1RQFA

Structure of ck2 beta subunit crystallized in the presence of a p21waf1 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the regulatory subunit of CK2 in the presence of a p21WAF1 peptide demonstrates flexibility of the acidic loop.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
molecule keywords Casein kinase II beta chain
total genus 51
structure length 172
sequence length 172
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2003-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1rqfA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rqfA02
4MD9A 1QF8A 4NH1C 1JWHC 4MD8A 1RQFA 2M48A 4MD7A 3EEDA 2JMOA 2RT9A 4DGLA 2R6MA 2M6NA
chains in the Genus database with same CATH superfamily
2JIMA 2QKDA 1Q16A 3CCJ1 1AA6A 1KRLA 1YI2Z 3I561 2RBLA 1FDOA 2KPIA 5FLXf 5AN9F 4NBCA 1YJW1 2AYDA 5CM2M 2VPZA 1Q811 1I6HI 1JJ2Z 1PFTA 1TWAI 1M901 5IP7I 1KQSZ 4NBFA 1RQFA 4TNUA 1Z02A 3NH8A 2WB1A 4Y7NI 1ZB8A 2VF1A 2QA4Z 2VPYA 2HU9A 2RPRA 1YI21 1WJ2A 1USPB 2LIYA 1Q7Y1 1YIJZ 3S1QI 4RS4A 3K7AI 1W2BZ 3F3FC 3HOUI 3JAMb 1QYPA 1YJNZ 3GTLI 1RLYA 2PMZA 3FQMA 3G711 4E2WA 4DGLA 1Q862 2E2JI 4HGZA 1K9M1 5D1OB 2NVYI 2JUBA 5C4XI 1KQSY 4A3JI 2GTHA 2QRCB 4BY1I 2M6NA 5D1OA 5T67A 3GTQI 3NDJA 3VMGA 4MRIA 3CMEZ 1QVGY 3NFZA 3NDIA 3S1RI 1Q812 3TE5B 1K8A2 1YJ9Z 4BXXI 1Z01A 3RZOI 2YU9I 3PO3I 1QVFZ 3MZLB 2JA7I 1YIT1 1VQ5Z 2RT9A 3VMIA 1NJI1 4RVHA 2K3RA 3ESWA 3F3PC 3J81b 1SFOI 2E9HA 3GTMS 4NB8A 4A3CI 3I07A 4X6AI 1YUAA 1TWHI 3FQQA 4DQYB 4NFRA 3PO3S 1VQMZ 2M48A 3CCU1 3GKQA 1Q822 2O53A 3RZDI 4MONA 1VQM1 2QRDB 1N8R1 4E2XA 1YJN1 1VQP1 1VQNZ 4CL1A 1VLAA 1KD12 3S17I 1ML8A 3D9XA 4E33A 4HGYA 4BY7I 2IV2X 3HOWI 2JIQA 3IR7A 4QTTA 2RHBA 1VQL1 1M1K1 4MD7A 1X3ZA 2NAPA 3IX0A 2V3VA 3I4NI 2P3YA 1USPA 2PM9A 2JIRA 2JR6A 4RVFA 3S14I 3CCE1 3CCQZ 3J81f 3KIFA 3D2LA 2QLVB 4RVGA 1VQOZ 3CXCY 3G6EZ 2F4OA 2V8KA 2R93I 1X0TA 1M902 3I551 2OOXB 2E2HI 5D1PA 4MD9A 4NBBA 1TWGI 1WW9A 4A3LI 3GCFA 