4BY1I

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I02
2F4MA 2DE5A 3ESWA 3GTGI 3GTOI 3GTQI 1TWGI 1TWAI 2JR6A 4NBHA 1I6HI 1Y1VS 4BY7I 3GTJI 3I07A 3H0GI 1N2FA 3I4MI 3U50C 3HOYI 1X3ZA 2RBLA 3D6WA 5C4JI 3S16I 1ZB8A 3VMHA 3M3YI 4A3II 2K5RA 1QYPA 1NUIA 4A3JI 5C3EI 1USPA 1L1OC 3RZDI 1LQLA 2E2JI 3S17I 2P3YA 4BBSI 4BY1I 1SFOI 4MH4A 3GTMI 5FLMI 3HOZI 2DE7A 1PFTA 3K7AI 1Y1WI 2NVTI 4BBRI 2BJOA 2NVYI 3PO3I 1TWFI 2NVQI 4NBFA 2F4OA 3I4NI 2R93I 1X3WA 3GCFA 1TFIA 3GTMS 4NOZA 4QTUA 1I3QI 1ML8A 3FKII 5IP9I 4A3CI 4XX2A 4A3FI 2YU9I 5C4XI 2KPIA 3CQZI 4NBDA 3PO3S 3S14I 4NBBA 2JA7I 3GTLI 2R7ZI 4A3EI 1RLYA 2JA6I 5CM2M 1WCMI 1WW9A 4BXXI 1K83I 1TWHI 3S2HI 4X6AI 4NBGA 1VLAA 1RO4A 5C44I 1YUAA 3Q87A 3HOWI 1R9TI 1TWCI 3HOXI 4NB8A 2JA8I 3PO2I 2AKLA 4A3BI 4A3KI 2NVXI 2J6AA 4A93I 4Y52I 3M4OI 3S1RI 2JNYA 3H3VJ 3S15I 3VMIA 4NB9A 4NBEA 3S1QI 4QTTA 3S1MI 4A3MI 4Y7NI 3RZOI 3GTKI 2E2II 3GTPI 3HOUI 2PK7A 2JS4A 4A3DI 3S1NI 2R92I 2VUMI 4A3LI 3VB9A 2HF1A 1USPB 2DE6A 2E2HI 1Y1VI 1DL6A 4NBCA 3GKQA 3EERA 2JA5I 4NBAA 1I50I 1ZB9A 3VMGA 5IP7I 3LUSA 3HOVI 2B63I 4A3GI 3S2DI
chains in the Genus database with same CATH superfamily
1YJNZ 3I561 3CD61 3GTOI 2RHBA 3CCQ1 3CCL1 3CC21 1VQ6Z 1YJW1 1VQO1 1M1K2 1JJ2Y 1M902 1ZB8A 1VQ9Z 2V8JA 1VQN1 2K5RA 1VQMZ 1NUIA 5C3EI 3T4NB 1M1K1 4NFRA 3RZDI 3S17I 2V3VA 4HH4A 1M901 2IV2X 2DE7A 4HGZA 2JMOA 3K7AI 2NVTI 2E7ZA 1Z02A 4E2XA 4NBFA 4MXUA 2R93I 5IT9f 3CCU1 2OTLZ 5D1PA 1VQL1 3OW2Z 2GU2A 3TE5B 4A3FI 1Q822 3I56Z 4E33A 2KPIA 1QF8A 1Y8CA 1YJWZ 1Z01A 4A3EI 4E30A 3JAMf 3D2LA 2QR1B 2AYDA 1W2BY 1Q821 3J7A4 1WW9A 1K83I 3CXCY 3CPWY 4X6AI 1YI2Z 2QA4Z 5C44I 4NB8A 2JA8I 3CCSZ 3S1RI 1YJ91 1K732 4RS4A 2QEXZ 4S1TA 1YITZ 1K731 4MD8A 4Y7NI 3GTKI 3GTPI 4A3DI 1VQLZ 2JS4A 2K3RA 1Q862 5LL6f 5FLXb 3S1NI 2R92I 1KQSY 3CMA1 1YJN1 1Q861 3MZKB 2DE6A 1VQ61 3EERA 3D9XA 4NBAA 1ZB9A 1Q812 3VMGA 1Z03A 3J80b 2RT9A 3LUSA 1VQPZ 1VQ91 4A3GI 2Q4ZA 2F4MA 1YHQ1 4RVDA 4DK1A 1KD12 1TWGI 2WAQA 1I6HI 4BY7I 3GTJI 2VUGA 3I07A 3CCR1 3H0GI 3NH8A 3CC41 1QVGZ 1KD11 4HGYA 5C4JI 1RO2A 3IX0A 2GTIA 3VMHA 2I3CA 1QYPA 4A3JI 4BY1I 4MH4A 2OTL1 2JIQA 3F3FC 3CMAZ 2OTJZ 3QWUA 2BJOA 2NVYI 3PO3I 1TWFI 2JIPA 1YUKA 