1RQFA

Structure of ck2 beta subunit crystallized in the presence of a p21waf1 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II beta chain
publication title Structure of the regulatory subunit of CK2 in the presence of a p21WAF1 peptide demonstrates flexibility of the acidic loop.
pubmed doi rcsb
source organism Xenopus laevis
total genus 51
structure length 172
sequence length 172
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2003-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1rqfA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rqfA02
4MD7A 2M6NA 4MD9A 2RT9A 1QF8A 4NH1C 2JMOA 4MD8A 3EEDA 4DGLA 2M48A 2R6MA 1RQFA 1JWHC
chains in the Genus database with same CATH superfamily
4E32A 3J81b 4NBBA 2P28A 2JIRA 2JR6A 3ESWA 3J80b 2J6AA 3I4NI 2NVXI 3HOVI 3CCS1 1AA6A 1Q862 4NH1C 1Q811 4RVFA 4MONA 1YHQZ 1KC82 4CL1A 2HU9A 4A3LI 2JMOA 2RIQA 2GU2A 3CPWY 3CCE1 1YUKA 1QVFZ 5A2Qb 5FLXb 2RHBA 3IR7A 3CCM1 3CCQ1 2QA41 3TE5B 1YI2Z 4AYBA 2OZKA 1W2BZ 2R92I 5IT9b 1X3ZA 4RS4A 2V45A 3RZDI 3I561 1K8A1 3S15I 3S1MI 4A3DI 1N8R2 3CC41 1VQOZ 4DK1A 2R6MA 4MH4A 2DE5A 1L1OC 3G711 4NBEA 1VQ81 3KIHA 2RPRA 2V8IA 2B63I 1WIIA 2RT9A 2VPXA 2E2JI 4Y52I 2V8KA 2IZ3A 3CCSZ 2PK7A 3S2HI 4QTUA 3RZOI 2JA8I 1USPB 2YADA 4MD9A 3CCEZ 2YU9I 3OW2Z 2JA6I 3CCQZ 3CCMZ 2QA4Z 3CC21 3HOXI 2I3CA 2QKDA 2QLVB 2V3VA 2WAQA 3I56Z 2QEX1 1TWFI 4BY1I 1Z03A 2GTIA 4A3BI 1USPA 3FQMA 3GTJI 3CC4Z 1VQN1 4A3GI 4A3KI 1Q16A 3G71Z 1VQ8Z 2VPZA 4E33A 2JUBA 3FKII 2NVYI 3U50C 3K7AI 2NVTI 2E2II 2M6NA 1NJI2 2OTJ1 3CCV1 2F4OA 4DQYB 3CME1 1WW9A 3VB9A 1JJ2Y 1LQLA 3JAMf 2IZ4A 2V8JA 2LIYA 4A3CI 1K731 1Y1VI 3G6E1 1QVGY 1TWAI 4E2XA 2OOXB 3CC2Z 3F3FC 2QR1B 4A93I 1X0TA 3NH4A 2JS4A 2LEXA 1ZH1A 2JNYA 3NFZA 2QEXZ 2JIQA 3GTQI 4HH4A 1ZB8A 1Q821 1ML8A 1Q812 1I6HI 1VQNZ 4BBRI 1Q7Y2 1RO2A 1K83I 1KD11 1M901 2E9HA 3T4NB 5IP9I 1WJ2A 1PFTA 1N2FA 1ZB9A 4NBAA 3CCR1 1VQ91 5C44I 1VLAA 1VQP1 1YJ91 1YJW1 1K8A2 2VUMI 