4A93I 3NH4A 1ZB9A 1TWFI 2W03A 2P28A 1S72Z 3JAMf 4Y52I 1KC82 4E2ZA 3S2DI 4A3BI 2J6AA 2JA5I 1K732 4XX2A 4RV9A 1Y1VS 3S1MI 4A3EI 2OTJZ 4S1TA 4MH4A 4A3II 4MXUA 3CCSZ 3OW2Z 1KD11 1VQO1 1QVFY 2QEX1 2DE5A 1RO4A 1Z03A 2Q4ZA 3KIHA 3S15I 1FDIA 1YIJ1 1M1K2 2VUGA 4A3DI 2BJOA 1VQ91 1VQ81 1S7MA 2NVQI 3G4SZ 1JJ2Y 1JWHC 1VQKZ 5C4JI 4E2YA 3P5JB 2EGTA 3EERA 1VQ6Z 1SIWA 4BBRI 1WCMI 3J80f 4A3MI 5IT9b 2VPXA 3CD61 1TFIA 2E7ZA 5IP9I 2RIQA 1K8A1 2VPWA 5A2Qf 1NP6A 2QREB 3TDHB 2K5RA 2V8IA 1QF8A 3CD6Z 1LQLA 1X3WA 2QR1B 1VQ8Z 1VQ9Z 4DK1A 2R7ZI 2W04A 1VQ61 3CME1 3GTPI 2JNYA 2LEXA 1NJI2 2LFUA 2YADA 3BG1B 3CQZI 3MONA 5C3EI 1K731 3HOVI 3CXCZ 1VQLZ 2R92I 4A3FI 5C44I 3J7A4 3S1NI 2B63I 2QEXZ 2H85A 1I50I 3I55Z 1RNIA 3CCRZ 3IFUA 1VQK1 3CMA1 4NBHA 5A2Qb 2NVTI 2OTJ1 2IZ4A 3CCV1 3H3VJ 4QTUA 3GTMI 3CCMZ 3U50C 1Y8CA 3HOXI 4HH4A 1VQ71 3CCM1 3Q87A 3IF8A 3VMHA 3HOZI 3CCVZ 4MD8A 3GTOI 1YUKA 3MZKB 2F4MA 4NOZA 2DE7A 2DE6A 3CC4Z 3PO2I 1VQ4Z 1N2FA 3FKII 1K9M2 2JA6I 2OTL1 3GTJI 2JIOA 2R6MA 2OTLZ 1VQ41 1VQPZ 1VQN1 2VUMI 4BBSI 1NUIA 2WAQA 1QVGZ 1R9TI 1RO0A 3OW2Y 3G6E1 1K83I 1YJWZ 1S721 2GTIA 3S2HI 1L1OC 3I56Z 1RO2A 2HF1A 1I3QI 4E31A 4NBGA 3LUSA 3CCJZ 2OOYB 2Q51A 1W2BY 3GTKI 2NVXI 1QXFA 3CC71 4E30A 5FLXb 1KC81 3J80b 3CC21 3CPWZ 3VB9A 5FLMI 2JIPA 2QA41 1YHQ1 3GTGI 3T4NB 2I3CA 4AYBA 1WZNA 4NBDA 4E32A 3M4OI 2Y0SA 5T64A 1DL6A 3VTNA 1ZH1A 2V8JA 2IZ3A 1YHQZ 3QWUA 3M3YI 3CC2Z 3G4S1 4A3KI 3H0GI 4NH1C 1Y1WI 1VQ7Z 3NH5A 3CCLZ 3HKZA 2G2KA 1Q7Y2 3CCL1 3HOYI 1TWCI 3CPWY 3CCS1 2PK7A 3CMAZ 5IT9f 2JS4A 3CCR1 5LL6f 1Q821 4A3GI 3CCUZ 1Q861 3EEDA 2KI7B 2JMOA 1WIIA 1Y1VI 1N8R2 2E2II 4EWCA 3BG0B 2AKLA 3CC41 4NB9A 3CCEZ 3CCQ1 1YJ91 2O4HA 4NBEA 5T6BA 2V45A 4NBAA 2GU2A 2OZKA 1P9NA 2JA8I 3D6WA 3S16I 3G71Z 4RVDA 3CC7Z 1VQ51 1YITZ 2ZAEB 3I4MI
chains in the Genus database with same CATH topology