3I4NI 5A2Qf 1VQ7Z 1ZH1A 1SIWA 2KI7B 1I3QI 1YI21 5IP9I 4A3CI 2QA41 1YHQZ 2YU9I 3J81f 3PO3S 2WB1A 3NH4A 2JA6I 3HKZA 3CCRZ 3CCS1 3CC4Z 1VQKZ 1NJI2 2IZ4A 3G6E1 1YIJ1 2QEX1 2O4HA 1VLAA 2YADA 3BG0B 4CL1A 3OW2Y 1YIT1 1R9TI 3TDHB 3HOXI 4A3BI 1NJI1 4A93I 4A3KI 2NVXI 3KIHA 3NH5A 4E31A 3M4OI 2JNYA 3H3VJ 1WIIA 1VQ4Z 2O53A 4NB9A 4E2ZA 5T64A 5T67A 4AYBA 4A3MI 2E2II 3HOUI 2PK7A 3G4SZ 2QREB 2NAPA 1VQP1 3CCEZ 4RVHA 2E2HI 2VPXA 1Y1VI 2V45A 3GKQA 3G6EZ 1YIJZ 1Q16A 2B63I 3ESWA 3GTGI 4NBHA 1Y1VS 1QXFA 2V8IA 3EEDA 3F3PC 1N2FA 5T6BA 3HOYI 2RBLA 2OTJ1 3D6WA 1S72Z 3M3YI 1QVFZ 1USPA 5IT9b 1L1OC 4BBSI 1LQLA 2E2JI 3G711 3MZLB 4E32A 1VQ71 2JUBA 1WZNA 3CCJZ 1PFTA 1Y1WI 1KRLA 2OOYB 3NDJA 3MONA 1AA6A 2IZ3A 1Q811 1RO0A 2M48A 1QVGY 2NVQI 3JAMb 2F4OA 1X3WA 1Q7Y2 3GCFA 3CCVZ 1TFIA 2PMZA 2QKDA 1VQK1 2V8KA 4E2WA 3NFZA 1ML8A 5C4XI 1Q7Y1 3CQZI 1X0TA 4NBDA 3S14I 2QRCB 2JA7I 5AN9F 2R7ZI 1RLYA 4E2YA 1P9NA 3FQQA 1WCMI 4BXXI 1TWHI 4MRIA 1VQ41 2RIQA 2GTHA 4RVGA 4NBGA 1RQFA 1RO4A 1YUAA 3Q87A 1TWCI 3G71Z 2W04A 2JIOA 2R6MA 2J6AA 3G4S1 2OOXB 3FQMA 1VQ81 4RVFA 4RV9A 1FDIA 3CCE1 2ZAEB 1VQ5Z 1FDOA 4NH1C 3S1MI 3RZOI 2VUMI 2HF1A 3P5JB 1WJ2A 1USPB 3I551 3CME1 4EWCA 1K9M2 1DL6A 1RNIA 4NBCA 1JJ2Z 2JA5I 4DQYB 1I50I 4DGLA 3KIFA 3CC71 1K8A2 5IP7I 2H85A 1K9M1 3S2DI 1S721 5FLXf 2DE5A 4MONA 3GTQI 1TWAI 2JR6A 2VPWA 1K8A1 1VQ8Z 3CCJ1 3I4MI 3U50C 1X3ZA 1N8R2 2E9HA 3S16I 3J80f 3NDIA 5D1OA 2VPZA 2JIRA 4A3II 3CD6Z 2LFUA 5A2Qb 2LIYA 3CCQZ 2P3YA 1N8R1 3CCLZ 1SFOI 3CC2Z 2OZKA 3CCM1 1VQOZ 3GTMI 5FLMI 3CCV1 3HOZI 3IFUA 2EGTA 4BBRI 3J81b 4TNUA 4MD9A 3I55Z 3CMEZ 1VQNZ 1W2BZ 3CXCZ 3CPWZ 1JWHC 2QRDB 1QVFY 2P28A 3CC7Z 3GTMS 4NOZA 4QTUA 2PM9A 3FKII 2VPYA 4XX2A 4NBBA 3GTLI 5CM2M 2Y0SA 3IR7A 3CCUZ 1S7MA 4MD7A 3S2HI 1NP6A 2W03A 1VQ51 3HOWI 3CCMZ 3PO2I 2AKLA 1KQSZ 4Y52I 3S15I 3VMIA 4NBEA 2HU9A 3S1QI 3IF8A 4QTTA 1VQM1 2G2KA 3VTNA 2Q51A 2JIMA 1YJ9Z 4A3LI 5D1OB 3VB9A 1KC82 2RPRA 2QLVB 2LEXA 2M6NA 1KC81 3HOVI 2VF1A 3BG1B
chains in the Genus database with same CATH topology
