4BY1I

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I02
3CQZI 3S17I 1USPA 1QYPA 5FLMI 2NVYI 3Q87A 2RBLA 4NBDA 2AKLA 3S14I 3H3VJ 4A3II 2E2HI 3I4NI 1WW9A 3D6WA 1LQLA 4QTUA 5IP7I 3M4OI 2JA6I 1TWGI 2E2II 2JR6A 3PO3S 1TFIA 2DE7A 2R92I 5C3EI 2JNYA 3GCFA 3S1NI 1SFOI 3GTGI 2NVQI 2JA5I 1DL6A 4BY7I 3VMGA 4BY1I 1ML8A 2JS4A 4BXXI 3S2HI 2K5RA 3S1MI 2HF1A 3RZDI 2DE5A 1Y1WI 1I50I 3EERA 3M3YI 3I07A 4NB9A 1I3QI 2NVXI 3GTQI 4A3BI 2DE6A 4A3GI 3S16I 4NBBA 1Y1VI 5C44I 2KPIA 4BBRI 1I6HI 3GTMI 4NBEA 4XX2A 2R7ZI 3VB9A 3GTOI 1ZB9A 3S1QI 4A3DI 3GKQA 3HOXI 4A3FI 3GTKI 3GTMS 3S2DI 4BBSI 3PO2I 1X3WA 4A3CI 1TWAI 1R9TI 3GTPI 1N2FA 2F4MA 3FKII 2J6AA 3HOZI 1RO4A 4A3LI 1X3ZA 1YUAA 5CM2M 3VMHA 1RLYA 2B63I 4NBFA 4Y7NI 1TWHI 2VUMI 4NBGA 4A3MI 4A3JI 4A93I 4NBHA 3LUSA 3PO3I 3HOWI 1ZB8A 3GTJI 2F4OA 2E2JI 5C4JI 3HOUI 3RZOI 1TWCI 1VLAA 4NBAA 3U50C 3I4MI 2BJOA 3HOYI 1WCMI 3S1RI 2R93I 5C4XI 1K83I 3S15I 2NVTI 3H0GI 3HOVI 4A3KI 3VMIA 4X6AI 1L1OC 3ESWA 1TWFI 2PK7A 4NB8A 3GTLI 2JA8I 1Y1VS 2YU9I 3K7AI 4NOZA 5IP9I 2P3YA 1USPB 1PFTA 1NUIA 2JA7I 4Y52I 4MH4A 4NBCA 4A3EI 4QTTA
chains in the Genus database with same CATH superfamily
3J81b 3NFZA 5FLMI 2NVYI 2W04A 3D9XA 1YHQ1 2E9HA 2RBLA 1S721 4DQYB 3CMA1 1YJWZ 5IT9b 3I4NI 3CMEZ 1Q862 1WW9A 1QVGY 1LQLA 4QTUA 5IP7I 3M4OI 1M902 3MZLB 1VQ7Z 3PO3S 3IFUA 2JUBA 3CCJ1 5C3EI 3CCS1 4BY1I 3QWUA 2K5RA 1WIIA 3RZDI 5FLXb 1AA6A 1I50I 3M3YI 4A3GI 1Q812 2P28A 2OTJ1 4EWCA 3J80b 2LIYA 3NDJA 3TDHB 4MD8A 1VQN1 2R7ZI 4NBEA 4XX2A 3S1QI 3GTOI 3CCJZ 1Y8CA 4RS4A 3GKQA 3HOXI 3CCEZ 3OW2Y 2VUGA 3GTMS 3CCRZ 5IT9f 1N2FA 2F4MA 2J6AA 1RO4A 1X3ZA 3VMHA 1RLYA 2B63I 1TWHI 2GTIA 4A3MI 4NBHA 1VQP1 3LUSA 3I55Z 4E2YA 2AYDA 1KD11 3NH8A 4NBAA 2HU9A 2QKDA 4E31A 3G6E1 4NFRA 3J7A4 1JJ2Z 1YIJZ 1KC81 3H0GI 1YIT1 2WB1A 4A3KI 2QEX1 1Q7Y1 2WAQA 1L1OC 3ESWA 1TWFI 1QVGZ 1YJ91 4MH4A 4Y52I 2NAPA 4QTTA 2PMZA 2OTLZ 1KD12 1JWHC 3D2LA 3S17I 4E2ZA 4CL1A 4HH4A 2IZ4A 3NH4A 3CC41 2QA41 2VPZA 2GTHA 4NH1C 2VF1A 1Q822 3CD61 3H3VJ 4A3II 2E2HI 3F3PC 3D6WA 2PM9A 2ZAEB 3TE5B 2E2II 1VQNZ 2JR6A 1VQK1 2V45A 4RVFA 2DE7A 4RVGA 5D1OA 2Q51A 3CC4Z 1YHQZ 2QR1B 2O4HA 3GCFA 2V8IA 2JA5I 1X0TA 3VMGA 1VQ41 1KRLA 3FQMA 