2QKDA 3CCJ1 1KRLA 1YI2Z 3I561 2RBLA 5FLXf 2KPIA 5AN9F 4NBCA 1YJW1 5CM2M 1Q811 1I6HI 1JJ2Z 1PFTA 1TWAI 1M901 5IP7I 1KQSZ 4NBFA 1RQFA 4TNUA 1Z02A 3NH8A 2WB1A 4Y7NI 1ZB8A 2VF1A 2QA4Z 2HU9A 2RPRA 1YI21 1USPB 2LIYA 1Q7Y1 1YIJZ 3S1QI 4RS4A 3K7AI 1W2BZ 3F3FC 3HOUI 3JAMb 1QYPA 1YJNZ 3GTLI 1RLYA 2PMZA 3FQMA 3G711 4E2WA 4DGLA 1Q862 2E2JI 4HGZA 1K9M1 5D1OB 2NVYI 2JUBA 5C4XI 1KQSY 4A3JI 2GTHA 2QRCB 4BY1I 2M6NA 5D1OA 5T67A 3GTQI 3NDJA 3VMGA 4MRIA 3CMEZ 1QVGY 3NFZA 3NDIA 3S1RI 1Q812 3TE5B 1K8A2 1YJ9Z 4BXXI 1Z01A 3RZOI 2YU9I 3PO3I 1QVFZ 3MZLB 2JA7I 1YIT1 1VQ5Z 2RT9A 3VMIA 1NJI1 4RVHA 2K3RA 3ESWA 3F3PC 3J81b 1SFOI 2E9HA 3GTMS 4NB8A 4A3CI 3I07A 4X6AI 1YUAA 1TWHI 3FQQA 4DQYB 4NFRA 3PO3S 1VQMZ 2M48A 3CCU1 3GKQA 1Q822 2O53A 3RZDI 4MONA 1VQM1 2QRDB 1N8R1 4E2XA 1YJN1 1VQP1 1VQNZ 4CL1A 1VLAA 1KD12 3S17I 1ML8A 3D9XA 4E33A 4HGYA 4BY7I 3HOWI 1VQL1 4QTTA 2RHBA 1M1K1 4MD7A 1X3ZA 3IX0A 3I4NI 2P3YA 1USPA 2PM9A 2JR6A 4RVFA 3S14I 3CCE1 3CCQZ 3J81f 3KIFA 2QLVB 4RVGA 1VQOZ 3CXCY 3G6EZ 2F4OA 2V8KA 2R93I 1X0TA 1M902 3I551 2OOXB 2E2HI 5D1PA 4MD9A 4NBBA 1TWGI 1WW9A 4A3LI 3GCFA 4A93I 3NH4A 1ZB9A 1TWFI 2W03A 2P28A 1S72Z 3JAMf 4Y52I 1KC82 4E2ZA 3S2DI 4A3BI 2J6AA 2JA5I 1K732 4XX2A 4RV9A 1Y1VS 3S1MI 4A3EI 2OTJZ 4S1TA 4MH4A 4A3II 4MXUA 3CCSZ 3OW2Z 1KD11 1VQO1 1QVFY 2QEX1 2DE5A 1RO4A 1Z03A 2Q4ZA 3KIHA 3S15I 1YIJ1 1M1K2 2VUGA 4A3DI 2BJOA 1VQ91 1VQ81 1S7MA 2NVQI 3G4SZ 1JJ2Y 1JWHC 1VQKZ 5C4JI 4E2YA 3P5JB 2EGTA 3EERA 1VQ6Z 4BBRI 1WCMI 3J80f 4A3MI 5IT9b 3CD61 1TFIA 5IP9I 2RIQA 1K8A1 5A2Qf 1NP6A 2QREB 3TDHB 2K5RA 2V8IA 1QF8A 3CD6Z 1LQLA 1X3WA 2QR1B 1VQ8Z 1VQ9Z 4DK1A 2R7ZI 2W04A 1VQ61 3CME1 3GTPI 2JNYA 1NJI2 2LFUA 2YADA 3BG1B 3CQZI 3MONA 5C3EI 1K731 3HOVI 3CXCZ 1VQLZ 2R92I 4A3FI 5C44I 3J7A4 3S1NI 2B63I 2QEXZ 2H85A 1I50I 3I55Z 1RNIA 3CCRZ 3IFUA 1VQK1 3CMA1 4NBHA 5A2Qb 2NVTI 2OTJ1 2IZ4A 3CCV1 3H3VJ 4QTUA 3GTMI 3CCMZ 3U50C 3HOXI 4HH4A 1VQ71 3CCM1 3Q87A 3IF8A 3VMHA 3HOZI 3CCVZ 4MD8A 3GTOI 1YUKA 3MZKB 2F4MA 4NOZA 2DE7A 2DE6A 3CC4Z 3PO2I 1VQ4Z 1N2FA 3FKII 1K9M2 2JA6I 2OTL1 3GTJI 2R6MA 2OTLZ 1VQ41 1VQPZ 