1YJNZ 3I561 3CD61 3GTOI 2RHBA 3CCQ1 3CCL1 3CC21 1VQ6Z 1YJW1 1VQO1 1M1K2 1JJ2Y 1M902 1ZB8A 1VQ9Z 2V8JA 1VQN1 2K5RA 1VQMZ 1NUIA 5C3EI 3T4NB 1M1K1 4NFRA 3RZDI 3S17I 4HH4A 1M901 2DE7A 4HGZA 2JMOA 3K7AI 2NVTI 1Z02A 4E2XA 4NBFA 4MXUA 2R93I 5IT9f 3CCU1 2OTLZ 5D1PA 1VQL1 3OW2Z 2GU2A 3TE5B 4A3FI 1Q822 3I56Z 4E33A 2KPIA 1QF8A 1YJWZ 1Z01A 4A3EI 4E30A 3JAMf 2QR1B 1W2BY 1Q821 3J7A4 1WW9A 1K83I 3CXCY 3CPWY 4X6AI 1YI2Z 2QA4Z 5C44I 4NB8A 2JA8I 3CCSZ 3S1RI 1YJ91 1K732 4RS4A 2QEXZ 4S1TA 1YITZ 1K731 4MD8A 4Y7NI 3GTKI 3GTPI 4A3DI 1VQLZ 2JS4A 2K3RA 1Q862 5LL6f 5FLXb 3S1NI 2R92I 1KQSY 3CMA1 1YJN1 1Q861 3MZKB 2DE6A 1VQ61 3EERA 3D9XA 4NBAA 1ZB9A 1Q812 3VMGA 1Z03A 3J80b 2RT9A 3LUSA 1VQPZ 1VQ91 4A3GI 2Q4ZA 2F4MA 1YHQ1 4RVDA 4DK1A 1KD12 1TWGI 2WAQA 1I6HI 4BY7I 3GTJI 2VUGA 3I07A 3CCR1 3H0GI 3NH8A 3CC41 1QVGZ 1KD11 4HGYA 5C4JI 1RO2A 3IX0A 2GTIA 3VMHA 2I3CA 1QYPA 4A3JI 4BY1I 4MH4A 2OTL1 3F3FC 3CMAZ 2OTJZ 3QWUA 2BJOA 2NVYI 3PO3I 1TWFI 1YUKA 3I4NI 5A2Qf 1VQ7Z 1ZH1A 2KI7B 1I3QI 1YI21 5IP9I 4A3CI 2QA41 1YHQZ 2YU9I 3J81f 3PO3S 2WB1A 3NH4A 2JA6I 3HKZA 3CCRZ 3CCS1 3CC4Z 1VQKZ 1NJI2 2IZ4A 3G6E1 1YIJ1 2QEX1 2O4HA 1VLAA 2YADA 3BG0B 4CL1A 3OW2Y 1YIT1 1R9TI 3TDHB 3HOXI 4A3BI 1NJI1 4A93I 4A3KI 2NVXI 3KIHA 3NH5A 4E31A 3M4OI 2JNYA 3H3VJ 1WIIA 1VQ4Z 2O53A 4NB9A 4E2ZA 5T64A 5T67A 4AYBA 4A3MI 2E2II 3HOUI 2PK7A 3G4SZ 2QREB 1VQP1 3CCEZ 4RVHA 2E2HI 1Y1VI 3GKQA 3G6EZ 1YIJZ 2B63I 3ESWA 3GTGI 4NBHA 1Y1VS 2V8IA 3EEDA 3F3PC 1N2FA 5T6BA 3HOYI 2RBLA 2OTJ1 3D6WA 1S72Z 3M3YI 1QVFZ 1USPA 5IT9b 1L1OC 4BBSI 1LQLA 2E2JI 3G711 3MZLB 4E32A 1VQ71 2JUBA 3CCJZ 1PFTA 1Y1WI 1KRLA 2OOYB 3NDJA 3MONA 2IZ3A 1Q811 1RO0A 2M48A 1QVGY 2NVQI 3JAMb 2F4OA 1X3WA 1Q7Y2 3GCFA 3CCVZ 1TFIA 2PMZA 2QKDA 1VQK1 2V8KA 4E2WA 3NFZA 1ML8A 5C4XI 1Q7Y1 3CQZI 1X0TA 4NBDA 3S14I 2QRCB 2JA7I 5AN9F 2R7ZI 1RLYA 4E2YA 1P9NA 3FQQA 1WCMI 4BXXI 1TWHI 4MRIA 1VQ41 2RIQA 2GTHA 4RVGA 4NBGA 1RQFA 1RO4A 1YUAA 3Q87A 1TWCI 3G71Z 2W04A 2R6MA 2J6AA 3G4S1 2OOXB 3FQMA 1VQ81 4RVFA 4RV9A 3CCE1 2ZAEB 1VQ5Z 4NH1C 3S1MI 3RZOI 2VUMI 2HF1A 3P5JB 1USPB 3I551 3CME1 4EWCA 1K9M2 1DL6A 1RNIA 4NBCA 1JJ2Z 2JA5I 4DQYB 1I50I 4DGLA 3KIFA 3CC71 1K8A2 5IP7I 2H85A 1K9M1 3S2DI 1S721 5FLXf 2DE5A 4MONA 3GTQI 1TWAI 2JR6A 1K8A1 1VQ8Z 3CCJ1 3I4MI 3U50C 1X3ZA 1N8R2 2E9HA 3S16I 3J80f 3NDIA 5D1OA 4A3II 3CD6Z 2LFUA 5A2Qb 2LIYA 3CCQZ 2P3YA 1N8R1 