3EERA 3I07A 4NB9A 1I3QI 2VPXA 3CXCY 2G2KA 1VQ71 2KPIA 4BBRI 2GU2A 2E7ZA 3HKZA 4A3DI 1ZB9A 2RPRA 2QLVB 3S2DI 3GTKI 4BBSI 1YJ9Z 1K732 3PO2I 1WZNA 1R9TI 3CCL1 3I561 1RQFA 1K9M1 3T4NB 1YI2Z 1RO0A 2OOYB 3HOZI 2QEXZ 2V3VA 2JMOA 1YITZ 5LL6f 2VUMI 4NBGA 2OZKA 4A93I 3BG0B 3PO3I 3HOWI 3GTJI 2F4OA 2E2JI 1TWCI 3G6EZ 1VQKZ 3U50C 3G71Z 3NDIA 3S1RI 1K83I 3CC7Z 2JIMA 1Q821 2YADA 1VQ4Z 1K8A1 5A2Qb 2PK7A 3EEDA 5T6BA 3GTLI 3MONA 2JA8I 3CME1 1NP6A 2EGTA 3K7AI 4NOZA 2YU9I 1KQSZ 4MXUA 1NUIA 2JA7I 1VQLZ 3MZKB 1QYPA 2RHBA 3Q87A 3G711 1K8A2 2IZ3A 3CPWY 3S14I 1Z03A 3F3FC 5A2Qf 1QF8A 5FLXf 2Q4ZA 4E33A 2IV2X 1W2BY 2R6MA 3CCE1 4TNUA 3IF8A 4DK1A 1VQOZ 1VQ8Z 2R92I 3CCSZ 1SFOI 1KQSY 3GTGI 3CCR1 1DL6A 1QVFY 1ML8A 2JS4A 3S1MI 3FQQA 2DE5A 1FDOA 1YIJ1 1S72Z 3J81f 2JIQA 3GTQI 4A3BI 2DE6A 3S16I 5C44I 1VQ5Z 1VQ9Z 3VTNA 4RVDA 2W03A 3G4SZ 1I6HI 3GTMI 3VB9A 4A3FI 1X3WA 1TWAI 3CC71 2QA4Z 3I56Z 1YUAA 5CM2M 4RV9A 1SIWA 2QREB 3JAMb 1YJN1 3P5JB 4HGYA 1VQPZ 1W2BZ 3CCQZ 2OTJZ 1YJW1 3G4S1 1WJ2A 1ZB8A 1M901 3RZOI 2OTL1 3HOYI 3S15I 3CXCZ 2NVTI 3CCMZ 1Z01A 4RVHA 1FDIA 3CMAZ 3JAMf 1S7MA 2RIQA 1ZH1A 3BG1B 5IP9I 2H85A 1QXFA 4NBCA 2V8JA 3NH5A 3CPWZ 1K9M2 3CQZI 3CC2Z 1USPA 1K731 1N8R1 4HGZA 3CC21 4NBDA 2AKLA 2QRCB 1Q16A 1M1K2 1RO2A 2QRDB 2K3RA 4MD9A 1Q811 1YJNZ 1VQL1 1TWGI 2JA6I 2Y0SA 2VPWA 2OOXB 1VQ61 1TFIA 1JJ2Y 2VPYA 3IX0A 2V8KA 4MRIA 3I551 2JNYA 1M1K1 2LFUA 3S1NI 1VQ81 2NVQI 4BY7I 1N8R2 2KI7B 4BXXI 3S2HI 2M48A 2HF1A 3OW2Z 5T64A 4S1TA 1P9NA 2JIOA 4MONA 5D1OB 3CCU1 1Y1WI 1VQM1 5AN9F 1VQ91 1Q861 2NVXI 4NBBA 1Y1VI 4DGLA 5D1PA 1VQ51 4E2WA 4A3CI 1QVFZ 3GTPI 3FKII 4A3LI 1YUKA 2O53A 4AYBA 3J80f 3CCV1 1YI21 4NBFA 4Y7NI 3CCUZ 3CD6Z 1RNIA 4A3JI 5C4JI 3HOUI 4E32A 3CCLZ 1VLAA 1VQ6Z 3I4MI 2BJOA 1WCMI 3KIFA 2R93I 4E30A 5C4XI 2LEXA 1VQMZ 3HOVI 2JIRA 2RT9A 2JIPA 3VMIA 4X6AI 3CCVZ 1Q7Y2 3CCM1 2I3CA 4NB8A 3CCQ1 1KC82 1Y1VS 5T67A 4E2XA 2M6NA 3KIHA 3IR7A 1Z02A 2P3YA 1USPB 1PFTA 1NJI1 4MD7A 1VQO1 4A3EI 1NJI2
chains in the Genus database with same CATH topology
