2J6AA

Crystal structure of s. cerevisiae ynr046w, a zinc finger protein from the erf1 methyltransferase complex.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
136
Chain Sequence
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TRM112
publication title The Zinc Finger Protein Ynr046W is Plurifunctional and a Component of the Erf1 Methyltransferase in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 33
structure length 136
sequence length 136
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2j6aA00
2DE7A 2JS4A 2YU9I 2JA7I 1X3WA 1N2FA 5FLMI 3S2HI 1ZB8A 3I4MI 5IP7I 3M4OI 1ML8A 4QTUA 1Y1VI 4BBRI 2JR6A 1YUAA 1SFOI 1ZB9A 1I6HI 3LUSA 2PK7A 1Y1WI 3I4NI 4A3DI 3VMIA 3RZOI 5C4XI 1RLYA 2JA5I 4A3GI 3GTMS 3HOVI 3VMHA 2NVQI 4QTTA 1USPA 4NBGA 1LQLA 3GTQI 5C4JI 4NBFA 2F4OA 2HF1A 3S14I 3HOZI 5C3EI 2NVYI 1RO4A 2NVTI 3ESWA 1VLAA 4A3MI 4NOZA 1QYPA 3S1MI 2F4MA 4BXXI 2KPIA 3K7AI 4A3II 1Y1VS 4A3KI 3S2DI 2E2II 3RZDI 4BBSI 3GTPI 4XX2A 1I50I 1PFTA 2E2HI 2AKLA 1TWFI 3GTOI 1L1OC 2R93I 2R92I 3H0GI 4MH4A 1TFIA 3CQZI 1TWHI 1NUIA 1WW9A 3EERA 1TWAI 2J6AA 3GTLI 4A93I 5CM2M 3M3YI 2DE6A 4NBEA 3PO3I 3GTGI 4NBHA 2P3YA 3GKQA 2JA8I 2JNYA 3VB9A 4BY7I 3U50C 4A3CI 3Q87A 3GTJI 3FKII 1K83I 2E2JI 3S16I 3H3VJ 3S1NI 4BY1I 2RBLA 1I3QI 1WCMI 4NBAA 3HOXI 3S1RI 3S1QI 3HOUI 1TWGI 2B63I 1DL6A 3D6WA 2DE5A 4A3FI 2NVXI 4A3EI 2R7ZI 4A3BI 3VMGA 4Y7NI 1X3ZA 4NBDA 3HOWI 3GTKI 2JA6I 3GCFA 3S17I 1USPB 3I07A 3PO3S 5C44I 5IP9I 3S15I 4A3LI 2K5RA 3GTMI 4A3JI 4X6AI 4NB8A 4NB9A 3PO2I 4NBCA 1R9TI 2BJOA 4Y52I 2VUMI 4NBBA 3HOYI 1TWCI
chains in the Genus database with same CATH superfamily
2YU9I 2JA7I 3D9XA 1X3WA 3CCQ1 1AA6A 5FLMI 3I4MI 5IP7I 2W03A 1P9NA 2W04A 1ML8A 2VPWA 2RPRA 1YUAA 1I6HI 4E32A 2OTLZ 5FLXf 3CD6Z 4A3DI 3G4S1 1K9M2 4RVGA 3CCV1 1YITZ 2JMOA 2QLVB 4E2ZA 2NVYI 3J81b 4RVDA 1VLAA 4NOZA 3K7AI 2NAPA 2QR1B 1JJ2Z 2E2II 3RZDI 1FDOA 2QEX1 3GTPI 1I50I 3I561 1JJ2Y 2E2HI 1FDIA 1RNIA 1TWFI 2RT9A 2R92I 3H0GI 4MH4A 4MD7A 3BG1B 3EERA 1TWAI 5AN9F 1KC82 1Z01A 4A93I 3GTGI 2P3YA 3TE5B 2WB1A 3GTJI 3FKII 3J80f 3CC2Z 3S16I 3MONA 3NDIA 3CMA1 3CCQZ 1WCMI 3MZLB 4MONA 4E2XA 3S1QI 1WJ2A 3HOUI 3JAMb 1X0TA 1VQ81 3VMGA 4Y7NI 3HOWI 1W2BZ 3GTKI 2VUGA 3GCFA 3S17I 1W2BY 5IT9f 