1VQN1 2VUMI 4BBSI 1NUIA 2WAQA 1QVGZ 1R9TI 1RO0A 3OW2Y 3G6E1 1K83I 1YJWZ 1S721 2GTIA 3S2HI 1L1OC 3I56Z 1RO2A 2HF1A 1I3QI 4E31A 4NBGA 3LUSA 3CCJZ 2OOYB 2Q51A 1W2BY 3GTKI 2NVXI 3CC71 4E30A 5FLXb 1KC81 3J80b 3CC21 3CPWZ 3VB9A 5FLMI 2QA41 1YHQ1 3GTGI 3T4NB 2I3CA 4AYBA 4NBDA 4E32A 3M4OI 2Y0SA 5T64A 1DL6A 3VTNA 1ZH1A 2V8JA 2IZ3A 1YHQZ 3QWUA 3M3YI 3CC2Z 3G4S1 4A3KI 3H0GI 4NH1C 1Y1WI 1VQ7Z 3NH5A 3CCLZ 3HKZA 2G2KA 1Q7Y2 3CCL1 3HOYI 1TWCI 3CPWY 3CCS1 2PK7A 3CMAZ 5IT9f 2JS4A 3CCR1 5LL6f 1Q821 4A3GI 3CCUZ 1Q861 3EEDA 2KI7B 2JMOA 1WIIA 1Y1VI 1N8R2 2E2II 4EWCA 3BG0B 2AKLA 3CC41 4NB9A 3CCEZ 3CCQ1 1YJ91 2O4HA 4NBEA 5T6BA 4NBAA 2GU2A 2OZKA 1P9NA 2JA8I 3D6WA 3S16I 3G71Z 4RVDA 3CC7Z 1VQ51 1YITZ 2ZAEB 3I4MI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD9 A;  1QF8 A;  4NH1 C;  1JWH C;  4MD8 A;  1RQF A;  2M48 A;  4MD7 A;  3EED A;  2JMO A;  2RT9 A;  4DGL A;  2R6M A;  2M6N A; 
#chains in the Genus database with same CATH topology
 2JIM A;  2QKD A;  1Q16 A;  3CCJ 1;  1AA6 A;  1KRL A;  1YI2 Z;  3I56 1;  2RBL A;  1FDO A;  2KPI A;  5FLX f;  5AN9 F;  4NBC A;  1YJW 1;  2AYD A;  5CM2 M;  2VPZ A;  1Q81 1;  1I6H I;  1JJ2 Z;  1PFT A;  1TWA I;  1M90 1;  5IP7 I;  1KQS Z;  4NBF A;  1RQF A;  4TNU A;  1Z02 A;  3NH8 A;  2WB1 A;  4Y7N I;  1ZB8 A;  2VF1 A;  2QA4 Z;  2VPY A;  2HU9 A;  2RPR A;  1YI2 1;  1WJ2 A;  1USP B;  2LIY A;  1Q7Y 1;  1YIJ Z;  3S1Q I;  4RS4 A;  3K7A I;  1W2B Z;  3F3F C;  3HOU I;  3JAM b;  1QYP A;  1YJN Z;  3GTL I;  1RLY A;  2PMZ A;  3FQM A;  3G71 1;  4E2W A;  4DGL A;  1Q86 2;  2E2J I;  4HGZ A;  1K9M 1;  5D1O B;  2NVY I;  2JUB A;  5C4X I;  1KQS Y;  4A3J I;  2GTH A;  2QRC B;  4BY1 I;  2M6N A;  5D1O A;  5T67 A;  3GTQ I;  3NDJ A;  3VMG A;  4MRI A;  3CME Z;  1QVG Y;  3NFZ A;  3NDI A;  3S1R I;  1Q81 2;  3TE5 B;  1K8A 2;  1YJ9 Z;  4BXX I;  1Z01 A;  3RZO I;  2YU9 I;  3PO3 I;  1QVF Z;  3MZL B;  2JA7 I;  1YIT 1;  1VQ5 Z;  2RT9 A;  3VMI A;  1NJI 1;  4RVH