3J81b 3NFZA 5FLMI 2NVYI 2W04A 3D9XA 1YHQ1 2E9HA 2RBLA 1S721 4DQYB 3CMA1 1YJWZ 5IT9b 3I4NI 3CMEZ 1Q862 1WW9A 1QVGY 1LQLA 4QTUA 5IP7I 3M4OI 1M902 3MZLB 1VQ7Z 3PO3S 3IFUA 2JUBA 3CCJ1 5C3EI 3CCS1 4BY1I 3QWUA 2K5RA 1WIIA 3RZDI 5FLXb 1I50I 3M3YI 4A3GI 1Q812 2P28A 2OTJ1 4EWCA 3J80b 2LIYA 3NDJA 3TDHB 4MD8A 1VQN1 2R7ZI 4NBEA 4XX2A 3S1QI 3GTOI 3CCJZ 4RS4A 3CCEZ 3GKQA 3HOXI 3OW2Y 2VUGA 3GTMS 3CCRZ 5IT9f 1N2FA 2F4MA 2J6AA 1RO4A 1X3ZA 3VMHA 1RLYA 2B63I 1TWHI 2GTIA 4A3MI 4NBHA 1VQP1 3LUSA 3I55Z 4E2YA 1KD11 3NH8A 4NBAA 2HU9A 2QKDA 4E31A 3G6E1 4NFRA 3J7A4 1JJ2Z 1YIJZ 1KC81 3H0GI 1YIT1 2WB1A 4A3KI 2QEX1 1Q7Y1 2WAQA 1L1OC 3ESWA 1TWFI 1QVGZ 1YJ91 4MH4A 4Y52I 4QTTA 2PMZA 2OTLZ 1KD12 1JWHC 3S17I 4E2ZA 4CL1A 4HH4A 2IZ4A 3NH4A 3CC41 2QA41 2GTHA 4NH1C 2VF1A 1Q822 3CD61 3H3VJ 4A3II 2E2HI 3F3PC 3D6WA 2PM9A 2ZAEB 3TE5B 2E2II 1VQNZ 2JR6A 1VQK1 4RVFA 2DE7A 4RVGA 5D1OA 2Q51A 3CC4Z 1YHQZ 2QR1B 2O4HA 3GCFA 2V8IA 2JA5I 1X0TA 3VMGA 1VQ41 1KRLA 3FQMA 3EERA 3I07A 4NB9A 1I3QI 3CXCY 2G2KA 1VQ71 2KPIA 4BBRI 2GU2A 3HKZA 4A3DI 1ZB9A 2RPRA 2QLVB 3S2DI 3GTKI 4BBSI 1YJ9Z 1K732 3PO2I 1R9TI 3CCL1 3I561 1RQFA 1K9M1 3T4NB 1YI2Z 1RO0A 2OOYB 3HOZI 2QEXZ 2JMOA 1YITZ 5LL6f 2VUMI 4NBGA 2OZKA 4A93I 3BG0B 3PO3I 3HOWI 3GTJI 2F4OA 2E2JI 1TWCI 3G6EZ 1VQKZ 3U50C 3G71Z 3NDIA 3S1RI 1K83I 3CC7Z 1Q821 2YADA 1VQ4Z 1K8A1 5A2Qb 2PK7A 3EEDA 5T6BA 3GTLI 3MONA 2JA8I 3CME1 1NP6A 2EGTA 3K7AI 4NOZA 2YU9I 1KQSZ 4MXUA 1NUIA 2JA7I 1VQLZ 3MZKB 1QYPA 2RHBA 3Q87A 3G711 1K8A2 2IZ3A 3CPWY 3S14I 1Z03A 3F3FC 5A2Qf 1QF8A 5FLXf 2Q4ZA 4E33A 1W2BY 2R6MA 3CCE1 4TNUA 3IF8A 4DK1A 1VQOZ 1VQ8Z 2R92I 3CCSZ 1SFOI 1KQSY 3GTGI 3CCR1 1DL6A 1QVFY 1ML8A 2JS4A 3S1MI 3FQQA 2DE5A 1YIJ1 1S72Z 3J81f 3GTQI 4A3BI 2DE6A 3S16I 5C44I 1VQ5Z 1VQ9Z 3VTNA 4RVDA 2W03A 3G4SZ 1I6HI 3GTMI 3VB9A 4A3FI 1X3WA 1TWAI 3CC71 2QA4Z 3I56Z 1YUAA 5CM2M 4RV9A 2QREB 3JAMb 1YJN1 3P5JB 4HGYA 1VQPZ 1W2BZ 3CCQZ 2OTJZ 1YJW1 3G4S1 1ZB8A 1M901 3RZOI 2OTL1 3HOYI 3S15I 3CXCZ 2NVTI 3CCMZ 1Z01A 4RVHA 3CMAZ 3JAMf 1S7MA 2RIQA 1ZH1A 3BG1B 5IP9I 2H85A 4NBCA 2V8JA 3NH5A 3CPWZ 1K9M2 3CQZI 3CC2Z 1USPA 1K731 1N8R1 4HGZA 3CC21 4NBDA 2AKLA 2QRCB 1M1K2 1RO2A 2QRDB 2K3RA 4MD9A 1Q811 1YJNZ 1VQL1 1TWGI 2JA6I 2Y0SA 2OOXB 1VQ61 1TFIA 1JJ2Y 3IX0A 2V8KA 4MRIA 3I551 2JNYA 1M1K1 2LFUA 3S1NI 1VQ81 2NVQI 4BY7I 1N8R2 2KI7B 4BXXI 3S2HI 2M48A 2HF1A 3OW2Z 5T64A 