2E7ZA 2JUBA 4A3JI 4X6AI 1YJ91 3TDHB 4NBBA 1TWCI 2DE7A 2JS4A 1M1K1 2P28A 4E33A 1YI2Z 1Q821 4CL1A 2ZAEB 4RVFA 2PM9A 3LUSA 2Q51A 3CCL1 1VQK1 2PK7A 3I4NI 2E9HA 3VMIA 3D2LA 5C4XI 3G71Z 1RLYA 2HU9A 2JA5I 3GTMS 1VQNZ 1VQ61 3HOVI 5D1OA 1KD11 1USPA 1VQP1 2R6MA 1VQ7Z 2OTJ1 5C3EI 3CCUZ 1VQ41 1VQOZ 2QKDA 2V3VA 4A3MI 1KQSZ 2QA41 2GU2A 1KQSY 4HGYA 1S72Z 3T4NB 3CC41 2V8KA 2IV2X 1Q16A 3GTOI 2YADA 3J80b 2R93I 3CC71 3CQZI 1NUIA 1TWHI 3GTLI 4NBEA 2M48A 4NBHA 3GKQA 1YIJZ 1YJW1 3H3VJ 2WAQA 2RBLA 1I3QI 3G6EZ 4NBAA 5LL6f 1QVGZ 5IT9b 4RS4A 4S1TA 2LFUA 4A3FI 1N8R1 4A3BI 4NBDA 5T6BA 4DGLA 2V8IA 1M1K2 2JA6I 2JIRA 5D1OB 2AYDA 1USPB 3PO3S 4MXUA 1YHQZ 1VQ51 1VQM1 4A3LI 1NJI1 3HKZA 2K5RA 3GTMI 4NB8A 3CCR1 2OTJZ 1RQFA 4NB9A 3I551 1VQ4Z 2VPZA 4E2WA 1NP6A 2I3CA 3HOYI 2V45A 3J7A4 5T67A 1N2FA 1KD12 2QA4Z 3S2HI 1ZB8A 1VQL1 5A2Qf 3CPWZ 3M4OI 1Q7Y1 3G4SZ 1SFOI 3CC4Z 4MD8A 1ZB9A 1Y1WI 3CCVZ 3KIHA 4E2YA 2VF1A 3CCE1 3RZOI 2Y0SA 2OTL1 3CD61 4NBGA 4AYBA 3IX0A 5FLXb 4NBFA 2F4OA 2HF1A 1Q861 3HOZI 1RO4A 3ESWA 2GTHA 2K3RA 2JIQA 3S1MI 4BXXI 2QEXZ 3I56Z 1Y1VS 2G2KA 4A3KI 1QVFZ 3F3FC 4HH4A 4BBSI 4XX2A 1PFTA 3IR7A 3KIFA 1RO0A 3FQQA 3IF8A 2LEXA 1TFIA 3OW2Z 3BG0B 1VQ5Z 2OOYB 1VQMZ 2J6AA 3OW2Y 1N8R2 2QREB 3M3YI 3CCRZ 4E31A 3PO3I 3CMAZ 1K8A1 2VPXA 3VB9A 4TNUA 1Z03A 4EWCA 1S7MA 3Q87A 1K83I 1QF8A 3S1NI 4BY1I 1YUKA 3FQMA 1VQ8Z 2LIYA 1NJI2 3HOXI 1TWGI 1Q811 3CME1 2DE5A 3IFUA 2IZ4A 4A3EI 1Z02A 1X3ZA 2KI7B 2PMZA 3CCEZ 3CCM1 1VQ91 3NFZA 4HGZA 1Y8CA 3F3PC 1YJ9Z 1Q7Y2 3S15I 3CCS1 5A2Qb 1JWHC 1M901 4E30A 1WIIA 3P5JB 3PO2I 3NH8A 1R9TI 3NH5A 2JIMA 2QRCB 1QVGY 2OOXB 3CCLZ 1VQKZ 1Q862 4QTUA 1Y1VI 4BBRI 2JR6A 4RV9A 1K731 3EEDA 1SIWA 1VQ6Z 3VTNA 1Q822 1YI21 2VPYA 1VQPZ 4MRIA 3CCJ1 4A3GI 3NH4A 3VMHA 2NVQI 4QTTA 3GTQI 1LQLA 2OZKA 5C4JI 3G711 3S14I 3CXCZ 2O53A 1YJN1 1VQN1 5D1PA 2NVTI 2Q4ZA 3CXCY 2EGTA 1VQ71 4NFRA 4RVHA 1QYPA 2JIOA 2F4MA 2KPIA 3CPWY 4A3II 3CCU1 1K9M1 1VQO1 3S2DI 1K8A2 3CMEZ 2O4HA 2V8JA 3CC7Z 3J81f 2AKLA 4NH1C 5T64A 1L1OC 3CCMZ 3NDJA 1VQ9Z 1S721 1KRLA 1WW9A 3CCSZ 1YJWZ 1Q812 1YIT1 5CM2M 2DE6A 2JA8I 2GTIA 2JNYA 2RIQA 4BY7I 3U50C 4A3CI 2E2JI 1ZH1A 3QWUA 1YIJ1 2M6NA 1QVFY 1M902 1QXFA 3S1RI 1WZNA 2B63I 1DL6A 3D6WA 3G6E1 1KC81 1RO2A 2NVXI 2JIPA 2QRDB 2IZ3A 2R7ZI 4DK1A 3CCJZ 3I07A 4MD9A 3I55Z 5C44I 5IP9I 2RHBA 3JAMf 1K732 1YJNZ 4NBCA 2BJOA 1YHQ1 4Y52I 1VQLZ 3MZKB 2VUMI 3CC21 4DQYB 2H85A