3CCLZ 1SFOI 3CC2Z 2OZKA 3CCM1 1VQOZ 3GTMI 5FLMI 3CCV1 3HOZI 3IFUA 2EGTA 4BBRI 3J81b 4TNUA 4MD9A 3I55Z 3CMEZ 1VQNZ 1W2BZ 3CXCZ 3CPWZ 1JWHC 2QRDB 1QVFY 2P28A 3CC7Z 3GTMS 4NOZA 4QTUA 2PM9A 3FKII 4XX2A 4NBBA 3GTLI 5CM2M 2Y0SA 3CCUZ 1S7MA 4MD7A 3S2HI 1NP6A 2W03A 1VQ51 3HOWI 3CCMZ 3PO2I 2AKLA 1KQSZ 4Y52I 3S15I 3VMIA 4NBEA 2HU9A 3S1QI 3IF8A 4QTTA 1VQM1 2G2KA 3VTNA 2Q51A 1YJ9Z 4A3LI 5D1OB 3VB9A 1KC82 2RPRA 2QLVB 2M6NA 1KC81 3HOVI 2VF1A 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4M A;  2DE5 A;  3ESW A;  3GTG I;  3GTO I;  3GTQ I;  1TWG I;  1TWA I;  2JR6 A;  4NBH A;  1I6H I;  1Y1V S;  4BY7 I;  3GTJ I;  3I07 A;  3H0G I;  1N2F A;  3I4M I;  3U50 C;  3HOY I;  1X3Z A;  2RBL A;  3D6W A;  5C4J I;  3S16 I;  1ZB8 A;  3VMH A;  3M3Y I;  4A3I I;  2K5R A;  1QYP A;  1NUI A;  4A3J I;  5C3E I;  1USP A;  1L1O C;  3RZD I;  1LQL A;  2E2J I;  3S17 I;  2P3Y A;  4BBS I;  4BY1 I;  1SFO I;  4MH4 A;  3GTM I;  5FLM I;  3HOZ I;  2DE7 A;  1PFT A;  3K7A I;  1Y1W I;  2NVT I;  4BBR I;  2BJO A;  2NVY I;  3PO3 I;  1TWF I;  2NVQ I;  4NBF A;  2F4O A;  3I4N I;  2R93 I;  1X3W A;  3GCF A;  1TFI A;  3GTM S;  4NOZ A;  4QTU A;  1I3Q I;  1ML8 A;  3FKI I;  5IP9 I;  4A3C I;  4XX2 A;  4A3F I;  2YU9 I;  5C4X I;  2KPI A;  3CQZ I;  4NBD A;  3PO3 S;  3S14 I;  4NBB A;  2JA7 I;  3GTL I;  2R7Z I;  4A3E I;  1RLY A;  2JA6 I;  5CM2 M;  1WCM I;  1WW9 A;  4BXX I;  1K83 I;  1TWH I;  3S2H I;  4X6A I;  4NBG A;  1VLA A;  1RO4 A;  5C44 I;  1YUA A;  3Q87 A;  3HOW I;  1R9T I;  1TWC I;  3HOX I;  4NB8 A;  2JA8 I;  3PO2 I;  2AKL A;  4A3B I;  4A3K I;  2NVX I;  2J6A A;  4A93 I;  4Y52 I;  3M4O I;  3S1R I;  2JNY A;  3H3V J;  3S15 I;  3VMI A;  4NB9 A;  4NBE A;  3S1Q I;  4QTT A;  3S1M I;  4A3M I;  4Y7N I;  3RZO I;  3GTK I;  2E2I I;  3GTP I;  3HOU I;  2PK7 A;  2JS4 A;  4A3D I;  3S1N I;  2R92 I;  2VUM I;  4A3L I;  3VB9 A;  2HF1 A;  1USP B;  2DE6 A;  2E2H I;  1Y1V I;  1DL6 A;  4NBC A;  3GKQ A;  3EER A;  2JA5 I;  4NBA A;  1I50 I;  1ZB9 A;  3VMG A;  5IP7 I;  3LUS A;  3HOV I;  2B63 I;  4A3G I;  3S2D I; 
#chains in the Genus database with same CATH topology