4S1TA 1P9NA 4MONA 5D1OB 3CCU1 1Y1WI 1VQM1 5AN9F 1VQ91 1Q861 2NVXI 4NBBA 1Y1VI 4DGLA 5D1PA 1VQ51 4E2WA 4A3CI 1QVFZ 3GTPI 3FKII 4A3LI 1YUKA 2O53A 4AYBA 3J80f 3CCV1 1YI21 4NBFA 4Y7NI 3CCUZ 3CD6Z 1RNIA 4A3JI 5C4JI 3HOUI 4E32A 3CCLZ 1VLAA 1VQ6Z 3I4MI 2BJOA 1WCMI 3KIFA 2R93I 4E30A 5C4XI 1VQMZ 3HOVI 2RT9A 3VMIA 4X6AI 3CCVZ 1Q7Y2 3CCM1 2I3CA 4NB8A 3CCQ1 1KC82 1Y1VS 5T67A 4E2XA 2M6NA 3KIHA 1Z02A 2P3YA 1USPB 1PFTA 1NJI1 4MD7A 1VQO1 4A3EI 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ I;  3S17 I;  1USP A;  1QYP A;  5FLM I;  2NVY I;  3Q87 A;  2RBL A;  4NBD A;  2AKL A;  3S14 I;  3H3V J;  4A3I I;  2E2H I;  3I4N I;  1WW9 A;  3D6W A;  1LQL A;  4QTU A;  5IP7 I;  3M4O I;  2JA6 I;  1TWG I;  2E2I I;  2JR6 A;  3PO3 S;  1TFI A;  2DE7 A;  2R92 I;  5C3E I;  2JNY A;  3GCF A;  3S1N I;  1SFO I;  3GTG I;  2NVQ I;  2JA5 I;  1DL6 A;  4BY7 I;  3VMG A;  4BY1 I;  1ML8 A;  2JS4 A;  4BXX I;  3S2H I;  2K5R A;  3S1M I;  2HF1 A;  3RZD I;  2DE5 A;  1Y1W I;  1I50 I;  3EER A;  3M3Y I;  3I07 A;  4NB9 A;  1I3Q I;  2NVX I;  3GTQ I;  4A3B I;  2DE6 A;  4A3G I;  3S16 I;  4NBB A;  1Y1V I;  5C44 I;  2KPI A;  4BBR I;  1I6H I;  3GTM I;  4NBE A;  4XX2 A;  2R7Z I;  3VB9 A;  3GTO I;  1ZB9 A;  3S1Q I;  4A3D I;  3GKQ A;  3HOX I;  4A3F I;  3GTK I;  3GTM S;  3S2D I;  4BBS I;  3PO2 I;  1X3W A;  4A3C I;  1TWA I;  1R9T I;  3GTP I;  1N2F A;  2F4M A;  3FKI I;  2J6A A;  3HOZ I;  1RO4 A;  4A3L I;  1X3Z A;  1YUA A;  5CM2 M;  3VMH A;  1RLY A;  2B63 I;  4NBF A;  4Y7N I;  1TWH I;  2VUM I;  4NBG A;  4A3M I;  4A3J I;  4A93 I;  4NBH A;  3LUS A;  3PO3 I;  3HOW I;  1ZB8 A;  3GTJ I;  2F4O A;  2E2J I;  5C4J I;  3HOU I;  3RZO I;  1TWC I;  1VLA A;  4NBA A;  3U50 C;  3I4M I;  2BJO A;  3HOY I;  1WCM I;  3S1R I;  2R93 I;  5C4X I;  1K83 I;  3S15 I;  2NVT I;  3H0G I;  3HOV I;  4A3K I;  3VMI A;  4X6A I;  1L1O C;  3ESW A;  1TWF I;  2PK7 A;  4NB8 A;  3GTL I;  2JA8 I;  1Y1V S;  2YU9 I;  3K7A I;  4NOZ A;  5IP9 I;  2P3Y A;  1USP B;  1PFT A;  1NUI A;  2JA7 I;  4Y52 I;  4MH4 A;  4NBC A;  4A3E I;  4QTT A; 
#chains in the Genus database with same CATH topology