chains in the Genus database with same CATH topology
2YU9I 2JA7I 3D9XA 1X3WA 3CCQ1 5FLMI 3I4MI 5IP7I 2W03A 1P9NA 2W04A 1ML8A 2RPRA 1YUAA 1I6HI 4E32A 2OTLZ 5FLXf 3CD6Z 4A3DI 3G4S1 1K9M2 4RVGA 3CCV1 1YITZ 2JMOA 2QLVB 4E2ZA 2NVYI 3J81b 4RVDA 1VLAA 4NOZA 3K7AI 2QR1B 1JJ2Z 2E2II 3RZDI 2QEX1 3GTPI 1I50I 3I561 1JJ2Y 2E2HI 1RNIA 1TWFI 2RT9A 2R92I 3H0GI 4MH4A 4MD7A 3BG1B 3EERA 1TWAI 5AN9F 1KC82 1Z01A 4A93I 3GTGI 2P3YA 3TE5B 2WB1A 3GTJI 3FKII 3J80f 3CC2Z 3S16I 3MONA 3NDIA 3CMA1 3CCQZ 1WCMI 3MZLB 4MONA 4E2XA 3S1QI 3HOUI 3JAMb 1X0TA 1VQ81 3VMGA 4Y7NI 3HOWI 1W2BZ 3GTKI 2VUGA 3GCFA 3S17I 1W2BY 5IT9f 2JUBA 4A3JI 4X6AI 1YJ91 3TDHB 4NBBA 1TWCI 2DE7A 2JS4A 1M1K1 2P28A 4E33A 1YI2Z 1Q821 4CL1A 2ZAEB 4RVFA 2PM9A 3LUSA 2Q51A 3CCL1 1VQK1 2PK7A 3I4NI 2E9HA 3VMIA 5C4XI 3G71Z 1RLYA 2HU9A 2JA5I 3GTMS 1VQNZ 1VQ61 3HOVI 5D1OA 1KD11 1USPA 1VQP1 2R6MA 1VQ7Z 2OTJ1 5C3EI 3CCUZ 1VQ41 1VQOZ 2QKDA 4A3MI 1KQSZ 2QA41 2GU2A 1KQSY 4HGYA 1S72Z 3T4NB 3CC41 2V8KA 3GTOI 2YADA 3J80b 2R93I 3CC71 3CQZI 1NUIA 1TWHI 3GTLI 4NBEA 2M48A 4NBHA 3GKQA 1YIJZ 1YJW1 3H3VJ 2WAQA 2RBLA 1I3QI 3G6EZ 4NBAA 5LL6f 1QVGZ 5IT9b 4RS4A 4S1TA 2LFUA 4A3FI 1N8R1 4A3BI 4NBDA 5T6BA 4DGLA 2V8IA 1M1K2 2JA6I 5D1OB 1USPB 3PO3S 4MXUA 1YHQZ 1VQ51 1VQM1 4A3LI 1NJI1 3HKZA 2K5RA 3GTMI 4NB8A 3CCR1 2OTJZ 1RQFA 4NB9A 3I551 1VQ4Z 4E2WA 1NP6A 2I3CA 3HOYI 3J7A4 5T67A 1N2FA 1KD12 2QA4Z 3S2HI 1ZB8A 1VQL1 5A2Qf 3CPWZ 3M4OI 1Q7Y1 3G4SZ 1SFOI 3CC4Z 4MD8A 1ZB9A 1Y1WI 3CCVZ 3KIHA 4E2YA 2VF1A 3CCE1 3RZOI 2Y0SA 2OTL1 3CD61 4NBGA 4AYBA 3IX0A 5FLXb 4NBFA 2F4OA 2HF1A 1Q861 3HOZI 1RO4A 3ESWA 2GTHA 2K3RA 3S1MI 4BXXI 2QEXZ 3I56Z 1Y1VS 2G2KA 4A3KI 1QVFZ 3F3FC 4HH4A 4BBSI 4XX2A 1PFTA 3KIFA 1RO0A 3FQQA 3IF8A 1TFIA 3OW2Z 3BG0B 1VQ5Z 2OOYB 1VQMZ 2J6AA 3OW2Y 1N8R2 2QREB 3M3YI 3CCRZ 4E31A 3PO3I 3CMAZ 1K8A1 3VB9A 4TNUA 1Z03A 4EWCA 1S7MA 3Q87A 1K83I 1QF8A 3S1NI 4BY1I 1YUKA 3FQMA 1VQ8Z 2LIYA 1NJI2 3HOXI 1TWGI 1Q811 3CME1 2DE5A 3IFUA 2IZ4A 4A3EI 1Z02A 1X3ZA 2KI7B 2PMZA 3CCEZ 3CCM1 1VQ91 3NFZA 4HGZA 3F3PC 1YJ9Z 1Q7Y2 3S15I 3CCS1 5A2Qb 1JWHC 1M901 4E30A 1WIIA 3P5JB 3PO2I 3NH8A 1R9TI 3NH5A 