3CQZI 1QVFY 3HKZA 1YUAA 5D1PA 1W2BY 1RO4A 1VQ71 2OTJZ 2Q51A 3CCVZ 3CMEZ 2OTL1 3IFUA 4A3FI 3G4S1 3I551 4MRIA 3GTPI 3G6EZ 1FDOA 3GCFA 1VQ41 1N8R1 3JAMb 1FDIA 4X6AI 2QRDB 5D1OB 1I50I 4A3MI 2K5RA 4TNUA 5CM2M 2JA5I 3CMA1 4BBSI 3PO3I 3VMHA 2W03A 2NAPA 1DL6A 2RBLA 1Y1VS 3CC71 1KRLA 1VQK1 2AKLA 3TDHB 3CCRZ 3S1QI 1K9M2 5D1OA 1RQFA 1VQPZ 1KQSZ 1YJ9Z 1YJWZ 3OW2Y 3HOUI 1S721 1VQ7Z 5T67A 1Y1WI 3HOYI 2DE7A 2P3YA 2OTLZ 3FQQA 1P9NA 3G4SZ 1KQSY 1WZNA 3I55Z 5AN9F 3EERA 3NH5A 1Z02A 2O4HA 4RVHA 1VQ4Z 1RLYA 3CD61 4HGYA 2E2HI 4DGLA 3KIFA 3CCU1 3CXCZ 2DE6A 3D2LA 4RVDA 3GTKI 4RV9A 3I4MI 3P5JB 2VPWA 1VQ51 3CMAZ 2QRCB 4S1TA 1TWHI 3MONA 3F3PC 4RVGA 3CCL1 2AYDA 3CCJ1 2R7ZI 1JWHC 5C3EI 1TWGI 2WB1A 5T6BA 1NJI1 3Q87A 2M48A 1M1K1 3CC7Z 1VQKZ 5FLMI 3NDIA 4NBDA 5C4JI 4QTTA 4BXXI 3VMGA 1YIJ1 2JIPA 4XX2A 2R93I 4E2YA 1VQM1 2VUGA 1S72Z 2Y0SA 2EGTA 3S14I 3VTNA 5IP7I 1Q861 3PO3S 5LL6f 4NB8A 5T64A 2OOYB 3MZLB 4MXUA 1Q822 3EEDA 1KC81 2JA7I 3GKQA 3CPWZ 4BY7I 2HF1A 3M4OI 4NOZA 1KD12 3MZKB 1M902 1VQ61 3CD6Z 3IX0A 1Q7Y1 1QXFA 4NBHA 3CCUZ 3S1RI 4NFRA 3HOZI 2K3RA 1I3QI 1VQL1 1VQ5Z 3S2DI 4Y7NI 3GTMI 4HGZA 3GTOI 3CCLZ 3CCJZ 1YIT1 3I07A 4E30A 1WCMI 2QREB 4A3II 4E2ZA 1RNIA 1Y8CA 2BJOA 4NBGA 2O53A 1Z01A 2Q4ZA 4MD8A 2JIMA 4MD7A 1YIJZ 1X3WA 1VQMZ 2KPIA 1YJN1 2PMZA 3IF8A 3HOWI 2PM9A 3M3YI 3BG1B 2VF1A 3BG0B 4EWCA 4A3JI 2GTHA 2NVQI 1VQ6Z 5C4XI 1VQ9Z 2F4MA 3S1NI 2LFUA 1TWCI 3J81f 3GTLI 3NDJA 3J80f 1VQLZ 4A3EI 1K9M1 1R9TI 1YITZ 3QWUA 3H0GI 3D6WA 3NH8A 4E2WA 3PO2I 2JIOA 3VMIA 4NBCA 4NBFA 3H3VJ 2W04A 1YHQ1 1TFIA 3J7A4 3LUSA 2E7ZA 2KI7B 1QYPA 2VPYA 4E31A 5A2Qf 5FLXf 1YJNZ 5IT9f 1S7MA 1RO0A 3GTGI 3S17I 3CXCY 3D9XA 1YI21 3GTMS 1NUIA 1NP6A 2ZAEB 4NB9A 1JJ2Z 1K732 2IV2X 2G2KA 3S16I 2H85A 1QVGZ 1M1K2 1VQO1 1QF8A 1SIWA 1SFOI
chains in the Genus database with same CATH topology