 3J81 b;  3NFZ A;  5FLM I;  2NVY I;  2W04 A;  3D9X A;  1YHQ 1;  2E9H A;  2RBL A;  1S72 1;  4DQY B;  3CMA 1;  1YJW Z;  5IT9 b;  3I4N I;  3CME Z;  1Q86 2;  1WW9 A;  1QVG Y;  1LQL A;  4QTU A;  5IP7 I;  3M4O I;  1M90 2;  3MZL B;  1VQ7 Z;  3PO3 S;  3IFU A;  2JUB A;  3CCJ 1;  5C3E I;  3CCS 1;  4BY1 I;  3QWU A;  2K5R A;  1WII A;  3RZD I;  5FLX b;  1AA6 A;  1I50 I;  3M3Y I;  4A3G I;  1Q81 2;  2P28 A;  2OTJ 1;  4EWC A;  3J80 b;  2LIY A;  3NDJ A;  3TDH B;  4MD8 A;  1VQN 1;  2R7Z I;  4NBE A;  4XX2 A;  3S1Q I;  3GTO I;  3CCJ Z;  1Y8C A;  4RS4 A;  3GKQ A;  3HOX I;  3CCE Z;  3OW2 Y;  2VUG A;  3GTM S;  3CCR Z;  5IT9 f;  1N2F A;  2F4M A;  2J6A A;  1RO4 A;  1X3Z A;  3VMH A;  1RLY A;  2B63 I;  1TWH I;  2GTI A;  4A3M I;  4NBH A;  1VQP 1;  3LUS A;  3I55 Z;  4E2Y A;  2AYD A;  1KD1 1;  3NH8 A;  4NBA A;  2HU9 A;  2QKD A;  4E31 A;  3G6E 1;  4NFR A;  3J7A 4;  1JJ2 Z;  1YIJ Z;  1KC8 1;  3H0G I;  1YIT 1;  2WB1 A;  4A3K I;  2QEX 1;  1Q7Y 1;  2WAQ A;  1L1O C;  3ESW A;  1TWF I;  1QVG Z;  1YJ9 1;  4MH4 A;  4Y52 I;  2NAP A;  4QTT A;  2PMZ A;  2OTL Z;  1KD1 2;  1JWH C;  3D2L A;  3S17 I;  4E2Z A;  4CL1 A;  4HH4 A;  2IZ4 A;  3NH4 A;  3CC4 1;  2QA4 1;  2VPZ A;  2GTH A;  4NH1 C;  2VF1 A;  1Q82 2;  3CD6 1;  3H3V J;  4A3I I;  2E2H I;  3F3P C;  3D6W A;  2PM9 A;  2ZAE B;  3TE5 B;  2E2I I;  1VQN Z;  2JR6 A;  1VQK 1;  2V45 A;  4RVF A;  2DE7 A;  4RVG A;  5D1O A;  2Q51 A;  3CC4 Z;  1YHQ Z;  2QR1 B;  2O4H A;  3GCF A;  2V8I A;  2JA5 I;  1X0T A;  3VMG A;  1VQ4 1;  1KRL A;  3FQM A;  3EER A;  3I07 A;  4NB9 A;  1I3Q I;  2VPX A;  3CXC Y;  2G2K A;  1VQ7 1;  2KPI A;  4BBR I;  2GU2 A;  2E7Z A;  3HKZ A;  4A3D I;  1ZB9 A;  2RPR A;  2QLV B;  3S2D I;  3GTK I;  4BBS I;  1YJ9 Z;  1K73 2;  3PO2 I;  1WZN A;  1R9T I;  3CCL 1;  3I56 1;  1RQF A;  1K9M 1;  3T4N B;  1YI2 Z;  1RO0 A;  2OOY B;  3HOZ I;  2QEX Z;  2V3V A;  2JMO A;  1YIT Z;  5LL6 f;  2VUM I;  4NBG A;  2OZK A;  4A93 I;  3BG0 B;  3PO3 I;  3HOW I;  3GTJ I;  2F4O A;  2E2J I;  1TWC I;  3G6E Z;  1VQK Z;  3U50 C;  3G71 Z;  3NDI A;  3S1R I;  1K83 I;  3CC7 Z;  2JIM A;  1Q82 1;  2YAD A;  1VQ4 Z;  1K8A 1;  5A2Q b;  2PK7 A;  3EED A;  5T6B A;  3GTL I;  3MON A;  2JA8 I;  3CME 1;  1NP6 A;  2EGT A;  3K7A I;  4NOZ A;  2YU9 