4OA 2O53A 2YADA 2GU2A 2E2II 3K7AI 3CCU1 1WCMI 3CCL1 1YJ91 1VQK1 2EGTA 2VUGA 3G71Z 2PMZA 5FLXb 1YUAA 4A3CI 2H85A 1Q7Y1 3CCS1 2ZAEB 4EWCA 1W2BY 1YJW1 1X3WA 3J81b 3CPWZ 4E30A 3S15I 3F3FC 4NBDA 1VQ4Z 2JR6A 4HH4A 5FLXf 4E33A 3CMEZ 1YI2Z 1Z01A 4BXXI 4E31A 2DE5A 4A93I 2DE6A 4NOZA 1N8R1 3H3VJ 5D1PA 2LFUA 3PO3S 2NVYI 5LL6f 2R6MA 2RHBA 3HOXI 3CCR1 4A3II 2AKLA 2OTL1 2YU9I 3IX0A 1VQ5Z 3GTPI 3S16I 4XX2A 3CCEZ 4E2YA 3HOVI 3FKII 3GTKI 4CL1A 3CD61 4NBGA 2HU9A 3CXCZ 1Y1WI 2RT9A 2Q51A 1QVGZ 1Y1VS 2JA5I 1RLYA 3D6WA 1RNIA 1JJ2Y 1VQNZ 3S1RI 1YIJ1 1K9M1 3CMA1 2QA41 1WW9A 2QR1B 1VQL1 3GTQI 3T4NB 4Y7NI 1YJNZ 4DQYB 2W03A 3NH8A 3P5JB 1KD11 1M902 4QTTA 2E9HA 2R92I 1WIIA 5CM2M 3G6E1 4MD7A 1VQ7Z 4MRIA 3MZKB 1TWCI 2DE7A 1PFTA 3S17I 3JAMb 1K83I 2R7ZI 1QVFZ 4A3KI 5IP7I 4NBEA 2BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4O A;  2E2I I;  3GTG I;  3K7A I;  3GCF A;  1WCM I;  1I6H I;  3GTL I;  3Q87 A;  1ZB8 A;  4NBH A;  1SFO I;  3HOU I;  4Y52 I;  2NVT I;  3I4N I;  4X6A I;  2F4M A;  1QYP A;  2P3Y A;  1YUA A;  5FLM I;  1I50 I;  4A3C I;  1DL6 A;  3GTO I;  1TWF I;  1L1O C;  1X3W A;  2VUM I;  5IP7 I;  3GTM I;  4A3F I;  3S15 I;  1RO4 A;  3GTM S;  4NBD A;  5C44 I;  2JR6 A;  2JA8 I;  4NBC A;  4BY7 I;  4A3E I;  2NVQ I;  1ZB9 A;  5C4X I;  4BXX I;  4NBB A;  3RZO I;  3S2D I;  2DE5 A;  4A93 I;  1NUI A;  3EER A;  2E2H I;  2DE6 A;  3CQZ I;  4NOZ A;  4A3G I;  3H3V J;  4A3D I;  3PO3 S;  4NB8 A;  2NVY I;  3VB9 A;  4A3K I;  3HOX I;  4A3I I;  2AKL A;  4BBS I;  4NBE A;  2HF1 A;  2YU9 I;  1I3Q I;  3GTP I;  3S1N I;  3M3Y I;  3S16 I;  3S1Q I;  3VMG A;  4XX2 A;  2JNY A;  1USP A;  5C4J I;  5IP9 I;  2JA7 I;  3HOV I;  3FKI I;  3GTK I;  2K5R A;  1TWH I;  1LQL A;  4A3L I;  4NBG A;  3M4O I;  1X3Z A;  1Y1V I;  1Y1W I;  3I4M I;  3VMI A;  4A3M I;  1Y1V S;  3LUS A;  2JA5 I;  1RLY A;  3PO2 I;  3D6W A;  2JA6 I;  4NBA A;  1TFI A;  3PO3 I;  3S1M I;  3S1R I;  2E2J I;  4BBR I;  1N2F A;  3I07 A;  1ML8 A;  1R9T I;  2PK7 A;  1TWG I;  1WW9 A;  5C3E I;  1VLA A;  3H0G I;  3GTQ I;  3S14 I;  2RBL A;  3RZD I;  4Y7N I;  2NVX I;  3HOW I;  4A3B I;  3S2H I;  4QTT A;  3VMH A;  2R92 I;  3HOZ I;  5CM2 M;  3HOY I;  2J6A A;  4MH4 A;  2KPI A;  3GKQ A;  1TWC I;  2DE7 A;  1USP B;  4NB9 A;  4A3J I;  1PFT A;  3ESW A;  3S17 I;  4QTU A;  4BY1 I;  1TWA I;  2R93 I;  1K83 I;  2R7Z I;  2B63 I;  3GTJ I;  2JS4 A;  4NBF A;  3U50 C;  2BJO A; 