4E32A 3J81b 4NBBA 2P28A 3ESWA 2JR6A 3J80b 2J6AA 3I4NI 2NVXI 3HOVI 3CCS1 1Q862 4NH1C 1Q811 4RVFA 4MONA 1YHQZ 1KC82 4CL1A 2HU9A 4A3LI 2JMOA 2RIQA 2GU2A 3CPWY 3CCE1 1YUKA 1QVFZ 5A2Qb 5FLXb 2RHBA 3CCQ1 3CCM1 2QA41 1YI2Z 3TE5B 1W2BZ 4AYBA 2OZKA 1K8A1 2R92I 5IT9b 1X3ZA 4RS4A 3RZDI 3I561 3S15I 3S1MI 4A3DI 1N8R2 3CC41 1VQOZ 4DK1A 2R6MA 4MH4A 2DE5A 1L1OC 3G711 4NBEA 1VQ81 3KIHA 2RPRA 2V8IA 2B63I 1WIIA 2RT9A 2E2JI 4Y52I 2V8KA 2IZ3A 3CCSZ 2PK7A 3S2HI 4QTUA 3RZOI 2JA8I 1USPB 2YADA 4MD9A 3CCEZ 2YU9I 3OW2Z 2JA6I 3CCQZ 3CCMZ 2QA4Z 3CC21 3HOXI 2I3CA 2QKDA 2QLVB 2WAQA 3I56Z 2QEX1 1TWFI 4BY1I 1Z03A 2GTIA 4A3BI 1USPA 3FQMA 3GTJI 3CC4Z 1VQN1 4A3GI 4A3KI 3G71Z 1VQ8Z 4E33A 2JUBA 3FKII 2NVYI 3U50C 3K7AI 2NVTI 2E2II 2M6NA 1NJI2 2OTJ1 3CCV1 2F4OA 4DQYB 3CME1 1WW9A 3VB9A 1JJ2Y 1LQLA 3JAMf 2IZ4A 2V8JA 2LIYA 4A3CI 1K731 1Y1VI 3G6E1 1QVGY 1TWAI 4E2XA 2OOXB 3CC2Z 3F3FC 2QR1B 4A93I 1X0TA 3NH4A 2JS4A 1ZH1A 2JNYA 3NFZA 2QEXZ 3GTQI 4HH4A 1ZB8A 1Q821 1ML8A 1Q812 1I6HI 1VQNZ 4BBRI 1Q7Y2 1RO2A 1K83I 1KD11 1M901 2E9HA 3T4NB 5IP9I 1PFTA 1N2FA 1ZB9A 4NBAA 3CCR1 1VQ91 5C44I 1VLAA 1VQP1 1YJ91 1YJW1 1K8A2 2VUMI 3CQZI 1QVFY 3HKZA 1YUAA 5D1PA 1W2BY 1RO4A 1VQ71 2OTJZ 2Q51A 3CCVZ 3CMEZ 2OTL1 3IFUA 4A3FI 3G4S1 3I551 4MRIA 3GTPI 3G6EZ 3GCFA 1VQ41 1N8R1 3JAMb 4X6AI 2QRDB 5D1OB 1I50I 4A3MI 2K5RA 4TNUA 5CM2M 2JA5I 3CMA1 4BBSI 3PO3I 3VMHA 2W03A 1DL6A 2RBLA 1Y1VS 3CC71 1KRLA 1VQK1 2AKLA 3TDHB 3CCRZ 3S1QI 1K9M2 5D1OA 1RQFA 1VQPZ 1KQSZ 1YJ9Z 1YJWZ 3OW2Y 3HOUI 1S721 1VQ7Z 5T67A 1Y1WI 3HOYI 2DE7A 2P3YA 2OTLZ 3FQQA 1P9NA 3G4SZ 1KQSY 3I55Z 5AN9F 3EERA 3NH5A 1Z02A 2O4HA 4RVHA 1VQ4Z 1RLYA 3CD61 4HGYA 2E2HI 4DGLA 3KIFA 3CCU1 3CXCZ 2DE6A 4RVDA 3GTKI 4RV9A 3I4MI 3P5JB 1VQ51 3CMAZ 2QRCB 4S1TA 1TWHI 3MONA 3F3PC 4RVGA 3CCL1 3CCJ1 2R7ZI 1JWHC 5C3EI 1TWGI 2WB1A 5T6BA 1NJI1 3Q87A 2M48A 1M1K1 3CC7Z 1VQKZ 5FLMI 3NDIA 4NBDA 5C4JI 4QTTA 4BXXI 3VMGA 1YIJ1 4XX2A 2R93I 4E2YA 1VQM1 2VUGA 1S72Z 2Y0SA 2EGTA 3S14I 3VTNA 5IP7I 1Q861 3PO3S 5LL6f 4NB8A 5T64A 2OOYB 3MZLB 4MXUA 1Q822 3EEDA 1KC81 2JA7I 3GKQA 3CPWZ 4BY7I 2HF1A 3M4OI 