I;  1KQS Z;  4MXU A;  1NUI A;  2JA7 I;  1VQL Z;  3MZK B;  1QYP A;  2RHB A;  3Q87 A;  3G71 1;  1K8A 2;  2IZ3 A;  3CPW Y;  3S14 I;  1Z03 A;  3F3F C;  5A2Q f;  1QF8 A;  5FLX f;  2Q4Z A;  4E33 A;  2IV2 X;  1W2B Y;  2R6M A;  3CCE 1;  4TNU A;  3IF8 A;  4DK1 A;  1VQO Z;  1VQ8 Z;  2R92 I;  3CCS Z;  1SFO I;  1KQS Y;  3GTG I;  3CCR 1;  1DL6 A;  1QVF Y;  1ML8 A;  2JS4 A;  3S1M I;  3FQQ A;  2DE5 A;  1FDO A;  1YIJ 1;  1S72 Z;  3J81 f;  2JIQ A;  3GTQ I;  4A3B I;  2DE6 A;  3S16 I;  5C44 I;  1VQ5 Z;  1VQ9 Z;  3VTN A;  4RVD A;  2W03 A;  3G4S Z;  1I6H I;  3GTM I;  3VB9 A;  4A3F I;  1X3W A;  1TWA I;  3CC7 1;  2QA4 Z;  3I56 Z;  1YUA A;  5CM2 M;  4RV9 A;  1SIW A;  2QRE B;  3JAM b;  1YJN 1;  3P5J B;  4HGY A;  1VQP Z;  1W2B Z;  3CCQ Z;  2OTJ Z;  1YJW 1;  3G4S 1;  1WJ2 A;  1ZB8 A;  1M90 1;  3RZO I;  2OTL 1;  3HOY I;  3S15 I;  3CXC Z;  2NVT I;  3CCM Z;  1Z01 A;  4RVH A;  1FDI A;  3CMA Z;  3JAM f;  1S7M A;  2RIQ A;  1ZH1 A;  3BG1 B;  5IP9 I;  2H85 A;  1QXF A;  4NBC A;  2V8J A;  3NH5 A;  3CPW Z;  1K9M 2;  3CQZ I;  3CC2 Z;  1USP A;  1K73 1;  1N8R 1;  4HGZ A;  3CC2 1;  4NBD A;  2AKL A;  2QRC B;  1Q16 A;  1M1K 2;  1RO2 A;  2QRD B;  2K3R A;  4MD9 A;  1Q81 1;  1YJN Z;  1VQL 1;  1TWG I;  2JA6 I;  2Y0S A;  2VPW A;  2OOX B;  1VQ6 1;  1TFI A;  1JJ2 Y;  2VPY A;  3IX0 A;  2V8K A;  4MRI A;  3I55 1;  2JNY A;  1M1K 1;  2LFU A;  3S1N I;  1VQ8 1;  2NVQ I;  4BY7 I;  1N8R 2;  2KI7 B;  4BXX I;  3S2H I;  2M48 A;  2HF1 A;  3OW2 Z;  5T64 A;  4S1T A;  1P9N A;  2JIO A;  4MON A;  5D1O B;  3CCU 1;  1Y1W I;  1VQM 1;  5AN9 F;  1VQ9 1;  1Q86 1;  2NVX I;  4NBB A;  1Y1V I;  4DGL A;  5D1P A;  1VQ5 1;  4E2W A;  4A3C I;  1QVF Z;  3GTP I;  3FKI I;  4A3L I;  1YUK A;  2O53 A;  4AYB A;  3J80 f;  3CCV 1;  1YI2 1;  4NBF A;  4Y7N I;  3CCU Z;  3CD6 Z;  1RNI A;  4A3J I;  5C4J I;  3HOU I;  4E32 A;  3CCL Z;  1VLA A;  1VQ6 Z;  3I4M I;  2BJO A;  1WCM I;  3KIF A;  2R93 I;  4E30 A;  5C4X I;  2LEX A;  1VQM Z;  3HOV I;  2JIR A;  2RT9 A;  2JIP A;  3VMI A;  4X6A I;  3CCV Z;  1Q7Y 2;  3CCM 1;  2I3C A;  4NB8 A;  3CCQ 1;  1KC8 2;  1Y1V S;  5T67 A;  4E2X A;  2M6N A;  3KIH A;  3IR7 A;  1Z02 A;  2P3Y A;  1USP B;  1PFT A;  1NJI 1;  4MD7 A;  1VQO 1;  4A3E I;  1NJI 2; 
