4BY1I

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I02
4A3BI 3I4MI 4X6AI 2P3YA 5C3EI 2R92I 1I6HI 3GTJI 5IP7I 2B63I 2R7ZI 2PK7A 2E2II 1LQLA 4BBRI 1WCMI 1ML8A 3HOWI 1X3WA 1VLAA 1Y1WI 4XX2A 2HF1A 5C4XI 1NUIA 1X3ZA 1ZB8A 2DE6A 5IP9I 1TWGI 2JA7I 2JS4A 1TWAI 4NBCA 1RO4A 3FKII 2K5RA 4MH4A 3PO3S 1Y1VI 2F4OA 1R9TI 3I07A 3VMIA 2NVTI 1K83I 4NBHA 3S2HI 1TWFI 4Y52I 4NBAA 5C44I 3VB9A 3S1MI 3K7AI 3PO2I 4NOZA 3S15I 4A3II 4A93I 4A3DI 2NVYI 3GTGI 4NB9A 4A3JI 3D6WA 4NB8A 3S1QI 2R93I 1WW9A 5FLMI 3I4NI 4Y7NI 1YUAA 1TWCI 3S1NI 2JR6A 2DE5A 1TWHI 4NBFA 1L1OC 5C4JI 3EERA 2KPIA 3PO3I 4A3EI 3GTMS 3GTKI 3H0GI 3HOXI 3ESWA 3VMHA 4A3LI 1I50I 2AKLA 4NBBA 4NBEA 1DL6A 3GTPI 2RBLA 3HOUI 2JNYA 4A3MI 3Q87A 4QTTA 5CM2M 3CQZI 4NBGA 3RZOI 2DE7A 3RZDI 2E2JI 2JA6I 3HOZI 4BY7I 2VUMI 2YU9I 3S1RI 3VMGA 2NVQI 3S16I 3S14I 1I3QI 2F4MA 3GTLI 4A3FI 3HOYI 4QTUA 1TFIA 1RLYA 3M4OI 3S17I 2JA5I 3S2DI 2J6AA 4BBSI 2NVXI 4BY1I 1N2FA 2BJOA 1Y1VS 3LUSA 2E2HI 4NBDA 1PFTA 1ZB9A 3GTMI 3H3VJ 3GCFA 3U50C 1USPB 1QYPA 1SFOI 3GTOI 3M3YI 4A3CI 4A3KI 1USPA 3GTQI 3HOVI 3GKQA 4A3GI 2JA8I 4BXXI
chains in the Genus database with same CATH superfamily
4A3BI 4NFRA 1YITZ 1I6HI 2R7ZI 3CXCY 5T67A 3CCJZ 2QRCB 2V8IA 1Y1WI 2E7ZA 1VQ51 1RO0A 1VQL1 3I561 5T6BA 2JS4A 4DK1A 2OTL1 1RO4A 5FLXb 1VQM1 4MH4A 1QXFA 3PO3S 1VQ5Z 3J7A4 3CCU1 1VQLZ 2QR1B 1W2BZ 2JIQA 2IV2X 3I56Z 2K3RA 2OTLZ 1VQMZ 2Y0SA 4NBAA 3FQMA 1Z03A 3CCUZ 3S1MI 4CL1A 4A3DI 2LEXA 1AA6A 4RVGA 4Y7NI 1K8A1 2P28A 2JR6A 3NFZA 3CC71 3QWUA 3EERA 2KPIA 2PMZA 3GTMS 4DGLA 3PO3I 5A2Qf 1VQ91 2AKLA 4NBEA 1RNIA 3GTPI 3HOUI 4A3MI 4E2WA 1FDIA 2IZ3A 1VQ9Z 2E2JI 3CCS1 3JAMb 2YU9I 1X0TA 1FDOA 1KRLA 3VMGA 3S16I 3S14I 3CCL1 3CD6Z 4A3FI 1KD12 4E31A 4QTUA 2RIQA 2OOXB 3BG0B 2QRDB 3CCLZ 3P5JB 2AYDA 4RVDA 5D1PA 3GTMI 3U50C 2G2KA 1NJI2 3CCM1 3M3YI 4A3KI 2M6NA 2EGTA 1Z02A 3HOVI 1Q811 3I4MI 2R6MA 5C3EI 4HGZA 3CCMZ 