4NOZA 1KD12 3MZKB 1M902 1VQ61 3CD6Z 3IX0A 1Q7Y1 4NBHA 3CCUZ 3S1RI 4NFRA 3HOZI 2K3RA 1I3QI 1VQL1 1VQ5Z 3S2DI 4Y7NI 3GTMI 4HGZA 3GTOI 3CCLZ 3CCJZ 1YIT1 3I07A 4E30A 1WCMI 2QREB 4A3II 4E2ZA 1RNIA 2BJOA 4NBGA 2O53A 1Z01A 2Q4ZA 4MD8A 4MD7A 1YIJZ 1X3WA 1VQMZ 2KPIA 1YJN1 2PMZA 3IF8A 3HOWI 2PM9A 3M3YI 3BG1B 2VF1A 3BG0B 4EWCA 4A3JI 2GTHA 2NVQI 1VQ6Z 5C4XI 1VQ9Z 2F4MA 3S1NI 2LFUA 1TWCI 3J81f 3GTLI 3NDJA 3J80f 1VQLZ 4A3EI 1K9M1 1R9TI 1YITZ 3QWUA 3H0GI 3D6WA 3NH8A 4E2WA 3PO2I 3VMIA 4NBCA 4NBFA 3H3VJ 2W04A 1YHQ1 1TFIA 3J7A4 3LUSA 2KI7B 1QYPA 4E31A 5A2Qf 5FLXf 1YJNZ 5IT9f 1S7MA 1RO0A 3GTGI 3S17I 3CXCY 3D9XA 1YI21 3GTMS 1NUIA 1NP6A 2ZAEB 4NB9A 1JJ2Z 1K732 2G2KA 3S16I 2H85A 1QVGZ 1M1K2 1VQO1 1QF8A 1SFOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD7 A;  2M6N A;  4MD9 A;  2RT9 A;  1QF8 A;  4NH1 C;  2JMO A;  4MD8 A;  3EED A;  4DGL A;  2M48 A;  2R6M A;  1RQF A;  1JWH C; 
#chains in the Genus database with same CATH topology
 4E32 A;  3J81 b;  4NBB A;  2P28 A;  2JIR A;  2JR6 A;  3ESW A;  3J80 b;  2J6A A;  3I4N I;  2NVX I;  3HOV I;  3CCS 1;  1AA6 A;  1Q86 2;  4NH1 C;  1Q81 1;  4RVF A;  4MON A;  1YHQ Z;  1KC8 2;  4CL1 A;  2HU9 A;  4A3L I;  2JMO A;  2RIQ A;  2GU2 A;  3CPW Y;  3CCE 1;  1YUK A;  1QVF Z;  5A2Q b;  5FLX b;  2RHB A;  3IR7 A;  3CCM 1;  3CCQ 1;  2QA4 1;  3TE5 B;  1YI2 Z;  4AYB A;  2OZK A;  1W2B Z;  2R92 I;  5IT9 b;  1X3Z A;  4RS4 A;  2V45 A;  3RZD I;  3I56 1;  1K8A 1;  3S15 I;  3S1M I;  4A3D I;  1N8R 2;  3CC4 1;  1VQO Z;  4DK1 A;  2R6M A;  4MH4 A;  2DE5 A;  1L1O C;  3G71 1;  4NBE A;  1VQ8 1;  3KIH A;  2RPR A;  2V8I A;  2B63 I;  1WII A;  2RT9 A;  2VPX A;  2E2J I;  4Y52 I;  2V8K A;  2IZ3 A;  3CCS Z;  2PK7 A;  3S2H I;  4QTU A;  3RZO I;  2JA8 I;  1USP B;  2YAD A;  4MD9 A;  3CCE Z;  2YU9 I;  3OW2 Z;  2JA6 I;  3CCQ Z;  3CCM Z;  2QA4 Z;  3CC2 1;  3HOX I;  2I3C A;  2QKD A;  2QLV B;  2V3V A;  2WAQ A;  3I56 Z;  2QEX 1;  1TWF I;  4BY1 I;  1Z03 A;  