2QRCB 1QVGY 2OOXB 3CCLZ 1VQKZ 1Q862 4QTUA 1Y1VI 4BBRI 2JR6A 4RV9A 1K731 3EEDA 1VQ6Z 3VTNA 1Q822 1YI21 1VQPZ 4MRIA 3CCJ1 4A3GI 3NH4A 3VMHA 2NVQI 4QTTA 3GTQI 1LQLA 2OZKA 5C4JI 3G711 3S14I 3CXCZ 2O53A 1YJN1 1VQN1 5D1PA 2NVTI 2Q4ZA 3CXCY 2EGTA 1VQ71 4NFRA 4RVHA 1QYPA 2F4MA 2KPIA 3CPWY 4A3II 3CCU1 1K9M1 1VQO1 3S2DI 1K8A2 3CMEZ 2O4HA 2V8JA 3CC7Z 3J81f 2AKLA 4NH1C 5T64A 1L1OC 3CCMZ 3NDJA 1VQ9Z 1S721 1KRLA 1WW9A 3CCSZ 1YJWZ 1Q812 1YIT1 5CM2M 2DE6A 2JA8I 2GTIA 2JNYA 2RIQA 4BY7I 3U50C 4A3CI 2E2JI 1ZH1A 3QWUA 1YIJ1 2M6NA 1QVFY 1M902 3S1RI 2B63I 1DL6A 3D6WA 3G6E1 1KC81 1RO2A 2NVXI 2QRDB 2IZ3A 2R7ZI 4DK1A 3CCJZ 3I07A 4MD9A 3I55Z 5C44I 5IP9I 2RHBA 3JAMf 1K732 1YJNZ 4NBCA 2BJOA 1YHQ1 4Y52I 1VQLZ 3MZKB 2VUMI 3CC21 4DQYB 2H85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 A;  2JS4 A;  2YU9 I;  2JA7 I;  1X3W A;  1N2F A;  5FLM I;  3S2H I;  1ZB8 A;  3I4M I;  5IP7 I;  3M4O I;  1ML8 A;  4QTU A;  1Y1V I;  4BBR I;  2JR6 A;  1YUA A;  1SFO I;  1ZB9 A;  1I6H I;  3LUS A;  2PK7 A;  1Y1W I;  3I4N I;  4A3D I;  3VMI A;  3RZO I;  5C4X I;  1RLY A;  2JA5 I;  4A3G I;  3GTM S;  3HOV I;  3VMH A;  2NVQ I;  4QTT A;  1USP A;  4NBG A;  1LQL A;  3GTQ I;  5C4J I;  4NBF A;  2F4O A;  2HF1 A;  3S14 I;  3HOZ I;  5C3E I;  2NVY I;  1RO4 A;  2NVT I;  3ESW A;  1VLA A;  4A3M I;  4NOZ A;  1QYP A;  3S1M I;  2F4M A;  4BXX I;  2KPI A;  3K7A I;  4A3I I;  1Y1V S;  4A3K I;  3S2D I;  2E2I I;  3RZD I;  4BBS I;  3GTP I;  4XX2 A;  1I50 I;  1PFT A;  2E2H I;  2AKL A;  1TWF I;  3GTO I;  1L1O C;  2R93 I;  2R92 I;  3H0G I;  4MH4 A;  1TFI A;  3CQZ I;  1TWH I;  1NUI A;  1WW9 A;  3EER A;  1TWA I;  2J6A A;  3GTL I;  4A93 I;  5CM2 M;  3M3Y I;  2DE6 A;  4NBE A;  3PO3 I;  3GTG I;  4NBH A;  2P3Y A;  3GKQ A;  2JA8 I;  2JNY A;  3VB9 A;  4BY7 I;  3U50 C;  4A3C I;  3Q87 A;  3GTJ I;  3FKI I;  1K83 I;  2E2J I;  3S16 I;  3H3V J;  3S1N I;  4BY1 I;  2RBL A;  1I3Q I;  1WCM I;  4NBA A;  3HOX I;  3S1R I;  3S1Q I;  3HOU I;  1TWG I;  2B63 I;  1DL6 A;  3D6W A;  2DE5 A;  4A3F I;  2NVX I;  4A3E I;  2R7Z I;  4A3B I;  3VMG A;  4Y7N I;  1X3Z A;  4NBD A;  3HOW I;  3GTK I;  2JA6 I;  3GCF A;  3S17 I;  1USP B;  3I07 A;  3PO3 S;  5C44 I;  5IP9 I;  3S15 I;  4A3L I;  2K5R A;  3GTM I;  4A3J I;  4X6A I;  4NB8 A;  4NB9 A;  3PO2 I;  4NBC A;  1R9T I;  2BJO A;  4Y52 I;  2VUM I;  4NBB A;  3HOY I;  1TWC I; 