5IP7I 5AN9F 4HGYA 1VQ61 2E2II 5T64A 1WCMI 1X3WA 1VLAA 2PM9A 4XX2A 2HF1A 1TWGI 1VQK1 1VQ6Z 3CCQ1 3NH5A 2F4OA 2GTIA 2VF1A 3CCV1 1K83I 1VQKZ 3S2HI 3CCQZ 2QREB 3J80f 3CPWZ 3K7AI 1KD11 3PO2I 3IFUA 3CCVZ 2JIPA 1VQ41 4A3II 1JJ2Y 2H85A 4NB9A 4A3JI 2V3VA 4MRIA 2QKDA 3BG1B 2R93I 3NDJA 1WW9A 5FLMI 4RV9A 1SIWA 1VQ4Z 3I4NI 1NJI1 3KIFA 3NDIA 3S1NI 3IX0A 4NBFA 1L1OC 2JIOA 4MD7A 4A3EI 2QEX1 3ESWA 1WIIA 3VMHA 3G4S1 1I50I 3IF8A 1KQSY 4EWCA 1DL6A 2RBLA 2JNYA 3Q87A 2V8JA 4QTTA 5CM2M 1WJ2A 1Q862 3RZOI 2DE7A 2VPZA 4TNUA 1QVGY 2QEXZ 2JA6I 1Q16A 4AYBA 1Q812 1YJW1 1KC82 4E2ZA 1I3QI 1K9M2 2F4MA 2WB1A 2HU9A 1YJWZ 2NVXI 1N2FA 3LUSA 1Y1VS 2M48A 1ZB9A 3CC7Z 3H3VJ 2W04A 3GTOI 2VPXA 2JIMA 1NP6A 1S721 3GTQI 1RO2A 3KIHA 1Q7Y2 1N8R1 1YI21 4BXXI 4X6AI 1W2BY 2P3YA 3G711 3GTJI 1VQP1 1S7MA 1Q822 4E32A 1S72Z 3CCSZ 4BBRI 3HOWI 1JWHC 5C4XI 1NUIA 4E30A 2DE6A 5IP9I 3G71Z 1VQPZ 3D2LA 3OW2Z 1QVFZ 3MZKB 1YIJ1 1TWAI 1YHQ1 4NBCA 3FKII 5IT9f 3MZLB 1Y1VI 1Q861 2W03A 3I07A 3CMA1 5A2Qb 3VMIA 3NH8A 2NVTI 4RS4A 1TWFI 1YIJZ 1YHQZ 4NH1C 3MONA 1KC81 3CXCZ 2VPYA 3CMAZ 2WAQA 5C44I 1Z01A 2LIYA 1K9M1 3HKZA 1Y8CA 4NOZA 1JJ2Z 1P9NA 3NH4A 3GTGI 3IR7A 4NB8A 3CME1 2DE5A 1TWHI 5FLXf 1Q7Y1 2RHBA 3HOXI 4A3LI 1VQN1 4NBBA 5IT9b 1Q821 2Q51A 3CMEZ 2GTHA 3EEDA 4RVHA 3RZDI 3CCE1 2KI7B 3HOZI 1VQNZ 1N8R2 1M901 2JMOA 3CCEZ 2Q4ZA 3GTLI 3HOYI 1RLYA 2JA5I 2QA41 1M1K2 2LFUA 4BY1I 2E2HI 1RQFA 1YJ91 1PFTA 1USPB 1SFOI 1YUKA 2QA4Z 4A3CI 3T4NB 3J81f 1USPA 2VPWA 3G4SZ 2OZKA 3J80b 3GKQA 4A3GI 1YJ9Z 2JA8I 1K732 3D9XA 4MD8A 2R92I 2RPRA 2GU2A 3G6E1 2B63I 3JAMf 3CPWY 4DQYB 2PK7A 1LQLA 2RT9A 1ML8A 3F3PC 1WZNA 1X3ZA 1ZB8A 3FQQA 3G6EZ 2JA7I 3I551 3F3FC 3CC21 1QF8A 2K5RA 2O53A 1R9TI 2V45A 2YADA 4E2YA 4HH4A 4NBHA 3VTNA 3I55Z 4E33A 3CC2Z 4Y52I 3VB9A 4MXUA 3J81b 2QLVB 2IZ4A 2NAPA 1YI2Z 3S15I 2V8KA 4A93I 1M1K1 3TDHB 2JUBA 2NVYI 3CD61 3D6WA 3S1QI 1M902 4E2XA 1VQ81 1YUAA 