2GTI A;  4A3B I;  1USP A;  3FQM A;  3GTJ I;  3CC4 Z;  1VQN 1;  4A3G I;  4A3K I;  1Q16 A;  3G71 Z;  1VQ8 Z;  2VPZ A;  4E33 A;  2JUB A;  3FKI I;  2NVY I;  3U50 C;  3K7A I;  2NVT I;  2E2I I;  2M6N A;  1NJI 2;  2OTJ 1;  3CCV 1;  2F4O A;  4DQY B;  3CME 1;  1WW9 A;  3VB9 A;  1JJ2 Y;  1LQL A;  3JAM f;  2IZ4 A;  2V8J A;  2LIY A;  4A3C I;  1K73 1;  1Y1V I;  3G6E 1;  1QVG Y;  1TWA I;  4E2X A;  2OOX B;  3CC2 Z;  3F3F C;  2QR1 B;  4A93 I;  1X0T A;  3NH4 A;  2JS4 A;  2LEX A;  1ZH1 A;  2JNY A;  3NFZ A;  2QEX Z;  2JIQ A;  3GTQ I;  4HH4 A;  1ZB8 A;  1Q82 1;  1ML8 A;  1Q81 2;  1I6H I;  1VQN Z;  4BBR I;  1Q7Y 2;  1RO2 A;  1K83 I;  1KD1 1;  1M90 1;  2E9H A;  3T4N B;  5IP9 I;  1WJ2 A;  1PFT A;  1N2F A;  1ZB9 A;  4NBA A;  3CCR 1;  1VQ9 1;  5C44 I;  1VLA A;  1VQP 1;  1YJ9 1;  1YJW 1;  1K8A 2;  2VUM I;  3CQZ I;  1QVF Y;  3HKZ A;  1YUA A;  5D1P A;  1W2B Y;  1RO4 A;  1VQ7 1;  2OTJ Z;  2Q51 A;  3CCV Z;  3CME Z;  2OTL 1;  3IFU A;  4A3F I;  3G4S 1;  3I55 1;  4MRI A;  3GTP I;  3G6E Z;  1FDO A;  3GCF A;  1VQ4 1;  1N8R 1;  3JAM b;  1FDI A;  4X6A I;  2QRD B;  5D1O B;  1I50 I;  4A3M I;  2K5R A;  4TNU A;  5CM2 M;  2JA5 I;  3CMA 1;  4BBS I;  3PO3 I;  3VMH A;  2W03 A;  2NAP A;  1DL6 A;  2RBL A;  1Y1V S;  3CC7 1;  1KRL A;  1VQK 1;  2AKL A;  3TDH B;  3CCR Z;  3S1Q I;  1K9M 2;  5D1O A;  1RQF A;  1VQP Z;  1KQS Z;  1YJ9 Z;  1YJW Z;  3OW2 Y;  3HOU I;  1S72 1;  1VQ7 Z;  5T67 A;  1Y1W I;  3HOY I;  2DE7 A;  2P3Y A;  2OTL Z;  3FQQ A;  1P9N A;  3G4S Z;  1KQS Y;  1WZN A;  3I55 Z;  5AN9 F;  3EER A;  3NH5 A;  1Z02 A;  2O4H A;  4RVH A;  1VQ4 Z;  1RLY A;  3CD6 1;  4HGY A;  2E2H I;  4DGL A;  3KIF A;  3CCU 1;  3CXC Z;  2DE6 A;  3D2L A;  4RVD A;  3GTK I;  4RV9 A;  3I4M I;  3P5J B;  2VPW A;  1VQ5 1;  3CMA Z;  2QRC B;  4S1T A;  1TWH I;  3MON A;  3F3P C;  4RVG A;  3CCL 1;  2AYD A;  3CCJ 1;  2R7Z I;  1JWH C;  5C3E I;  1TWG I;  2WB1 A;  5T6B A;  1NJI 1;  3Q87 A;  2M48 A;  1M1K 1;  3CC7 