 1YJN Z;  3I56 1;  3CD6 1;  3GTO I;  2RHB A;  3CCQ 1;  3CCL 1;  3CC2 1;  1VQ6 Z;  1YJW 1;  1VQO 1;  1M1K 2;  1JJ2 Y;  1M90 2;  1ZB8 A;  1VQ9 Z;  2V8J A;  1VQN 1;  2K5R A;  1VQM Z;  1NUI A;  5C3E I;  3T4N B;  1M1K 1;  4NFR A;  3RZD I;  3S17 I;  2V3V A;  4HH4 A;  1M90 1;  2IV2 X;  2DE7 A;  4HGZ A;  2JMO A;  3K7A I;  2NVT I;  2E7Z A;  1Z02 A;  4E2X A;  4NBF A;  4MXU A;  2R93 I;  5IT9 f;  3CCU 1;  2OTL Z;  5D1P A;  1VQL 1;  3OW2 Z;  2GU2 A;  3TE5 B;  4A3F I;  1Q82 2;  3I56 Z;  4E33 A;  2KPI A;  1QF8 A;  1Y8C A;  1YJW Z;  1Z01 A;  4A3E I;  4E30 A;  3JAM f;  3D2L A;  2QR1 B;  2AYD A;  1W2B Y;  1Q82 1;  3J7A 4;  1WW9 A;  1K83 I;  3CXC Y;  3CPW Y;  4X6A I;  1YI2 Z;  2QA4 Z;  5C44 I;  4NB8 A;  2JA8 I;  3CCS Z;  3S1R I;  1YJ9 1;  1K73 2;  4RS4 A;  2QEX Z;  4S1T A;  1YIT Z;  1K73 1;  4MD8 A;  4Y7N I;  3GTK I;  3GTP I;  4A3D I;  1VQL Z;  2JS4 A;  2K3R A;  1Q86 2;  5LL6 f;  5FLX b;  3S1N I;  2R92 I;  1KQS Y;  3CMA 1;  1YJN 1;  1Q86 1;  3MZK B;  2DE6 A;  1VQ6 1;  3EER A;  3D9X A;  4NBA A;  1ZB9 A;  1Q81 2;  3VMG A;  1Z03 A;  3J80 b;  2RT9 A;  3LUS A;  1VQP Z;  1VQ9 1;  4A3G I;  2Q4Z A;  2F4M A;  1YHQ 1;  4RVD A;  4DK1 A;  1KD1 2;  1TWG I;  2WAQ A;  1I6H I;  4BY7 I;  3GTJ I;  2VUG A;  3I07 A;  3CCR 1;  3H0G I;  3NH8 A;  3CC4 1;  1QVG Z;  1KD1 1;  4HGY A;  5C4J I;  1RO2 A;  3IX0 A;  2GTI A;  3VMH A;  2I3C A;  1QYP A;  4A3J I;  4BY1 I;  4MH4 A;  2OTL 1;  2JIQ A;  3F3F C;  3CMA Z;  2OTJ Z;  3QWU A;  2BJO A;  2NVY I;  3PO3 I;  1TWF I;  2JIP A;  1YUK A;  3I4N I;  5A2Q f;  1VQ7 Z;  1ZH1 A;  1SIW A;  2KI7 B;  1I3Q I;  1YI2 1;  5IP9 I;  4A3C I;  2QA4 1;  1YHQ Z;  2YU9 I;  3J81 f;  3PO3 S;  2WB1 A;  3NH4 A;  2JA6 I;  3HKZ A;  3CCR Z;  3CCS 1;  3CC4 Z;  1VQK Z;  1NJI 2;  2IZ4 A;  3G6E 1;  1YIJ 1;  2QEX 1;  2O4H A;  1VLA A;  2YAD A;  3BG0 B;  4CL1 A;  3OW2 Y;  1YIT 1;  1R9T I;  3TDH B;  3HOX I;  4A3B I;  1NJI 1;  4A93 I;  4A3K I;  2NVX I;  3KIH A;  3NH5 A;  4E31 A;  3M4O I;  2JNY A;  3H3V J;  1WII A;  1VQ4 Z;  2O53 A;  4NB9 A;  4E2Z A;  5T64 A;  5T67 A;  4AYB A;  4A3M I;  2E2I I;  3HOU I;  2PK7 A;  3G4S Z;  2QRE B;  2NAP A;  1VQP 1;  3CCE Z;  4RVH A;  2E2H I;  2VPX A;  1Y1V I;  2V45 A;  3GKQ A;  3G6E Z;  1YIJ Z;  1Q16 A;  2B63 