1TWCI 4MONA 5C4JI 1VQO1 2OTJ1 1K731 2OOYB 3TE5B 3GTKI 3H0GI 1VQ8Z 2I3CA 4S1TA 3CQZI 4NBGA 1VQOZ 2OTJZ 4MD9A 2VUMI 4BY7I 3S1RI 5D1OB 3CC41 2NVQI 3CCR1 5D1OA 2E9HA 2ZAEB 3M4OI 1TFIA 3S17I 2JIRA 3S2DI 2J6AA 4BBSI 2O4HA 1VQ71 1KQSZ 3CC4Z 4RVFA 2BJOA 2VUGA 3CCRZ 4NBDA 1YJN1 3OW2Y 3GCFA 5LL6f 1YIT1 1QVFY 1QVGZ 1QYPA 1K8A2 1VQ7Z 3CCJ1 1ZH1A 1YJNZ
chains in the Genus database with same CATH topology
4A3BI 4NFRA 1YITZ 1I6HI 2R7ZI 3CXCY 5T67A 3CCJZ 2QRCB 2V8IA 1Y1WI 1VQ51 1RO0A 1VQL1 3I561 5T6BA 2JS4A 4DK1A 2OTL1 1RO4A 5FLXb 1VQM1 4MH4A 3PO3S 1VQ5Z 3J7A4 3CCU1 1VQLZ 2QR1B 1W2BZ 3I56Z 2K3RA 2OTLZ 1VQMZ 2Y0SA 4NBAA 3FQMA 1Z03A 3CCUZ 3S1MI 4CL1A 4A3DI 4RVGA 4Y7NI 1K8A1 2P28A 2JR6A 3NFZA 3CC71 3QWUA 3EERA 2KPIA 2PMZA 3GTMS 4DGLA 3PO3I 5A2Qf 1VQ91 2AKLA 4NBEA 1RNIA 3GTPI 3HOUI 4A3MI 4E2WA 2IZ3A 1VQ9Z 2E2JI 3CCS1 3JAMb 2YU9I 1X0TA 1KRLA 3VMGA 3S16I 3S14I 3CCL1 3CD6Z 4A3FI 1KD12 4E31A 4QTUA 2RIQA 2OOXB 3BG0B 2QRDB 3CCLZ 3P5JB 4RVDA 5D1PA 3GTMI 3U50C 2G2KA 1NJI2 3CCM1 3M3YI 4A3KI 2M6NA 2EGTA 1Z02A 3HOVI 1Q811 3I4MI 2R6MA 5C3EI 4HGZA 3CCMZ 5IP7I 5AN9F 4HGYA 1VQ61 2E2II 5T64A 1WCMI 1X3WA 1VLAA 2PM9A 4XX2A 2HF1A 1TWGI 1VQK1 1VQ6Z 3CCQ1 3NH5A 2F4OA 2GTIA 2VF1A 3CCV1 1K83I 1VQKZ 3S2HI 3CCQZ 2QREB 3J80f 3CPWZ 3K7AI 1KD11 3PO2I 3IFUA 3CCVZ 1VQ41 4A3II 1JJ2Y 2H85A 4NB9A 4A3JI 4MRIA 2QKDA 3BG1B 2R93I 3NDJA 1WW9A 5FLMI 4RV9A 1VQ4Z 3I4NI 1NJI1 3KIFA 3NDIA 3S1NI 3IX0A 4NBFA 1L1OC 4MD7A 4A3EI 2QEX1 3ESWA 1WIIA 3VMHA 3G4S1 1I50I 3IF8A 1KQSY 4EWCA 1DL6A 2RBLA 2JNYA 3Q87A 2V8JA 4QTTA 5CM2M 1Q862 3RZOI 2DE7A 4TNUA 1QVGY 2QEXZ 2JA6I 4AYBA 1Q812 1YJW1 1KC82 4E2ZA 1I3QI 1K9M2 2F4MA 2WB1A 2HU9A 1YJWZ 2NVXI 1N2FA 3LUSA 1Y1VS 2M48A 1ZB9A 3CC7Z 3H3VJ 2W04A 3GTOI 1NP6A 1S721 3GTQI 1RO2A 3KIHA 1Q7Y2 1N8R1 1YI21 4BXXI 4X6AI 1W2BY 2P3YA 3G711 3GTJI 1VQP1 1S7MA 1Q822 4E32A 1S72Z 3CCSZ 4BBRI 3HOWI 1JWHC 5C4XI 1NUIA 