#chains in the Genus database with same CATH topology
 3GTG I;  4RVF A;  3GTL I;  3Q87 A;  4NBH A;  1VQO 1;  1ZH1 A;  3CC2 Z;  1Q16 A;  3FQM A;  1VQP 1;  4X6A I;  3JAM f;  2F4M A;  2RIQ A;  2O4H A;  2OOX B;  2QEX Z;  3CCJ 1;  3I56 1;  2OOY B;  1VQ8 Z;  2QLV B;  4MD8 A;  3CCM 1;  1K8A 2;  2VUM I;  3G4S 1;  1VQ9 1;  2G2K A;  2GTH A;  3GTM S;  3CC4 Z;  3VTN A;  3CXC Y;  4NBC A;  2JA8 I;  4A3E I;  1QVG Y;  2NVQ I;  1K73 1;  4NBB A;  1Y8C A;  3RZO I;  1S72 Z;  4RVD A;  3EED A;  3BG1 B;  4A3D I;  4E2W A;  2JIO A;  2Y0S A;  5D1O A;  1NJI 2;  1I3Q I;  1JWH C;  2AYD A;  3M3Y I;  3S1Q I;  3VMG A;  2QKD A;  3J80 b;  1USP A;  5C4J I;  3CCQ 1;  1VQ6 Z;  2K5R A;  4RV9 A;  1TWH I;  2WAQ A;  2JMO A;  3OW2 Z;  1Q86 1;  2QRC B;  1QVF Y;  3J81 f;  4NBA A;  2KI7 B;  2LIY A;  3J80 f;  1N2F A;  1ML8 A;  4RVH A;  4DK1 A;  4HGZ A;  1RO0 A;  1TWG I;  3D9X A;  4HGY A;  5C3E I;  1N8R 2;  3S14 I;  2RBL A;  3RZD I;  4A3B I;  2V8K A;  1YHQ Z;  2GTI A;  3CCU Z;  3CCL Z;  1AA6 A;  3NDI A;  2J6A A;  2KPI A;  3GKQ A;  1VQK Z;  4A3J I;  3ESW A;  3CC7 Z;  4BY1 I;  1TWA I;  1M1K 1;  5T64 A;  3CCS Z;  4NBF A;  3U50 C;  2PK7 A;  3TE5 B;  1KC8 1;  1YJW Z;  1KQS Z;  1I6H I;  2V8J A;  2JUB A;  1SFO I;  2JIP A;  4E32 A;  1WJ2 A;  2P3Y A;  1I50 I;  3GTO I;  3CPW Y;  3NH5 A;  3QWU A;  1Q81 1;  2OTJ Z;  1L1O C;  5IT9 b;  2JIQ A;  4S1T A;  3BG0 B;  5T6B A;  2VPX A;  1M90 1;  4A3F I;  1RO4 A;  1FDO A;  3G71 1;  1S72 1;  3KIH A;  1ZB9 A;  1WZN A;  1Q82 2;  2P28 A;  3S2D I;  1NUI A;  3CD6 Z;  2E2H I;  3CQZ I;  4A3G I;  1VQM Z;  3VB9 A;  1VQ4 1;  3F3P C;  2HF1 A;  2I3C A;  3CME 1;  1YI2 1;  1P9N A;  4E2X A;  5IP9 I;  3FQQ A;  1YIT Z;  2QA4 Z;  2LEX A;  1X0T A;  1LQL A;  4MXU A;  1VQL Z;  3M4O I;  1K8A 1;  1Y1V I;  3I4M I;  3MON A;  2QRE B;  1VQ5 1;  3PO2 I;  1K73 2;  3G6E Z;  1KQS Y;  3CCE 1;  4BBR I;  2RPR A;  1R9T I;  1YHQ 1;  1JJ2 Z;  1Z02 A;  3H0G I;  1Q7Y 2;  4NFR A;  2NVX I;  2Q4Z A;  2WB1 A;  3VMH A;  1Z03 A;  3CC7 1;  5T67 A;  4MD9 A;  1NJI 1;  1RQF A;  1VQO Z;  4MH4 A;  1VQN 1;  2V3V A;  3NFZ A;  1VQP Z;  1S7M