#chains in the Genus database with same CATH homology
 3J81 b;  3NFZ A;  5FLM I;  2NVY I;  2W04 A;  3D9X A;  1YHQ 1;  2E9H A;  2RBL A;  1S72 1;  4DQY B;  3CMA 1;  1YJW Z;  5IT9 b;  3I4N I;  3CME Z;  1Q86 2;  1WW9 A;  1QVG Y;  1LQL A;  4QTU A;  5IP7 I;  3M4O I;  1M90 2;  3MZL B;  1VQ7 Z;  3PO3 S;  3IFU A;  2JUB A;  3CCJ 1;  5C3E I;  3CCS 1;  4BY1 I;  3QWU A;  2K5R A;  1WII A;  3RZD I;  5FLX b;  1I50 I;  3M3Y I;  4A3G I;  1Q81 2;  2P28 A;  2OTJ 1;  4EWC A;  3J80 b;  2LIY A;  3NDJ A;  3TDH B;  4MD8 A;  1VQN 1;  2R7Z I;  4NBE A;  4XX2 A;  3S1Q I;  3GTO I;  3CCJ Z;  4RS4 A;  3CCE Z;  3GKQ A;  3HOX I;  3OW2 Y;  2VUG A;  3GTM S;  3CCR Z;  5IT9 f;  1N2F A;  2F4M A;  2J6A A;  1RO4 A;  1X3Z A;  3VMH A;  1RLY A;  2B63 I;  1TWH I;  2GTI A;  4A3M I;  4NBH A;  1VQP 1;  3LUS A;  3I55 Z;  4E2Y A;  1KD1 1;  3NH8 A;  4NBA A;  2HU9 A;  2QKD A;  4E31 A;  3G6E 1;  4NFR A;  3J7A 4;  1JJ2 Z;  1YIJ Z;  1KC8 1;  3H0G I;  1YIT 1;  2WB1 A;  4A3K I;  2QEX 1;  1Q7Y 1;  2WAQ A;  1L1O C;  3ESW A;  1TWF I;  1QVG Z;  1YJ9 1;  4MH4 A;  4Y52 I;  4QTT A;  2PMZ A;  2OTL Z;  1KD1 2;  1JWH C;  3S17 I;  4E2Z A;  4CL1 A;  4HH4 A;  2IZ4 A;  3NH4 A;  3CC4 1;  2QA4 1;  2GTH A;  4NH1 C;  2VF1 A;  1Q82 2;  3CD6 1;  3H3V J;  4A3I I;  2E2H I;  3F3P C;  3D6W A;  2PM9 A;  2ZAE B;  3TE5 B;  2E2I I;  1VQN Z;  2JR6 A;  1VQK 1;  4RVF A;  2DE7 A;  4RVG A;  5D1O A;  2Q51 A;  3CC4 Z;  1YHQ Z;  2QR1 B;  2O4H A;  3GCF A;  2V8I A;  2JA5 I;  1X0T A;  3VMG A;  1VQ4 1;  1KRL A;  3FQM A;  3EER A;  3I07 A;  4NB9 A;  1I3Q I;  3CXC Y;  2G2K A;  1VQ7 1;  2KPI A;  4BBR I;  2GU2 A;  3HKZ A;  4A3D I;  1ZB9 A;  2RPR A;  2QLV B;  3S2D I;  3GTK I;  4BBS I;  1YJ9 Z;  1K73 2;  3PO2 I;  1R9T I;  3CCL 1;  3I56 1;  1RQF A;  1K9M 1;  3T4N B;  1YI2 Z;  1RO0 A;  2OOY B;  3HOZ I;  2QEX Z;  2JMO A;  1YIT Z;  5LL6 f;  2VUM I;  4NBG A;  2OZK A;  4A93 I;  3BG0 B;  3PO3 I;  3HOW I;  3GTJ I;  2F4O A;  2E2J I;  1TWC I;  3G6E Z;  1VQK Z;  3U50 C;  3G71 Z;  3NDI A;  3S1R I;  1K83 I;  3CC7 Z;  1Q82 1;  2YAD A;  1VQ4 Z;  1K8A 1;  5A2Q b;  2PK7 A;  3EED A;  5T6B A;  3GTL I;  3MON A;  2JA8 I;  