A;  2K3R A;  3ESW A;  3F3P C;  3J81 b;  1SFO I;  2E9H A;  3GTM S;  4NB8 A;  4A3C I;  3I07 A;  4X6A I;  1YUA A;  1TWH I;  3FQQ A;  4DQY B;  4NFR A;  3PO3 S;  1VQM Z;  2M48 A;  3CCU 1;  3GKQ A;  1Q82 2;  2O53 A;  3RZD I;  4MON A;  1VQM 1;  2QRD B;  1N8R 1;  4E2X A;  1YJN 1;  1VQP 1;  1VQN Z;  4CL1 A;  1VLA A;  1KD1 2;  3S17 I;  1ML8 A;  3D9X A;  4E33 A;  4HGY A;  4BY7 I;  2IV2 X;  3HOW I;  2JIQ A;  3IR7 A;  4QTT A;  2RHB A;  1VQL 1;  1M1K 1;  4MD7 A;  1X3Z A;  2NAP A;  3IX0 A;  2V3V A;  3I4N I;  2P3Y A;  1USP A;  2PM9 A;  2JIR A;  2JR6 A;  4RVF A;  3S14 I;  3CCE 1;  3CCQ Z;  3J81 f;  3KIF A;  3D2L A;  2QLV B;  4RVG A;  1VQO Z;  3CXC Y;  3G6E Z;  2F4O A;  2V8K A;  2R93 I;  1X0T A;  1M90 2;  3I55 1;  2OOX B;  2E2H I;  5D1P A;  4MD9 A;  4NBB A;  1TWG I;  1WW9 A;  4A3L I;  3GCF A;  4A93 I;  3NH4 A;  1ZB9 A;  1TWF I;  2W03 A;  2P28 A;  1S72 Z;  3JAM f;  4Y52 I;  1KC8 2;  4E2Z A;  3S2D I;  4A3B I;  2J6A A;  2JA5 I;  1K73 2;  4XX2 A;  4RV9 A;  1Y1V S;  3S1M I;  4A3E I;  2OTJ Z;  4S1T A;  4MH4 A;  4A3I I;  4MXU A;  3CCS Z;  3OW2 Z;  1KD1 1;  1VQO 1;  1QVF Y;  2QEX 1;  2DE5 A;  1RO4 A;  1Z03 A;  2Q4Z A;  3KIH A;  3S15 I;  1FDI A;  1YIJ 1;  1M1K 2;  2VUG A;  4A3D I;  2BJO A;  1VQ9 1;  1VQ8 1;  1S7M A;  2NVQ I;  3G4S Z;  1JJ2 Y;  1JWH C;  1VQK Z;  5C4J I;  4E2Y A;  3P5J B;  2EGT A;  3EER A;  1VQ6 Z;  1SIW A;  4BBR I;  1WCM I;  3J80 f;  4A3M I;  5IT9 b;  2VPX A;  3CD6 1;  1TFI A;  2E7Z A;  5IP9 I;  2RIQ A;  1K8A 1;  2VPW A;  5A2Q f;  1NP6 A;  2QRE B;  3TDH B;  2K5R A;  2V8I A;  1QF8 A;  3CD6 Z;  1LQL A;  1X3W A;  2QR1 B;  1VQ8 Z;  1VQ9 Z;  4DK1 A;  2R7Z I;  2W04 A;  1VQ6 1;  3CME 1;  3GTP I;  2JNY A;  2LEX A;  1NJI 2;  2LFU A;  2YAD A;  3BG1 B;  3CQZ I;  3MON A;  5C3E I;  1K73 1;  3HOV I;  3CXC Z;  1VQL Z;  2R92 I;  4A3F I;  5C44 I;  3J7A 4;  3S1N I;  2B63 I;  2QEX Z;  2H85 A;  1I50 I;  3I55 Z;  1RNI A;  3CCR Z;  3IFU A;  1VQK 1;  3CMA 1;  4NBH