A;  3CCV Z;  2VF1 A;  4QTU A;  1FDI A;  1Q86 2;  1YJN 1;  2B63 I;  3GTJ I;  3CCJ Z;  2JS4 A;  3I56 Z;  1SIW A;  4NH1 C;  2VPW A;  3GCF A;  3CCM Z;  4DGL A;  3G4S Z;  1VQ9 Z;  1ZB8 A;  1QXF A;  1VQ7 1;  3HOU I;  4Y52 I;  2NVT I;  3I55 Z;  3I4N I;  1YUK A;  2OTJ 1;  3IFU A;  1YJ9 Z;  1QYP A;  5FLM I;  1DL6 A;  5AN9 F;  3NDJ A;  4RVG A;  1TWF I;  2V8I A;  3GTM I;  3CC2 1;  4MON A;  2W04 A;  1NP6 A;  5C44 I;  4BY7 I;  1M1K 2;  5C4X I;  1K9M 2;  2QEX 1;  1KC8 2;  3CCQ Z;  1VQM 1;  3TDH B;  1VQ8 1;  3HKZ A;  2M6N A;  3IR7 A;  2VPY A;  3EER A;  3J7A 4;  2E7Z A;  4TNU A;  1KD1 2;  4NB8 A;  3CC4 1;  2IZ4 A;  1KRL A;  4BBS I;  1YIT 1;  3S1N I;  2M48 A;  2JNY A;  1W2B Z;  2JA7 I;  1Q81 2;  3CCR Z;  2OTL Z;  3IF8 A;  3NH4 A;  3OW2 Y;  4A3L I;  1X3Z A;  2K3R A;  5IT9 f;  4RS4 A;  3VMI A;  4E2Z A;  4A3M I;  3LUS A;  1RO2 A;  5A2Q b;  2JA6 I;  3PO3 I;  1TFI A;  3S1M I;  2V45 A;  3MZL B;  2E2J I;  4AYB A;  3I07 A;  1VQ6 1;  1Q82 1;  1VLA A;  2JIM A;  3HOW I;  1YIJ Z;  3S2H I;  3CMA Z;  3CCV 1;  2QRD B;  5A2Q f;  5D1O B;  2IZ3 A;  3HOZ I;  3KIF A;  3HOY I;  2PM9 A;  1QF8 A;  2OZK A;  1USP B;  4NB9 A;  3D2L A;  2R93 I;  3I55 1;  2F4O A;  2O53 A;  2YAD A;  2GU2 A;  2E2I I;  3K7A I;  3CCU 1;  1WCM I;  3CCL 1;  1YJ9 1;  1VQK 1;  2EGT A;  2VUG A;  3G71 Z;  2PMZ A;  5FLX b;  1YUA A;  4A3C I;  2H85 A;  1Q7Y 1;  3CCS 1;  2ZAE B;  4EWC A;  1W2B Y;  1YJW 1;  1X3W A;  3J81 b;  3CPW Z;  4E30 A;  3S15 I;  3F3F C;  4NBD A;  1VQ4 Z;  2JR6 A;  4HH4 A;  5FLX f;  4E33 A;  3CME Z;  1YI2 Z;  1Z01 A;  4BXX I;  4E31 A;  2VPZ A;  2DE5 A;  4A93 I;  2DE6 A;  4NOZ A;  1N8R 1;  3H3V J;  5D1P A;  2LFU A;  3PO3 S;  2NVY I;  5LL6 f;  2R6M A;  2RHB A;  3HOX I;  3CCR 1;  4A3I I;  2AKL A;  2OTL 1;  2YU9 I;  3IX0 A;  1VQ5 Z;  3GTP I;  3S16 I;  4XX2 A;  3CCE Z;  4E2Y A;  3HOV I;  3FKI I;  3GTK I;  4CL1 A;  3CD6 1;  4NBG A;  2HU9 A;  3CXC Z;  1Y1W I;  2RT9 A;  2Q51 A;  1QVG Z;  1Y1V S;  2JA5 I;  1RLY A;  3D6W A;  1RNI A;  1JJ2 Y;  1VQN Z;  3S1R I;  1YIJ 1;  2JIR A;  1K9M 1;  3CMA 1;  2QA4 1;  1WW9 A;  2QR1 B;  1VQL 1;  3GTQ I;  3T4N B;  4Y7N I;  1YJN Z;  4DQY B;  2IV2 X;  2W03 A;  3NH8 A;  3P5J B;  1KD1 1;  1M90 2;  4QTT A;  2E9H A;  2R92 I;  1WII A;  5CM2 M;  3G6E 1;  4MD7 A;  1VQ7 Z;  4MRI A;  3MZK B;  1TWC I;  2DE7 A;  1PFT A;  3S17 I;  3JAM b;  1K83 I;  2R7Z I;  1QVF Z;  2NAP A;  4A3K I;  5IP7 I;  4NBE A;  2BJO A; 