#chains in the Genus database with same CATH topology
 2YU9 I;  2JA7 I;  3D9X A;  1X3W A;  3CCQ 1;  1AA6 A;  5FLM I;  3I4M I;  5IP7 I;  2W03 A;  1P9N A;  2W04 A;  1ML8 A;  2VPW A;  2RPR A;  1YUA A;  1I6H I;  4E32 A;  2OTL Z;  5FLX f;  3CD6 Z;  4A3D I;  3G4S 1;  1K9M 2;  4RVG A;  3CCV 1;  1YIT Z;  2JMO A;  2QLV B;  4E2Z A;  2NVY I;  3J81 b;  4RVD A;  1VLA A;  4NOZ A;  3K7A I;  2NAP A;  2QR1 B;  1JJ2 Z;  2E2I I;  3RZD I;  1FDO A;  2QEX 1;  3GTP I;  1I50 I;  3I56 1;  1JJ2 Y;  2E2H I;  1FDI A;  1RNI A;  1TWF I;  2RT9 A;  2R92 I;  3H0G I;  4MH4 A;  4MD7 A;  3BG1 B;  3EER A;  1TWA I;  5AN9 F;  1KC8 2;  1Z01 A;  4A93 I;  3GTG I;  2P3Y A;  3TE5 B;  2WB1 A;  3GTJ I;  3FKI I;  3J80 f;  3CC2 Z;  3S16 I;  3MON A;  3NDI A;  3CMA 1;  3CCQ Z;  1WCM I;  3MZL B;  4MON A;  4E2X A;  3S1Q I;  1WJ2 A;  3HOU I;  3JAM b;  1X0T A;  1VQ8 1;  3VMG A;  4Y7N I;  3HOW I;  1W2B Z;  3GTK I;  2VUG A;  3GCF A;  3S17 I;  1W2B Y;  5IT9 f;  2E7Z A;  2JUB A;  4A3J I;  4X6A I;  1YJ9 1;  3TDH B;  4NBB A;  1TWC I;  2DE7 A;  2JS4 A;  1M1K 1;  2P28 A;  4E33 A;  1YI2 Z;  1Q82 1;  4CL1 A;  2ZAE B;  4RVF A;  2PM9 A;  3LUS A;  2Q51 A;  3CCL 1;  1VQK 1;  2PK7 A;  3I4N I;  2E9H A;  3VMI A;  3D2L A;  5C4X I;  3G71 Z;  1RLY A;  2HU9 A;  2JA5 I;  3GTM S;  1VQN Z;  1VQ6 1;  3HOV I;  5D1O A;  1KD1 1;  1USP A;  1VQP 1;  2R6M A;  1VQ7 Z;  2OTJ 1;  5C3E I;  3CCU Z;  1VQ4 1;  1VQO Z;  2QKD A;  2V3V A;  4A3M I;  1KQS Z;  2QA4 1;  2GU2 A;  1KQS Y;  4HGY A;  1S72 Z;  3T4N B;  3CC4 1;  2V8K A;  2IV2 X;  1Q16 A;  3GTO I;  2YAD A;  3J80 b;  2R93 I;  3CC7 1;  3CQZ I;  1NUI A;  1TWH I;  3GTL I;  4NBE A;  2M48 A;  4NBH A;  3GKQ A;  1YIJ Z;  1YJW 1;  3H3V J;  2WAQ A;  2RBL A;  1I3Q I;  3G6E Z;  4NBA A;  5LL6 f;  1QVG Z;  5IT9 b;  4RS4 A;  4S1T A;  2LFU A;  4A3F I;  1N8R 1;  4A3B I;  4NBD A;  5T6B A;  4DGL A;  2V8I A;  1M1K 2;  2JA6 I;  2JIR A;  5D1O B;  2AYD A;  1USP B;  3PO3 S;  4MXU A;  1YHQ Z;  1VQ5 1;  1VQM 1;  4A3L I;  1NJI 1;  3HKZ A;  2K5R A;  3GTM I;  4NB8 A;  3CCR 1;  2OTJ Z;  1RQF A;  4NB9 A;  3I55 1;  1VQ4 Z;  2VPZ A;  4E2W A;  1NP6 A;  2I3C A;  