A;  5A2Q b;  2NVT I;  2OTJ 1;  2IZ4 A;  3CCV 1;  3H3V J;  4QTU A;  3GTM I;  3CCM Z;  3U50 C;  1Y8C A;  3HOX I;  4HH4 A;  1VQ7 1;  3CCM 1;  3Q87 A;  3IF8 A;  3VMH A;  3HOZ I;  3CCV Z;  4MD8 A;  3GTO I;  1YUK A;  3MZK B;  2F4M A;  4NOZ A;  2DE7 A;  2DE6 A;  3CC4 Z;  3PO2 I;  1VQ4 Z;  1N2F A;  3FKI I;  1K9M 2;  2JA6 I;  2OTL 1;  3GTJ I;  2JIO A;  2R6M A;  2OTL Z;  1VQ4 1;  1VQP Z;  1VQN 1;  2VUM I;  4BBS I;  1NUI A;  2WAQ A;  1QVG Z;  1R9T I;  1RO0 A;  3OW2 Y;  3G6E 1;  1K83 I;  1YJW Z;  1S72 1;  2GTI A;  3S2H I;  1L1O C;  3I56 Z;  1RO2 A;  2HF1 A;  1I3Q I;  4E31 A;  4NBG A;  3LUS A;  3CCJ Z;  2OOY B;  2Q51 A;  1W2B Y;  3GTK I;  2NVX I;  1QXF A;  3CC7 1;  4E30 A;  5FLX b;  1KC8 1;  3J80 b;  3CC2 1;  3CPW Z;  3VB9 A;  5FLM I;  2JIP A;  2QA4 1;  1YHQ 1;  3GTG I;  3T4N B;  2I3C A;  4AYB A;  1WZN A;  4NBD A;  4E32 A;  3M4O I;  2Y0S A;  5T64 A;  1DL6 A;  3VTN A;  1ZH1 A;  2V8J A;  2IZ3 A;  1YHQ Z;  3QWU A;  3M3Y I;  3CC2 Z;  3G4S 1;  4A3K I;  3H0G I;  4NH1 C;  1Y1W I;  1VQ7 Z;  3NH5 A;  3CCL Z;  3HKZ A;  2G2K A;  1Q7Y 2;  3CCL 1;  3HOY I;  1TWC I;  3CPW Y;  3CCS 1;  2PK7 A;  3CMA Z;  5IT9 f;  2JS4 A;  3CCR 1;  5LL6 f;  1Q82 1;  4A3G I;  3CCU Z;  1Q86 1;  3EED A;  2KI7 B;  2JMO A;  1WII A;  1Y1V I;  1N8R 2;  2E2I I;  4EWC A;  3BG0 B;  2AKL A;  3CC4 1;  4NB9 A;  3CCE Z;  3CCQ 1;  1YJ9 1;  2O4H A;  4NBE A;  5T6B A;  2V45 A;  4NBA A;  2GU2 A;  2OZK A;  1P9N A;  2JA8 I;  3D6W A;  3S16 I;  3G71 Z;  4RVD A;  3CC7 Z;  1VQ5 1;  1YIT Z;  2ZAE B;  3I4M I; 
#chains in the Genus database with same CATH homology
 2QKD A;  3CCJ 1;  1KRL A;  1YI2 Z;  3I56 1;  2RBL A;  5FLX f;  2KPI A;  5AN9 F;  4NBC A;  1YJW 1;  5CM2 M;  1Q81 1;  1I6H I;  1JJ2 Z;  1PFT A;  1TWA I;  1M90 1;  5IP7 I;  1KQS Z;  4NBF A;  1RQF A;  4TNU A;  1Z02 A;  3NH8 A;  2WB1 A;  4Y7N I;  1ZB8 A;  2VF1 A;  2QA4 Z;  2HU9 A;  2RPR A;  1YI2 1;  1USP B;  2LIY A;  1Q7Y 1;  1YIJ Z;  3S1Q I;  