Z;  1VQK Z;  5FLM I;  3NDI A;  4NBD A;  5C4J I;  4QTT A;  4BXX I;  3VMG A;  1YIJ 1;  2JIP A;  4XX2 A;  2R93 I;  4E2Y A;  1VQM 1;  2VUG A;  1S72 Z;  2Y0S A;  2EGT A;  3S14 I;  3VTN A;  5IP7 I;  1Q86 1;  3PO3 S;  5LL6 f;  4NB8 A;  5T64 A;  2OOY B;  3MZL B;  4MXU A;  1Q82 2;  3EED A;  1KC8 1;  2JA7 I;  3GKQ A;  3CPW Z;  4BY7 I;  2HF1 A;  3M4O I;  4NOZ A;  1KD1 2;  3MZK B;  1M90 2;  1VQ6 1;  3CD6 Z;  3IX0 A;  1Q7Y 1;  1QXF A;  4NBH A;  3CCU Z;  3S1R I;  4NFR A;  3HOZ I;  2K3R A;  1I3Q I;  1VQL 1;  1VQ5 Z;  3S2D I;  4Y7N I;  3GTM I;  4HGZ A;  3GTO I;  3CCL Z;  3CCJ Z;  1YIT 1;  3I07 A;  4E30 A;  1WCM I;  2QRE B;  4A3I I;  4E2Z A;  1RNI A;  1Y8C A;  2BJO A;  4NBG A;  2O53 A;  1Z01 A;  2Q4Z A;  4MD8 A;  2JIM A;  4MD7 A;  1YIJ Z;  1X3W A;  1VQM Z;  2KPI A;  1YJN 1;  2PMZ A;  3IF8 A;  3HOW I;  2PM9 A;  3M3Y I;  3BG1 B;  2VF1 A;  3BG0 B;  4EWC A;  4A3J I;  2GTH A;  2NVQ I;  1VQ6 Z;  5C4X I;  1VQ9 Z;  2F4M A;  3S1N I;  2LFU A;  1TWC I;  3J81 f;  3GTL I;  3NDJ A;  3J80 f;  1VQL Z;  4A3E I;  1K9M 1;  1R9T I;  1YIT Z;  3QWU A;  3H0G I;  3D6W A;  3NH8 A;  4E2W A;  3PO2 I;  2JIO A;  3VMI A;  4NBC A;  4NBF A;  3H3V J;  2W04 A;  1YHQ 1;  1TFI A;  3J7A 4;  3LUS A;  2E7Z A;  2KI7 B;  1QYP A;  2VPY A;  4E31 A;  5A2Q f;  5FLX f;  1YJN Z;  5IT9 f;  1S7M A;  1RO0 A;  3GTG I;  3S17 I;  3CXC Y;  3D9X A;  1YI2 1;  3GTM S;  1NUI A;  1NP6 A;  2ZAE B;  4NB9 A;  1JJ2 Z;  1K73 2;  2IV2 X;  2G2K A;  3S16 I;  2H85 A;  1QVG Z;  1M1K 2;  1VQO 1;  1QF8 A;  1SIW A;  1SFO I; 
#chains in the Genus database with same CATH homology
 4E32 A;  3J81 b;  4NBB A;  2P28 A;  3ESW A;  2JR6 A;  3J80 b;  2J6A A;  3I4N I;  2NVX I;  3HOV I;  3CCS 1;  1Q86 2;  4NH1 C;  1Q81 1;  4RVF A;  4MON A;  1YHQ Z;  1KC8 2;  4CL1 A;  2HU9 A;  4A3L I;  2JMO A;  2RIQ A;  2GU2 A;  3CPW Y;  3CCE 1;  1YUK A;  1QVF Z;  5A2Q b;  5FLX b;  2RHB A;  3CCQ 1;  3CCM 1;  2QA4 1;  1YI2 Z;  3TE5 B;  1W2B Z;  