3CME 1;  1NP6 A;  2EGT A;  3K7A I;  4NOZ A;  2YU9 I;  1KQS Z;  4MXU A;  1NUI A;  2JA7 I;  1VQL Z;  3MZK B;  1QYP A;  2RHB A;  3Q87 A;  3G71 1;  1K8A 2;  2IZ3 A;  3CPW Y;  3S14 I;  1Z03 A;  3F3F C;  5A2Q f;  1QF8 A;  5FLX f;  2Q4Z A;  4E33 A;  1W2B Y;  2R6M A;  3CCE 1;  4TNU A;  3IF8 A;  4DK1 A;  1VQO Z;  1VQ8 Z;  2R92 I;  3CCS Z;  1SFO I;  1KQS Y;  3GTG I;  3CCR 1;  1DL6 A;  1QVF Y;  1ML8 A;  2JS4 A;  3S1M I;  3FQQ A;  2DE5 A;  1YIJ 1;  1S72 Z;  3J81 f;  3GTQ I;  4A3B I;  2DE6 A;  3S16 I;  5C44 I;  1VQ5 Z;  1VQ9 Z;  3VTN A;  4RVD A;  2W03 A;  3G4S Z;  1I6H I;  3GTM I;  3VB9 A;  4A3F I;  1X3W A;  1TWA I;  3CC7 1;  2QA4 Z;  3I56 Z;  1YUA A;  5CM2 M;  4RV9 A;  2QRE B;  3JAM b;  1YJN 1;  3P5J B;  4HGY A;  1VQP Z;  1W2B Z;  3CCQ Z;  2OTJ Z;  1YJW 1;  3G4S 1;  1ZB8 A;  1M90 1;  3RZO I;  2OTL 1;  3HOY I;  3S15 I;  3CXC Z;  2NVT I;  3CCM Z;  1Z01 A;  4RVH A;  3CMA Z;  3JAM f;  1S7M A;  2RIQ A;  1ZH1 A;  3BG1 B;  5IP9 I;  2H85 A;  4NBC A;  2V8J A;  3NH5 A;  3CPW Z;  1K9M 2;  3CQZ I;  3CC2 Z;  1USP A;  1K73 1;  1N8R 1;  4HGZ A;  3CC2 1;  4NBD A;  2AKL A;  2QRC B;  1M1K 2;  1RO2 A;  2QRD B;  2K3R A;  4MD9 A;  1Q81 1;  1YJN Z;  1VQL 1;  1TWG I;  2JA6 I;  2Y0S A;  2OOX B;  1VQ6 1;  1TFI A;  1JJ2 Y;  3IX0 A;  2V8K A;  4MRI A;  3I55 1;  2JNY A;  1M1K 1;  2LFU A;  3S1N I;  1VQ8 1;  2NVQ I;  4BY7 I;  1N8R 2;  2KI7 B;  4BXX I;  3S2H I;  2M48 A;  2HF1 A;  3OW2 Z;  5T64 A;  4S1T A;  1P9N A;  4MON A;  5D1O B;  3CCU 1;  1Y1W I;  1VQM 1;  5AN9 F;  1VQ9 1;  1Q86 1;  2NVX I;  4NBB A;  1Y1V I;  4DGL A;  5D1P A;  1VQ5 1;  4E2W A;  4A3C I;  1QVF Z;  3GTP I;  3FKI I;  4A3L I;  1YUK A;  2O53 A;  4AYB A;  3J80 f;  3CCV 1;  1YI2 1;  4NBF A;  4Y7N I;  3CCU Z;  3CD6 Z;  1RNI A;  4A3J I;  5C4J I;  3HOU I;  4E32 A;  3CCL Z;  1VLA A;  1VQ6 Z;  3I4M I;  2BJO A;  1WCM I;  3KIF A;  2R93 I;  4E30 A;  5C4X I;  1VQM Z;  3HOV I;  2RT9 A;  3VMI A;  4X6A I;  3CCV Z;  1Q7Y 2;  3CCM 1;  2I3C A;  4NB8 A;  3CCQ 1;  1KC8 2;  1Y1V S;  5T67 A;  4E2X A;  2M6N A;  3KIH A;  1Z02 A;  2P3Y A;  1USP B;  1PFT A;  1NJI 1;  4MD7 A;  1VQO 1;  4A3E I;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...