4RS4 A;  3K7A I;  1W2B Z;  3F3F C;  3HOU I;  3JAM b;  1QYP A;  1YJN Z;  3GTL I;  1RLY A;  2PMZ A;  3FQM A;  3G71 1;  4E2W A;  4DGL A;  1Q86 2;  2E2J I;  4HGZ A;  1K9M 1;  5D1O B;  2NVY I;  2JUB A;  5C4X I;  1KQS Y;  4A3J I;  2GTH A;  2QRC B;  4BY1 I;  2M6N A;  5D1O A;  5T67 A;  3GTQ I;  3NDJ A;  3VMG A;  4MRI A;  3CME Z;  1QVG Y;  3NFZ A;  3NDI A;  3S1R I;  1Q81 2;  3TE5 B;  1K8A 2;  1YJ9 Z;  4BXX I;  1Z01 A;  3RZO I;  2YU9 I;  3PO3 I;  1QVF Z;  3MZL B;  2JA7 I;  1YIT 1;  1VQ5 Z;  2RT9 A;  3VMI A;  1NJI 1;  4RVH A;  2K3R A;  3ESW A;  3F3P C;  3J81 b;  1SFO I;  2E9H A;  3GTM S;  4NB8 A;  4A3C I;  3I07 A;  4X6A I;  1YUA A;  1TWH I;  3FQQ A;  4DQY B;  4NFR A;  3PO3 S;  1VQM Z;  2M48 A;  3CCU 1;  3GKQ A;  1Q82 2;  2O53 A;  3RZD I;  4MON A;  1VQM 1;  2QRD B;  1N8R 1;  4E2X A;  1YJN 1;  1VQP 1;  1VQN Z;  4CL1 A;  1VLA A;  1KD1 2;  3S17 I;  1ML8 A;  3D9X A;  4E33 A;  4HGY A;  4BY7 I;  3HOW I;  1VQL 1;  4QTT A;  2RHB A;  1M1K 1;  4MD7 A;  1X3Z A;  3IX0 A;  3I4N I;  2P3Y A;  1USP A;  2PM9 A;  2JR6 A;  4RVF A;  3S14 I;  3CCE 1;  3CCQ Z;  3J81 f;  3KIF A;  2QLV B;  4RVG A;  1VQO Z;  3CXC Y;  3G6E Z;  2F4O A;  2V8K A;  2R93 I;  1X0T A;  1M90 2;  3I55 1;  2OOX B;  2E2H I;  5D1P A;  4MD9 A;  4NBB A;  1TWG I;  1WW9 A;  4A3L I;  3GCF A;  4A93 I;  3NH4 A;  1ZB9 A;  1TWF I;  2W03 A;  2P28 A;  1S72 Z;  3JAM f;  4Y52 I;  1KC8 2;  4E2Z A;  3S2D I;  4A3B I;  2J6A A;  2JA5 I;  1K73 2;  4XX2 A;  4RV9 A;  1Y1V S;  3S1M I;  4A3E I;  2OTJ Z;  4S1T A;  4MH4 A;  4A3I I;  4MXU A;  3CCS Z;  3OW2 Z;  1KD1 1;  1VQO 1;  1QVF Y;  2QEX 1;  2DE5 A;  1RO4 A;  1Z03 A;  2Q4Z A;  3KIH A;  3S15 I;  1YIJ 1;  1M1K 2;  2VUG A;  4A3D I;  2BJO A;  1VQ9 1;  1VQ8 1;  1S7M A;  2NVQ I;  3G4S Z;  1JJ2 Y;  1JWH C;  1VQK Z;  5C4J I;  4E2Y A;  3P5J B;  2EGT A;  3EER A;  1VQ6 Z;  4BBR I;  1WCM I;  3J80 f;  4A3M I;  5IT9 b;  3CD6 1;  1TFI A;  5IP9 I;  2RIQ A;  1K8A 1;  5A2Q f;  1NP6 A;  