I;  3ESW A;  3GTG I;  4NBH A;  1Y1V S;  1QXF A;  2V8I A;  3EED A;  3F3P C;  1N2F A;  5T6B A;  3HOY I;  2RBL A;  2OTJ 1;  3D6W A;  1S72 Z;  3M3Y I;  1QVF Z;  1USP A;  5IT9 b;  1L1O C;  4BBS I;  1LQL A;  2E2J I;  3G71 1;  3MZL B;  4E32 A;  1VQ7 1;  2JUB A;  1WZN A;  3CCJ Z;  1PFT A;  1Y1W I;  1KRL A;  2OOY B;  3NDJ A;  3MON A;  1AA6 A;  2IZ3 A;  1Q81 1;  1RO0 A;  2M48 A;  1QVG Y;  2NVQ I;  3JAM b;  2F4O A;  1X3W A;  1Q7Y 2;  3GCF A;  3CCV Z;  1TFI A;  2PMZ A;  2QKD A;  1VQK 1;  2V8K A;  4E2W A;  3NFZ A;  1ML8 A;  5C4X I;  1Q7Y 1;  3CQZ I;  1X0T A;  4NBD A;  3S14 I;  2QRC B;  2JA7 I;  5AN9 F;  2R7Z I;  1RLY A;  4E2Y A;  1P9N A;  3FQQ A;  1WCM I;  4BXX I;  1TWH I;  4MRI A;  1VQ4 1;  2RIQ A;  2GTH A;  4RVG A;  4NBG A;  1RQF A;  1RO4 A;  1YUA A;  3Q87 A;  1TWC I;  3G71 Z;  2W04 A;  2JIO A;  2R6M A;  2J6A A;  3G4S 1;  2OOX B;  3FQM A;  1VQ8 1;  4RVF A;  4RV9 A;  1FDI A;  3CCE 1;  2ZAE B;  1VQ5 Z;  1FDO A;  4NH1 C;  3S1M I;  3RZO I;  2VUM I;  2HF1 A;  3P5J B;  1WJ2 A;  1USP B;  3I55 1;  3CME 1;  4EWC A;  1K9M 2;  1DL6 A;  1RNI A;  4NBC A;  1JJ2 Z;  2JA5 I;  4DQY B;  1I50 I;  4DGL A;  3KIF A;  3CC7 1;  1K8A 2;  5IP7 I;  2H85 A;  1K9M 1;  3S2D I;  1S72 1;  5FLX f;  2DE5 A;  4MON A;  3GTQ I;  1TWA I;  2JR6 A;  2VPW A;  1K8A 1;  1VQ8 Z;  3CCJ 1;  3I4M I;  3U50 C;  1X3Z A;  1N8R 2;  2E9H A;  3S16 I;  3J80 f;  3NDI A;  5D1O A;  2VPZ A;  2JIR A;  4A3I I;  3CD6 Z;  2LFU A;  5A2Q b;  2LIY A;  3CCQ Z;  2P3Y A;  1N8R 1;  3CCL Z;  1SFO I;  3CC2 Z;  2OZK A;  3CCM 1;  1VQO Z;  3GTM I;  5FLM I;  3CCV 1;  3HOZ I;  3IFU A;  2EGT A;  4BBR I;  3J81 b;  4TNU A;  4MD9 A;  3I55 Z;  3CME Z;  1VQN Z;  1W2B Z;  3CXC Z;  3CPW Z;  1JWH C;  2QRD B;  1QVF Y;  2P28 A;  3CC7 Z;  3GTM S;  4NOZ A;  4QTU A;  2PM9 A;  3FKI I;  2VPY A;  4XX2 A;  4NBB A;  3GTL I;  5CM2 M;  2Y0S A;  3IR7 A;  3CCU Z;  1S7M A;  4MD7 A;  3S2H I;  1NP6 A;  2W03 A;  1VQ5 1;  3HOW I;  3CCM Z;  3PO2 I;  2AKL A;  1KQS Z;  4Y52 I;  3S15 I;  3VMI A;  4NBE A;  2HU9 A;  3S1Q I;  3IF8 A;  4QTT A;  1VQM 1;  2G2K A;  3VTN A;  2Q51 A;  2JIM A;  1YJ9 Z;  4A3L I;  5D1O B;  3VB9 A;  1KC8 2;  2RPR A;  2QLV B;  2LEX A;  2M6N A;  1KC8 1;  3HOV I;  2VF1 A;  3BG1 B; 