4E30A 2DE6A 5IP9I 3G71Z 1VQPZ 3OW2Z 1QVFZ 3MZKB 1YIJ1 1TWAI 1YHQ1 4NBCA 3FKII 5IT9f 3MZLB 1Y1VI 1Q861 2W03A 3I07A 3CMA1 5A2Qb 3VMIA 3NH8A 2NVTI 4RS4A 1TWFI 1YIJZ 1YHQZ 4NH1C 3MONA 1KC81 3CXCZ 3CMAZ 2WAQA 5C44I 1Z01A 2LIYA 1K9M1 3HKZA 4NOZA 1JJ2Z 1P9NA 3NH4A 3GTGI 4NB8A 3CME1 2DE5A 1TWHI 5FLXf 1Q7Y1 2RHBA 3HOXI 4A3LI 1VQN1 4NBBA 5IT9b 1Q821 2Q51A 3CMEZ 2GTHA 3EEDA 4RVHA 3RZDI 3CCE1 2KI7B 3HOZI 1VQNZ 1N8R2 1M901 2JMOA 3CCEZ 2Q4ZA 3GTLI 3HOYI 1RLYA 2JA5I 2QA41 1M1K2 2LFUA 4BY1I 2E2HI 1RQFA 1YJ91 1PFTA 1USPB 1SFOI 1YUKA 2QA4Z 4A3CI 3T4NB 3J81f 1USPA 3G4SZ 2OZKA 3J80b 3GKQA 4A3GI 1YJ9Z 2JA8I 1K732 3D9XA 4MD8A 2R92I 2RPRA 2GU2A 3G6E1 2B63I 3JAMf 3CPWY 4DQYB 2PK7A 1LQLA 2RT9A 1ML8A 3F3PC 1X3ZA 1ZB8A 3FQQA 3G6EZ 2JA7I 3I551 3F3FC 3CC21 1QF8A 2K5RA 2O53A 1R9TI 2YADA 4E2YA 4HH4A 4NBHA 3VTNA 3I55Z 4E33A 3CC2Z 4Y52I 3VB9A 4MXUA 3J81b 2QLVB 2IZ4A 1YI2Z 3S15I 2V8KA 4A93I 1M1K1 3TDHB 2JUBA 2NVYI 3CD61 3D6WA 3S1QI 1M902 4E2XA 1VQ81 1YUAA 1TWCI 4MONA 5C4JI 1VQO1 2OTJ1 1K731 2OOYB 3TE5B 3GTKI 3H0GI 1VQ8Z 2I3CA 4S1TA 3CQZI 4NBGA 1VQOZ 2OTJZ 4MD9A 2VUMI 4BY7I 3S1RI 5D1OB 3CC41 2NVQI 3CCR1 5D1OA 2E9HA 2ZAEB 3M4OI 1TFIA 3S17I 3S2DI 2J6AA 4BBSI 2O4HA 1VQ71 1KQSZ 3CC4Z 4RVFA 2BJOA 2VUGA 3CCRZ 4NBDA 1YJN1 3OW2Y 3GCFA 5LL6f 1YIT1 1QVFY 1QVGZ 1QYPA 1K8A2 1VQ7Z 3CCJ1 1ZH1A 1YJNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B I;  3I4M I;  4X6A I;  2P3Y A;  5C3E I;  2R92 I;  1I6H I;  3GTJ I;  5IP7 I;  2B63 I;  2R7Z I;  2PK7 A;  2E2I I;  1LQL A;  4BBR I;  1WCM I;  1ML8 A;  3HOW I;  1X3W A;  1VLA A;  1Y1W I;  4XX2 A;  2HF1 A;  5C4X I;  1NUI A;  1X3Z A;  1ZB8 A;  2DE6 A;  5IP9 I;  1TWG I;  2JA7 I;  2JS4 A;  1TWA I;  4NBC A;  1RO4 A;  3FKI I;  2K5R A;  4MH4 A;  3PO3 S;  1Y1V I;  2F4O A;  1R9T I;  3I07 A;  3VMI A;  2NVT I;  1K83 I;  4NBH A;  3S2H I;  1TWF I;  4Y52 I;  4NBA A;  5C44 I;  3VB9 A;  3S1M