3HOY I;  2V45 A;  3J7A 4;  5T67 A;  1N2F A;  1KD1 2;  2QA4 Z;  3S2H I;  1ZB8 A;  1VQL 1;  5A2Q f;  3CPW Z;  3M4O I;  1Q7Y 1;  3G4S Z;  1SFO I;  3CC4 Z;  4MD8 A;  1ZB9 A;  1Y1W I;  3CCV Z;  3KIH A;  4E2Y A;  2VF1 A;  3CCE 1;  3RZO I;  2Y0S A;  2OTL 1;  3CD6 1;  4NBG A;  4AYB A;  3IX0 A;  5FLX b;  4NBF A;  2F4O A;  2HF1 A;  1Q86 1;  3HOZ I;  1RO4 A;  3ESW A;  2GTH A;  2K3R A;  2JIQ A;  3S1M I;  4BXX I;  2QEX Z;  3I56 Z;  1Y1V S;  2G2K A;  4A3K I;  1QVF Z;  3F3F C;  4HH4 A;  4BBS I;  4XX2 A;  1PFT A;  3IR7 A;  3KIF A;  1RO0 A;  3FQQ A;  3IF8 A;  2LEX A;  1TFI A;  3OW2 Z;  3BG0 B;  1VQ5 Z;  2OOY B;  1VQM Z;  2J6A A;  3OW2 Y;  1N8R 2;  2QRE B;  3M3Y I;  3CCR Z;  4E31 A;  3PO3 I;  3CMA Z;  1K8A 1;  2VPX A;  3VB9 A;  4TNU A;  1Z03 A;  4EWC A;  1S7M A;  3Q87 A;  1K83 I;  1QF8 A;  3S1N I;  4BY1 I;  1YUK A;  3FQM A;  1VQ8 Z;  2LIY A;  1NJI 2;  3HOX I;  1TWG I;  1Q81 1;  3CME 1;  2DE5 A;  3IFU A;  2IZ4 A;  4A3E I;  1Z02 A;  1X3Z A;  2KI7 B;  2PMZ A;  3CCE Z;  3CCM 1;  1VQ9 1;  3NFZ A;  4HGZ A;  1Y8C A;  3F3P C;  1YJ9 Z;  1Q7Y 2;  3S15 I;  3CCS 1;  5A2Q b;  1JWH C;  1M90 1;  4E30 A;  1WII A;  3P5J B;  3PO2 I;  3NH8 A;  1R9T I;  3NH5 A;  2JIM A;  2QRC B;  1QVG Y;  2OOX B;  3CCL Z;  1VQK Z;  1Q86 2;  4QTU A;  1Y1V I;  4BBR I;  2JR6 A;  4RV9 A;  1K73 1;  3EED A;  1SIW A;  1VQ6 Z;  3VTN A;  1Q82 2;  1YI2 1;  2VPY A;  1VQP Z;  4MRI A;  3CCJ 1;  4A3G I;  3NH4 A;  3VMH A;  2NVQ I;  4QTT A;  3GTQ I;  1LQL A;  2OZK A;  5C4J I;  3G71 1;  3S14 I;  3CXC Z;  2O53 A;  1YJN 1;  1VQN 1;  5D1P A;  2NVT I;  2Q4Z A;  3CXC Y;  2EGT A;  1VQ7 1;  4NFR A;  4RVH A;  1QYP A;  2JIO A;  2F4M A;  2KPI A;  3CPW Y;  4A3I I;  3CCU 1;  1K9M 1;  1VQO 1;  3S2D I;  1K8A 2;  3CME Z;  2O4H A;  2V8J A;  3CC7 Z;  3J81 f;  2AKL A;  4NH1 C;  5T64 A;  1L1O C;  3CCM Z;  3NDJ A;  1VQ9 Z;  1S72 1;  1KRL A;  1WW9 A;  3CCS Z;  1YJW Z;  1Q81 2;  1YIT 1;  5CM2 M;  2DE6 A;  2JA8 I;  2GTI A;  2JNY A;  2RIQ A;  4BY7 I;  3U50 C;  4A3C I;  2E2J I;  1ZH1 A;  3QWU A;  1YIJ 1;  2M6N A;  1QVF Y;  1M90 2;  1QXF A;  3S1R I;  1WZN A;  2B63 I;  1DL6 A;  3D6W A;  3G6E 1;  1KC8 1;  1RO2 A;  2NVX I;  2JIP A;  2QRD B;  2IZ3 A;  2R7Z I;  4DK1 A;  3CCJ Z;  3I07 A;  4MD9 A;  3I55 Z;  5C44 I;  5IP9 I;  2RHB A;  3JAM f;  1K73 2;  1YJN Z;  4NBC A;  2BJO A;  1YHQ 1;  4Y52 I;  1VQL Z;  3MZK B;  2VUM I;  3CC2 1;  4DQY B;  2H85 A; 