#chains in the Genus database with same CATH homology
 1YJN Z;  3I56 1;  3CD6 1;  3GTO I;  2RHB A;  3CCQ 1;  3CCL 1;  3CC2 1;  1VQ6 Z;  1YJW 1;  1VQO 1;  1M1K 2;  1JJ2 Y;  1M90 2;  1ZB8 A;  1VQ9 Z;  2V8J A;  1VQN 1;  2K5R A;  1VQM Z;  1NUI A;  5C3E I;  3T4N B;  1M1K 1;  4NFR A;  3RZD I;  3S17 I;  4HH4 A;  1M90 1;  2DE7 A;  4HGZ A;  2JMO A;  3K7A I;  2NVT I;  1Z02 A;  4E2X A;  4NBF A;  4MXU A;  2R93 I;  5IT9 f;  3CCU 1;  2OTL Z;  5D1P A;  1VQL 1;  3OW2 Z;  2GU2 A;  3TE5 B;  4A3F I;  1Q82 2;  3I56 Z;  4E33 A;  2KPI A;  1QF8 A;  1YJW Z;  1Z01 A;  4A3E I;  4E30 A;  3JAM f;  2QR1 B;  1W2B Y;  1Q82 1;  3J7A 4;  1WW9 A;  1K83 I;  3CXC Y;  3CPW Y;  4X6A I;  1YI2 Z;  2QA4 Z;  5C44 I;  4NB8 A;  2JA8 I;  3CCS Z;  3S1R I;  1YJ9 1;  1K73 2;  4RS4 A;  2QEX Z;  4S1T A;  1YIT Z;  1K73 1;  4MD8 A;  4Y7N I;  3GTK I;  3GTP I;  4A3D I;  1VQL Z;  2JS4 A;  2K3R A;  1Q86 2;  5LL6 f;  5FLX b;  3S1N I;  2R92 I;  1KQS Y;  3CMA 1;  1YJN 1;  1Q86 1;  3MZK B;  2DE6 A;  1VQ6 1;  3EER A;  3D9X A;  4NBA A;  1ZB9 A;  1Q81 2;  3VMG A;  1Z03 A;  3J80 b;  2RT9 A;  3LUS A;  1VQP Z;  1VQ9 1;  4A3G I;  2Q4Z A;  2F4M A;  1YHQ 1;  4RVD A;  4DK1 A;  1KD1 2;  1TWG I;  2WAQ A;  1I6H I;  4BY7 I;  3GTJ I;  2VUG A;  3I07 A;  3CCR 1;  3H0G I;  3NH8 A;  3CC4 1;  1QVG Z;  1KD1 1;  4HGY A;  5C4J I;  1RO2 A;  3IX0 A;  2GTI A;  3VMH A;  2I3C A;  1QYP A;  4A3J I;  4BY1 I;  4MH4 A;  2OTL 1;  3F3F C;  3CMA Z;  2OTJ Z;  3QWU A;  2BJO A;  2NVY I;  3PO3 I;  1TWF I;  1YUK A;  3I4N I;  5A2Q f;  1VQ7 Z;  1ZH1 A;  2KI7 B;  1I3Q I;  1YI2 1;  5IP9 I;  4A3C I;  2QA4 1;  1YHQ Z;  2YU9 I;  3J81 f;  3PO3 S;  2WB1 A;  3NH4 A;  2JA6 I;  3HKZ A;  3CCR Z;  3CCS 1;  3CC4 Z;  1VQK Z;  1NJI 2;  2IZ4 A;  3G6E 1;  1YIJ 1;  2QEX 1;  2O4H A;  1VLA A;  2YAD A;  3BG0 B;  4CL1 A;  3OW2 Y;  1YIT 1;  1R9T I;  3TDH B;  3HOX I;  4A3B I;  1NJI 1;  4A93 I;  4A3K I;  2NVX I;  3KIH A;  3NH5 A;  4E31 A;  3M4O I;  2JNY A;  3H3V J;  1WII A;  1VQ4 Z;  2O53 A;  4NB9 A;  4E2Z A;  5T64 A;  5T67 A;  4AYB A;  4A3M I;  2E2I I;  3HOU I;  2PK7 A;  3G4S Z;  2QRE B;  1VQP 1;  3CCE Z;  4RVH A;  2E2H I;  