I;  3K7A I;  3PO2 I;  4NOZ A;  3S15 I;  4A3I I;  4A93 I;  4A3D I;  2NVY I;  3GTG I;  4NB9 A;  4A3J I;  3D6W A;  4NB8 A;  3S1Q I;  2R93 I;  1WW9 A;  5FLM I;  3I4N I;  4Y7N I;  1YUA A;  1TWC I;  3S1N I;  2JR6 A;  2DE5 A;  1TWH I;  4NBF A;  1L1O C;  5C4J I;  3EER A;  2KPI A;  3PO3 I;  4A3E I;  3GTM S;  3GTK I;  3H0G I;  3HOX I;  3ESW A;  3VMH A;  4A3L I;  1I50 I;  2AKL A;  4NBB A;  4NBE A;  1DL6 A;  3GTP I;  2RBL A;  3HOU I;  2JNY A;  4A3M I;  3Q87 A;  4QTT A;  5CM2 M;  3CQZ I;  4NBG A;  3RZO I;  2DE7 A;  3RZD I;  2E2J I;  2JA6 I;  3HOZ I;  4BY7 I;  2VUM I;  2YU9 I;  3S1R I;  3VMG A;  2NVQ I;  3S16 I;  3S14 I;  1I3Q I;  2F4M A;  3GTL I;  4A3F I;  3HOY I;  4QTU A;  1TFI A;  1RLY A;  3M4O I;  3S17 I;  2JA5 I;  3S2D I;  2J6A A;  4BBS I;  2NVX I;  4BY1 I;  1N2F A;  2BJO A;  1Y1V S;  3LUS A;  2E2H I;  4NBD A;  1PFT A;  1ZB9 A;  3GTM I;  3H3V J;  3GCF A;  3U50 C;  1USP B;  1QYP A;  1SFO I;  3GTO I;  3M3Y I;  4A3C I;  4A3K I;  1USP A;  3GTQ I;  3HOV I;  3GKQ A;  4A3G I;  2JA8 I;  4BXX I; 
#chains in the Genus database with same CATH topology
 4A3B I;  4NFR A;  1YIT Z;  1I6H I;  2R7Z I;  3CXC Y;  5T67 A;  3CCJ Z;  2QRC B;  2V8I A;  1Y1W I;  2E7Z A;  1VQ5 1;  1RO0 A;  1VQL 1;  3I56 1;  5T6B A;  2JS4 A;  4DK1 A;  2OTL 1;  1RO4 A;  5FLX b;  1VQM 1;  4MH4 A;  1QXF A;  3PO3 S;  1VQ5 Z;  3J7A 4;  3CCU 1;  1VQL Z;  2QR1 B;  1W2B Z;  2JIQ A;  2IV2 X;  3I56 Z;  2K3R A;  2OTL Z;  1VQM Z;  2Y0S A;  4NBA A;  3FQM A;  1Z03 A;  3CCU Z;  3S1M I;  4CL1 A;  4A3D I;  2LEX A;  1AA6 A;  4RVG A;  4Y7N I;  1K8A 1;  2P28 A;  2JR6 A;  3NFZ A;  3CC7 1;  3QWU A;  3EER A;  2KPI A;  2PMZ A;  3GTM S;  4DGL A;  3PO3 I;  5A2Q f;  1VQ9 1;  2AKL A;  4NBE A;  1RNI A;  3GTP I;  3HOU I;  4A3M I;  4E2W A;  1FDI A;  2IZ3 A;  1VQ9 Z;  2E2J I;  3CCS 1;  3JAM b;  2YU9 I;  1X0T A;  1FDO A;  1KRL A;  3VMG A;  3S16 I;  3S14 