#chains in the Genus database with same CATH homology
 2YU9 I;  2JA7 I;  3D9X A;  1X3W A;  3CCQ 1;  5FLM I;  3I4M I;  5IP7 I;  2W03 A;  1P9N A;  2W04 A;  1ML8 A;  2RPR A;  1YUA A;  1I6H I;  4E32 A;  2OTL Z;  5FLX f;  3CD6 Z;  4A3D I;  3G4S 1;  1K9M 2;  4RVG A;  3CCV 1;  1YIT Z;  2JMO A;  2QLV B;  4E2Z A;  2NVY I;  3J81 b;  4RVD A;  1VLA A;  4NOZ A;  3K7A I;  2QR1 B;  1JJ2 Z;  2E2I I;  3RZD I;  2QEX 1;  3GTP I;  1I50 I;  3I56 1;  1JJ2 Y;  2E2H I;  1RNI A;  1TWF I;  2RT9 A;  2R92 I;  3H0G I;  4MH4 A;  4MD7 A;  3BG1 B;  3EER A;  1TWA I;  5AN9 F;  1KC8 2;  1Z01 A;  4A93 I;  3GTG I;  2P3Y A;  3TE5 B;  2WB1 A;  3GTJ I;  3FKI I;  3J80 f;  3CC2 Z;  3S16 I;  3MON A;  3NDI A;  3CMA 1;  3CCQ Z;  1WCM I;  3MZL B;  4MON A;  4E2X A;  3S1Q I;  3HOU I;  3JAM b;  1X0T A;  1VQ8 1;  3VMG A;  4Y7N I;  3HOW I;  1W2B Z;  3GTK I;  2VUG A;  3GCF A;  3S17 I;  1W2B Y;  5IT9 f;  2JUB A;  4A3J I;  4X6A I;  1YJ9 1;  3TDH B;  4NBB A;  1TWC I;  2DE7 A;  2JS4 A;  1M1K 1;  2P28 A;  4E33 A;  1YI2 Z;  1Q82 1;  4CL1 A;  2ZAE B;  4RVF A;  2PM9 A;  3LUS A;  2Q51 A;  3CCL 1;  1VQK 1;  2PK7 A;  3I4N I;  2E9H A;  3VMI A;  5C4X I;  3G71 Z;  1RLY A;  2HU9 A;  2JA5 I;  3GTM S;  1VQN Z;  1VQ6 1;  3HOV I;  5D1O A;  1KD1 1;  1USP A;  1VQP 1;  2R6M A;  1VQ7 Z;  2OTJ 1;  5C3E I;  3CCU Z;  1VQ4 1;  1VQO Z;  2QKD A;  4A3M I;  1KQS Z;  2QA4 1;  2GU2 A;  1KQS Y;  4HGY A;  1S72 Z;  3T4N B;  3CC4 1;  2V8K A;  3GTO I;  2YAD A;  3J80 b;  2R93 I;  3CC7 1;  3CQZ I;  1NUI A;  1TWH I;  3GTL I;  4NBE A;  2M48 A;  4NBH A;  3GKQ A;  1YIJ Z;  1YJW 1;  3H3V J;  2WAQ A;  2RBL A;  1I3Q I;  3G6E Z;  4NBA A;  5LL6 f;  1QVG Z;  5IT9 b;  4RS4 A;  4S1T A;  2LFU A;  4A3F I;  1N8R 1;  4A3B I;  4NBD A;  5T6B A;  4DGL A;  2V8I A;  1M1K 2;  2JA6 I;  5D1O B;  1USP B;  3PO3 S;  4MXU A;  1YHQ Z;  1VQ5 1;  1VQM 1;  4A3L I;  1NJI 1;  3HKZ A;  2K5R A;  3GTM I;  4NB8 A;  3CCR 1;  2OTJ Z;  1RQF A;  4NB9 A;  3I55 1;  1VQ4 Z;  4E2W A;  1NP6 A;  2I3C A;  3HOY I;  3J7A 4;  5T67 A;  1N2F A;  1KD1 2;  2QA4 Z;  3S2H I;  1ZB8 A;  1VQL 1;  5A2Q