4AYB A;  2OZK A;  1K8A 1;  2R92 I;  5IT9 b;  1X3Z A;  4RS4 A;  3RZD I;  3I56 1;  3S15 I;  3S1M I;  4A3D I;  1N8R 2;  3CC4 1;  1VQO Z;  4DK1 A;  2R6M A;  4MH4 A;  2DE5 A;  1L1O C;  3G71 1;  4NBE A;  1VQ8 1;  3KIH A;  2RPR A;  2V8I A;  2B63 I;  1WII A;  2RT9 A;  2E2J I;  4Y52 I;  2V8K A;  2IZ3 A;  3CCS Z;  2PK7 A;  3S2H I;  4QTU A;  3RZO I;  2JA8 I;  1USP B;  2YAD A;  4MD9 A;  3CCE Z;  2YU9 I;  3OW2 Z;  2JA6 I;  3CCQ Z;  3CCM Z;  2QA4 Z;  3CC2 1;  3HOX I;  2I3C A;  2QKD A;  2QLV B;  2WAQ A;  3I56 Z;  2QEX 1;  1TWF I;  4BY1 I;  1Z03 A;  2GTI A;  4A3B I;  1USP A;  3FQM A;  3GTJ I;  3CC4 Z;  1VQN 1;  4A3G I;  4A3K I;  3G71 Z;  1VQ8 Z;  4E33 A;  2JUB A;  3FKI I;  2NVY I;  3U50 C;  3K7A I;  2NVT I;  2E2I I;  2M6N A;  1NJI 2;  2OTJ 1;  3CCV 1;  2F4O A;  4DQY B;  3CME 1;  1WW9 A;  3VB9 A;  1JJ2 Y;  1LQL A;  3JAM f;  2IZ4 A;  2V8J A;  2LIY A;  4A3C I;  1K73 1;  1Y1V I;  3G6E 1;  1QVG Y;  1TWA I;  4E2X A;  2OOX B;  3CC2 Z;  3F3F C;  2QR1 B;  4A93 I;  1X0T A;  3NH4 A;  2JS4 A;  1ZH1 A;  2JNY A;  3NFZ A;  2QEX Z;  3GTQ I;  4HH4 A;  1ZB8 A;  1Q82 1;  1ML8 A;  1Q81 2;  1I6H I;  1VQN Z;  4BBR I;  1Q7Y 2;  1RO2 A;  1K83 I;  1KD1 1;  1M90 1;  2E9H A;  3T4N B;  5IP9 I;  1PFT A;  1N2F A;  1ZB9 A;  4NBA A;  3CCR 1;  1VQ9 1;  5C44 I;  1VLA A;  1VQP 1;  1YJ9 1;  1YJW 1;  1K8A 2;  2VUM I;  3CQZ I;  1QVF Y;  3HKZ A;  1YUA A;  5D1P A;  1W2B Y;  1RO4 A;  1VQ7 1;  2OTJ Z;  2Q51 A;  3CCV Z;  3CME Z;  2OTL 1;  3IFU A;  4A3F I;  3G4S 1;  3I55 1;  4MRI A;  3GTP I;  3G6E Z;  3GCF A;  1VQ4 1;  1N8R 1;  3JAM b;  4X6A I;  2QRD B;  5D1O B;  1I50 I;  4A3M I;  2K5R A;  4TNU A;  5CM2 M;  2JA5 I;  3CMA 1;  4BBS I;  3PO3 I;  3VMH A;  2W03 A;  1DL6 A;  2RBL A;  1Y1V S;  3CC7 1;  1KRL A;  1VQK 1;  2AKL A;  3TDH B;  3CCR Z;  3S1Q I;  1K9M 2;  5D1O A;  1RQF A;  1VQP Z;  1KQS Z;  1YJ9 Z;  1YJW Z;  3OW2 Y;  3HOU I;  1S72 1;  1VQ7 Z;  5T67 A;  1Y1W I;  3HOY I;  2DE7 A;  2P3Y A;  