#chains in the Genus database with same CATH homology
 3GTG I;  4RVF A;  3GTL I;  3Q87 A;  4NBH A;  1VQO 1;  1ZH1 A;  3CC2 Z;  3FQM A;  1VQP 1;  4X6A I;  3JAM f;  2F4M A;  2RIQ A;  2O4H A;  2OOX B;  2QEX Z;  3CCJ 1;  3I56 1;  2OOY B;  1VQ8 Z;  2QLV B;  4MD8 A;  3CCM 1;  1K8A 2;  2VUM I;  3G4S 1;  1VQ9 1;  2G2K A;  2GTH A;  3GTM S;  3CC4 Z;  3VTN A;  3CXC Y;  4NBC A;  2JA8 I;  4A3E I;  1QVG Y;  2NVQ I;  1K73 1;  4NBB A;  3RZO I;  1S72 Z;  4RVD A;  3EED A;  3BG1 B;  4A3D I;  4E2W A;  2Y0S A;  5D1O A;  1NJI 2;  1I3Q I;  1JWH C;  3M3Y I;  3S1Q I;  3VMG A;  2QKD A;  3J80 b;  1USP A;  5C4J I;  3CCQ 1;  1VQ6 Z;  2K5R A;  4RV9 A;  1TWH I;  2WAQ A;  2JMO A;  3OW2 Z;  1Q86 1;  2QRC B;  1QVF Y;  3J81 f;  4NBA A;  2KI7 B;  2LIY A;  3J80 f;  1N2F A;  1ML8 A;  4RVH A;  4DK1 A;  4HGZ A;  1RO0 A;  1TWG I;  3D9X A;  4HGY A;  5C3E I;  1N8R 2;  3S14 I;  2RBL A;  3RZD I;  4A3B I;  2V8K A;  1YHQ Z;  2GTI A;  3CCU Z;  3CCL Z;  3NDI A;  2J6A A;  2KPI A;  3GKQ A;  1VQK Z;  4A3J I;  3ESW A;  3CC7 Z;  4BY1 I;  1TWA I;  1M1K 1;  5T64 A;  3CCS Z;  4NBF A;  3U50 C;  2PK7 A;  3TE5 B;  1KC8 1;  1YJW Z;  1KQS Z;  1I6H I;  2V8J A;  2JUB A;  1SFO I;  4E32 A;  2P3Y A;  1I50 I;  3GTO I;  3CPW Y;  3NH5 A;  3QWU A;  1Q81 1;  2OTJ Z;  1L1O C;  5IT9 b;  4S1T A;  3BG0 B;  5T6B A;  1M90 1;  4A3F I;  1RO4 A;  3G71 1;  1S72 1;  3KIH A;  1ZB9 A;  1Q82 2;  2P28 A;  3S2D I;  1NUI A;  3CD6 Z;  2E2H I;  3CQZ I;  4A3G I;  1VQM Z;  3VB9 A;  1VQ4 1;  3F3P C;  2HF1 A;  2I3C A;  3CME 1;  1YI2 1;  1P9N A;  4E2X A;  5IP9 I;  3FQQ A;  1YIT Z;  2QA4 Z;  1X0T A;  1LQL A;  4MXU A;  1VQL Z;  3M4O I;  1K8A 1;  1Y1V I;  3I4M I;  3MON A;  2QRE B;  1VQ5 1;  3PO2 I;  1K73 2;  3G6E Z;  1KQS Y;  3CCE 1;  4BBR I;  2RPR A;  1R9T I;  1YHQ 1;  1JJ2 Z;  1Z02 A;  3H0G I;  1Q7Y 2;  4NFR A;  2NVX I;  2Q4Z A;  2WB1 A;  3VMH A;  3CC7 1;  1Z03 A;  5T67 A;  4MD9 A;  1NJI 1;  1RQF A;  1VQO Z;  4MH4 A;  1VQN 1;  3NFZ A;  1VQP Z;  1S7M A;  3CCV Z;  2VF1 A;  4QTU A;  1Q86 2;  1YJN 1;  2B63 I;  3GTJ I;  3CCJ Z;  2JS4 A;  3I56 