1Y1V I;  3GKQ A;  3G6E Z;  1YIJ Z;  2B63 I;  3ESW A;  3GTG I;  4NBH A;  1Y1V S;  2V8I A;  3EED A;  3F3P C;  1N2F A;  5T6B A;  3HOY I;  2RBL A;  2OTJ 1;  3D6W A;  1S72 Z;  3M3Y I;  1QVF Z;  1USP A;  5IT9 b;  1L1O C;  4BBS I;  1LQL A;  2E2J I;  3G71 1;  3MZL B;  4E32 A;  1VQ7 1;  2JUB A;  3CCJ Z;  1PFT A;  1Y1W I;  1KRL A;  2OOY B;  3NDJ A;  3MON A;  2IZ3 A;  1Q81 1;  1RO0 A;  2M48 A;  1QVG Y;  2NVQ I;  3JAM b;  2F4O A;  1X3W A;  1Q7Y 2;  3GCF A;  3CCV Z;  1TFI A;  2PMZ A;  2QKD A;  1VQK 1;  2V8K A;  4E2W A;  3NFZ A;  1ML8 A;  5C4X I;  1Q7Y 1;  3CQZ I;  1X0T A;  4NBD A;  3S14 I;  2QRC B;  2JA7 I;  5AN9 F;  2R7Z I;  1RLY A;  4E2Y A;  1P9N A;  3FQQ A;  1WCM I;  4BXX I;  1TWH I;  4MRI A;  1VQ4 1;  2RIQ A;  2GTH A;  4RVG A;  4NBG A;  1RQF A;  1RO4 A;  1YUA A;  3Q87 A;  1TWC I;  3G71 Z;  2W04 A;  2R6M A;  2J6A A;  3G4S 1;  2OOX B;  3FQM A;  1VQ8 1;  4RVF A;  4RV9 A;  3CCE 1;  2ZAE B;  1VQ5 Z;  4NH1 C;  3S1M I;  3RZO I;  2VUM I;  2HF1 A;  3P5J B;  1USP B;  3I55 1;  3CME 1;  4EWC A;  1K9M 2;  1DL6 A;  1RNI A;  4NBC A;  1JJ2 Z;  2JA5 I;  4DQY B;  1I50 I;  4DGL A;  3KIF A;  3CC7 1;  1K8A 2;  5IP7 I;  2H85 A;  1K9M 1;  3S2D I;  1S72 1;  5FLX f;  2DE5 A;  4MON A;  3GTQ I;  1TWA I;  2JR6 A;  1K8A 1;  1VQ8 Z;  3CCJ 1;  3I4M I;  3U50 C;  1X3Z A;  1N8R 2;  2E9H A;  3S16 I;  3J80 f;  3NDI A;  5D1O A;  4A3I I;  3CD6 Z;  2LFU A;  5A2Q b;  2LIY A;  3CCQ Z;  2P3Y A;  1N8R 1;  3CCL Z;  1SFO I;  3CC2 Z;  2OZK A;  3CCM 1;  1VQO Z;  3GTM I;  5FLM I;  3CCV 1;  3HOZ I;  3IFU A;  2EGT A;  4BBR I;  3J81 b;  4TNU A;  4MD9 A;  3I55 Z;  3CME Z;  1VQN Z;  1W2B Z;  3CXC Z;  3CPW Z;  1JWH C;  2QRD B;  1QVF Y;  2P28 A;  3CC7 Z;  3GTM S;  4NOZ A;  4QTU A;  2PM9 A;  3FKI I;  4XX2 A;  4NBB A;  3GTL I;  5CM2 M;  2Y0S A;  3CCU Z;  1S7M A;  4MD7 A;  3S2H I;  1NP6 A;  2W03 A;  1VQ5 1;  3HOW I;  3CCM Z;  3PO2 I;  2AKL A;  1KQS Z;  4Y52 I;  3S15 I;  3VMI A;  4NBE A;  2HU9 A;  3S1Q I;  3IF8 A;  4QTT A;  1VQM 1;  2G2K A;  3VTN A;  2Q51 A;  1YJ9 Z;  4A3L I;  5D1O B;  3VB9 A;  1KC8 2;  2RPR A;  2QLV B;  2M6N A;  1KC8 1;  3HOV I;  2VF1 A;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...