2OTL Z;  3FQQ A;  1P9N A;  3G4S Z;  1KQS Y;  3I55 Z;  5AN9 F;  3EER A;  3NH5 A;  1Z02 A;  2O4H A;  4RVH A;  1VQ4 Z;  1RLY A;  3CD6 1;  4HGY A;  2E2H I;  4DGL A;  3KIF A;  3CCU 1;  3CXC Z;  2DE6 A;  4RVD A;  3GTK I;  4RV9 A;  3I4M I;  3P5J B;  1VQ5 1;  3CMA Z;  2QRC B;  4S1T A;  1TWH I;  3MON A;  3F3P C;  4RVG A;  3CCL 1;  3CCJ 1;  2R7Z I;  1JWH C;  5C3E I;  1TWG I;  2WB1 A;  5T6B A;  1NJI 1;  3Q87 A;  2M48 A;  1M1K 1;  3CC7 Z;  1VQK Z;  5FLM I;  3NDI A;  4NBD A;  5C4J I;  4QTT A;  4BXX I;  3VMG A;  1YIJ 1;  4XX2 A;  2R93 I;  4E2Y A;  1VQM 1;  2VUG A;  1S72 Z;  2Y0S A;  2EGT A;  3S14 I;  3VTN A;  5IP7 I;  1Q86 1;  3PO3 S;  5LL6 f;  4NB8 A;  5T64 A;  2OOY B;  3MZL B;  4MXU A;  1Q82 2;  3EED A;  1KC8 1;  2JA7 I;  3GKQ A;  3CPW Z;  4BY7 I;  2HF1 A;  3M4O I;  4NOZ A;  1KD1 2;  3MZK B;  1M90 2;  1VQ6 1;  3CD6 Z;  3IX0 A;  1Q7Y 1;  4NBH A;  3CCU Z;  3S1R I;  4NFR A;  3HOZ I;  2K3R A;  1I3Q I;  1VQL 1;  1VQ5 Z;  3S2D I;  4Y7N I;  3GTM I;  4HGZ A;  3GTO I;  3CCL Z;  3CCJ Z;  1YIT 1;  3I07 A;  4E30 A;  1WCM I;  2QRE B;  4A3I I;  4E2Z A;  1RNI A;  2BJO A;  4NBG A;  2O53 A;  1Z01 A;  2Q4Z A;  4MD8 A;  4MD7 A;  1YIJ Z;  1X3W A;  1VQM Z;  2KPI A;  1YJN 1;  2PMZ A;  3IF8 A;  3HOW I;  2PM9 A;  3M3Y I;  3BG1 B;  2VF1 A;  3BG0 B;  4EWC A;  4A3J I;  2GTH A;  2NVQ I;  1VQ6 Z;  5C4X I;  1VQ9 Z;  2F4M A;  3S1N I;  2LFU A;  1TWC I;  3J81 f;  3GTL I;  3NDJ A;  3J80 f;  1VQL Z;  4A3E I;  1K9M 1;  1R9T I;  1YIT Z;  3QWU A;  3H0G I;  3D6W A;  3NH8 A;  4E2W A;  3PO2 I;  3VMI A;  4NBC A;  4NBF A;  3H3V J;  2W04 A;  1YHQ 1;  1TFI A;  3J7A 4;  3LUS A;  2KI7 B;  1QYP A;  4E31 A;  5A2Q f;  5FLX f;  1YJN Z;  5IT9 f;  1S7M A;  1RO0 A;  3GTG I;  3S17 I;  3CXC Y;  3D9X A;  1YI2 1;  3GTM S;  1NUI A;  1NP6 A;  2ZAE B;  4NB9 A;  1JJ2 Z;  1K73 2;  2G2K A;  3S16 I;  2H85 A;  1QVG Z;  1M1K 2;  1VQO 1;  1QF8 A;  1SFO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...