Z;  4NH1 C;  3GCF A;  3CCM Z;  4DGL A;  3G4S Z;  1VQ9 Z;  1ZB8 A;  3HOU I;  1VQ7 1;  4Y52 I;  2NVT I;  3I55 Z;  3I4N I;  1YUK A;  2OTJ 1;  3IFU A;  1YJ9 Z;  1QYP A;  5FLM I;  1DL6 A;  5AN9 F;  3NDJ A;  4RVG A;  1TWF I;  2V8I A;  3GTM I;  3CC2 1;  4MON A;  2W04 A;  1NP6 A;  5C44 I;  4BY7 I;  1M1K 2;  5C4X I;  1K9M 2;  2QEX 1;  1KC8 2;  3CCQ Z;  1VQM 1;  3TDH B;  1VQ8 1;  3HKZ A;  2M6N A;  3EER A;  3J7A 4;  4TNU A;  1KD1 2;  4NB8 A;  3CC4 1;  2IZ4 A;  1KRL A;  4BBS I;  1YIT 1;  3S1N I;  2M48 A;  2JNY A;  1W2B Z;  2JA7 I;  1Q81 2;  3CCR Z;  2OTL Z;  3IF8 A;  3NH4 A;  3OW2 Y;  4A3L I;  1X3Z A;  2K3R A;  5IT9 f;  4RS4 A;  3VMI A;  4E2Z A;  4A3M I;  3LUS A;  1RO2 A;  5A2Q b;  2JA6 I;  3PO3 I;  1TFI A;  3S1M I;  3MZL B;  2E2J I;  4AYB A;  3I07 A;  1VQ6 1;  1Q82 1;  1VLA A;  3HOW I;  1YIJ Z;  3S2H I;  3CMA Z;  3CCV 1;  2QRD B;  5A2Q f;  5D1O B;  2IZ3 A;  3HOZ I;  3KIF A;  3HOY I;  2PM9 A;  1QF8 A;  2OZK A;  1USP B;  4NB9 A;  2R93 I;  3I55 1;  2F4O A;  2O53 A;  2YAD A;  2GU2 A;  2E2I I;  3K7A I;  3CCU 1;  1WCM I;  3CCL 1;  1YJ9 1;  1VQK 1;  2EGT A;  2VUG A;  3G71 Z;  2PMZ A;  5FLX b;  1YUA A;  4A3C I;  2H85 A;  1Q7Y 1;  3CCS 1;  2ZAE B;  4EWC A;  1W2B Y;  1YJW 1;  1X3W A;  3J81 b;  3CPW Z;  4E30 A;  3S15 I;  3F3F C;  4NBD A;  1VQ4 Z;  2JR6 A;  4HH4 A;  5FLX f;  4E33 A;  3CME Z;  1YI2 Z;  1Z01 A;  4BXX I;  4E31 A;  2DE5 A;  4A93 I;  2DE6 A;  4NOZ A;  1N8R 1;  3H3V J;  5D1P A;  2LFU A;  3PO3 S;  2NVY I;  5LL6 f;  2R6M A;  2RHB A;  3HOX I;  3CCR 1;  4A3I I;  2AKL A;  2OTL 1;  2YU9 I;  3IX0 A;  1VQ5 Z;  3GTP I;  3S16 I;  4XX2 A;  3CCE Z;  4E2Y A;  3HOV I;  3FKI I;  3GTK I;  4CL1 A;  3CD6 1;  4NBG A;  2HU9 A;  3CXC Z;  1Y1W I;  2RT9 A;  2Q51 A;  1QVG Z;  1Y1V S;  2JA5 I;  1RLY A;  3D6W A;  1RNI A;  1JJ2 Y;  1VQN Z;  3S1R I;  1YIJ 1;  1K9M 1;  3CMA 1;  2QA4 1;  1WW9 A;  2QR1 B;  1VQL 1;  3GTQ I;  3T4N B;  4Y7N I;  1YJN Z;  4DQY B;  2W03 A;  3NH8 A;  3P5J B;  1KD1 1;  1M90 2;  4QTT A;  2E9H A;  2R92 I;  1WII A;  5CM2 M;  3G6E 1;  4MD7 A;  1VQ7 Z;  4MRI A;  3MZK B;  1TWC I;  2DE7 A;  1PFT A;  3S17 I;  3JAM b;  1K83 I;  2R7Z I;  1QVF Z;  4A3K I;  5IP7 I;  4NBE A;  2BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...