2QRE B;  3TDH B;  2K5R A;  2V8I A;  1QF8 A;  3CD6 Z;  1LQL A;  1X3W A;  2QR1 B;  1VQ8 Z;  1VQ9 Z;  4DK1 A;  2R7Z I;  2W04 A;  1VQ6 1;  3CME 1;  3GTP I;  2JNY A;  1NJI 2;  2LFU A;  2YAD A;  3BG1 B;  3CQZ I;  3MON A;  5C3E I;  1K73 1;  3HOV I;  3CXC Z;  1VQL Z;  2R92 I;  4A3F I;  5C44 I;  3J7A 4;  3S1N I;  2B63 I;  2QEX Z;  2H85 A;  1I50 I;  3I55 Z;  1RNI A;  3CCR Z;  3IFU A;  1VQK 1;  3CMA 1;  4NBH A;  5A2Q b;  2NVT I;  2OTJ 1;  2IZ4 A;  3CCV 1;  3H3V J;  4QTU A;  3GTM I;  3CCM Z;  3U50 C;  3HOX I;  4HH4 A;  1VQ7 1;  3CCM 1;  3Q87 A;  3IF8 A;  3VMH A;  3HOZ I;  3CCV Z;  4MD8 A;  3GTO I;  1YUK A;  3MZK B;  2F4M A;  4NOZ A;  2DE7 A;  2DE6 A;  3CC4 Z;  3PO2 I;  1VQ4 Z;  1N2F A;  3FKI I;  1K9M 2;  2JA6 I;  2OTL 1;  3GTJ I;  2R6M A;  2OTL Z;  1VQ4 1;  1VQP Z;  1VQN 1;  2VUM I;  4BBS I;  1NUI A;  2WAQ A;  1QVG Z;  1R9T I;  1RO0 A;  3OW2 Y;  3G6E 1;  1K83 I;  1YJW Z;  1S72 1;  2GTI A;  3S2H I;  1L1O C;  3I56 Z;  1RO2 A;  2HF1 A;  1I3Q I;  4E31 A;  4NBG A;  3LUS A;  3CCJ Z;  2OOY B;  2Q51 A;  1W2B Y;  3GTK I;  2NVX I;  3CC7 1;  4E30 A;  5FLX b;  1KC8 1;  3J80 b;  3CC2 1;  3CPW Z;  3VB9 A;  5FLM I;  2QA4 1;  1YHQ 1;  3GTG I;  3T4N B;  2I3C A;  4AYB A;  4NBD A;  4E32 A;  3M4O I;  2Y0S A;  5T64 A;  1DL6 A;  3VTN A;  1ZH1 A;  2V8J A;  2IZ3 A;  1YHQ Z;  3QWU A;  3M3Y I;  3CC2 Z;  3G4S 1;  4A3K I;  3H0G I;  4NH1 C;  1Y1W I;  1VQ7 Z;  3NH5 A;  3CCL Z;  3HKZ A;  2G2K A;  1Q7Y 2;  3CCL 1;  3HOY I;  1TWC I;  3CPW Y;  3CCS 1;  2PK7 A;  3CMA Z;  5IT9 f;  2JS4 A;  3CCR 1;  5LL6 f;  1Q82 1;  4A3G I;  3CCU Z;  1Q86 1;  3EED A;  2KI7 B;  2JMO A;  1WII A;  1Y1V I;  1N8R 2;  2E2I I;  4EWC A;  3BG0 B;  2AKL A;  3CC4 1;  4NB9 A;  3CCE Z;  3CCQ 1;  1YJ9 1;  2O4H A;  4NBE A;  5T6B A;  4NBA A;  2GU2 A;  2OZK A;  1P9N A;  2JA8 I;  3D6W A;  3S16 I;  3G71 Z;  4RVD A;  3CC7 Z;  1VQ5 1;  1YIT Z;  2ZAE B;  3I4M I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...