f;  3CPW Z;  3M4O I;  1Q7Y 1;  3G4S Z;  1SFO I;  3CC4 Z;  4MD8 A;  1ZB9 A;  1Y1W I;  3CCV Z;  3KIH A;  4E2Y A;  2VF1 A;  3CCE 1;  3RZO I;  2Y0S A;  2OTL 1;  3CD6 1;  4NBG A;  4AYB A;  3IX0 A;  5FLX b;  4NBF A;  2F4O A;  2HF1 A;  1Q86 1;  3HOZ I;  1RO4 A;  3ESW A;  2GTH A;  2K3R A;  3S1M I;  4BXX I;  2QEX Z;  3I56 Z;  1Y1V S;  2G2K A;  4A3K I;  1QVF Z;  3F3F C;  4HH4 A;  4BBS I;  4XX2 A;  1PFT A;  3KIF A;  1RO0 A;  3FQQ A;  3IF8 A;  1TFI A;  3OW2 Z;  3BG0 B;  1VQ5 Z;  2OOY B;  1VQM Z;  2J6A A;  3OW2 Y;  1N8R 2;  2QRE B;  3M3Y I;  3CCR Z;  4E31 A;  3PO3 I;  3CMA Z;  1K8A 1;  3VB9 A;  4TNU A;  1Z03 A;  4EWC A;  1S7M A;  3Q87 A;  1K83 I;  1QF8 A;  3S1N I;  4BY1 I;  1YUK A;  3FQM A;  1VQ8 Z;  2LIY A;  1NJI 2;  3HOX I;  1TWG I;  1Q81 1;  3CME 1;  2DE5 A;  3IFU A;  2IZ4 A;  4A3E I;  1Z02 A;  1X3Z A;  2KI7 B;  2PMZ A;  3CCE Z;  3CCM 1;  1VQ9 1;  3NFZ A;  4HGZ A;  3F3P C;  1YJ9 Z;  1Q7Y 2;  3S15 I;  3CCS 1;  5A2Q b;  1JWH C;  1M90 1;  4E30 A;  1WII A;  3P5J B;  3PO2 I;  3NH8 A;  1R9T I;  3NH5 A;  2QRC B;  1QVG Y;  2OOX B;  3CCL Z;  1VQK Z;  1Q86 2;  4QTU A;  1Y1V I;  4BBR I;  2JR6 A;  4RV9 A;  1K73 1;  3EED A;  1VQ6 Z;  3VTN A;  1Q82 2;  1YI2 1;  1VQP Z;  4MRI A;  3CCJ 1;  4A3G I;  3NH4 A;  3VMH A;  2NVQ I;  4QTT A;  3GTQ I;  1LQL A;  2OZK A;  5C4J I;  3G71 1;  3S14 I;  3CXC Z;  2O53 A;  1YJN 1;  1VQN 1;  5D1P A;  2NVT I;  2Q4Z A;  3CXC Y;  2EGT A;  1VQ7 1;  4NFR A;  4RVH A;  1QYP A;  2F4M A;  2KPI A;  3CPW Y;  4A3I I;  3CCU 1;  1K9M 1;  1VQO 1;  3S2D I;  1K8A 2;  3CME Z;  2O4H A;  2V8J A;  3CC7 Z;  3J81 f;  2AKL A;  4NH1 C;  5T64 A;  1L1O C;  3CCM Z;  3NDJ A;  1VQ9 Z;  1S72 1;  1KRL A;  1WW9 A;  3CCS Z;  1YJW Z;  1Q81 2;  1YIT 1;  5CM2 M;  2DE6 A;  2JA8 I;  2GTI A;  2JNY A;  2RIQ A;  4BY7 I;  3U50 C;  4A3C I;  2E2J I;  1ZH1 A;  3QWU A;  1YIJ 1;  2M6N A;  1QVF Y;  1M90 2;  3S1R I;  2B63 I;  1DL6 A;  3D6W A;  3G6E 1;  1KC8 1;  1RO2 A;  2NVX I;  2QRD B;  2IZ3 A;  2R7Z I;  4DK1 A;  3CCJ Z;  3I07 A;  4MD9 A;  3I55 Z;  5C44 I;  5IP9 I;  2RHB A;  3JAM f;  1K73 2;  1YJN Z;  4NBC A;  2BJO A;  1YHQ 1;  4Y52 I;  1VQL Z;  3MZK B;  2VUM I;  3CC2 1;  4DQY B;  2H85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...