I;  3CCL 1;  3CD6 Z;  4A3F I;  1KD1 2;  4E31 A;  4QTU A;  2RIQ A;  2OOX B;  3BG0 B;  2QRD B;  3CCL Z;  3P5J B;  2AYD A;  4RVD A;  5D1P A;  3GTM I;  3U50 C;  2G2K A;  1NJI 2;  3CCM 1;  3M3Y I;  4A3K I;  2M6N A;  2EGT A;  1Z02 A;  3HOV I;  1Q81 1;  3I4M I;  2R6M A;  5C3E I;  4HGZ A;  3CCM Z;  5IP7 I;  5AN9 F;  4HGY A;  1VQ6 1;  2E2I I;  5T64 A;  1WCM I;  1X3W A;  1VLA A;  2PM9 A;  4XX2 A;  2HF1 A;  1TWG I;  1VQK 1;  1VQ6 Z;  3CCQ 1;  3NH5 A;  2F4O A;  2GTI A;  2VF1 A;  3CCV 1;  1K83 I;  1VQK Z;  3S2H I;  3CCQ Z;  2QRE B;  3J80 f;  3CPW Z;  3K7A I;  1KD1 1;  3PO2 I;  3IFU A;  3CCV Z;  2JIP A;  1VQ4 1;  4A3I I;  1JJ2 Y;  2H85 A;  4NB9 A;  4A3J I;  2V3V A;  4MRI A;  2QKD A;  3BG1 B;  2R93 I;  3NDJ A;  1WW9 A;  5FLM I;  4RV9 A;  1SIW A;  1VQ4 Z;  3I4N I;  1NJI 1;  3KIF A;  3NDI A;  3S1N I;  3IX0 A;  4NBF A;  1L1O C;  2JIO A;  4MD7 A;  4A3E I;  2QEX 1;  3ESW A;  1WII A;  3VMH A;  3G4S 1;  1I50 I;  3IF8 A;  1KQS Y;  4EWC A;  1DL6 A;  2RBL A;  2JNY A;  3Q87 A;  2V8J A;  4QTT A;  5CM2 M;  1WJ2 A;  1Q86 2;  3RZO I;  2DE7 A;  2VPZ A;  4TNU A;  1QVG Y;  2QEX Z;  2JA6 I;  1Q16 A;  4AYB A;  1Q81 2;  1YJW 1;  1KC8 2;  4E2Z A;  1I3Q I;  1K9M 2;  2F4M A;  2WB1 A;  2HU9 A;  1YJW Z;  2NVX I;  1N2F A;  3LUS A;  1Y1V S;  2M48 A;  1ZB9 A;  3CC7 Z;  3H3V J;  2W04 A;  3GTO I;  2VPX A;  2JIM A;  1NP6 A;  1S72 1;  3GTQ I;  1RO2 A;  3KIH A;  1Q7Y 2;  1N8R 1;  1YI2 1;  4BXX I;  4X6A I;  1W2B Y;  2P3Y A;  3G71 1;  3GTJ I;  1VQP 1;  1S7M A;  1Q82 2;  4E32 A;  1S72 Z;  3CCS Z;  4BBR I;  3HOW I;  1JWH C;  5C4X I;  1NUI A;  4E30 A;  2DE6 A;  5IP9 I;  3G71 Z;  1VQP Z;  3D2L A;  3OW2 Z;  1QVF Z;  3MZK B;  1YIJ 1;  1TWA I;  1YHQ 1;  4NBC A;  3FKI I;  5IT9 f;  3MZL B;  1Y1V I;  1Q86 1;  2W03 A;  3I07 A;  3CMA 1;  5A2Q b;  3VMI A;  3NH8 A;  2NVT I;  4RS4 A;  1TWF I;  1YIJ Z;  1YHQ Z;  4NH1 C;  3MON A;  1KC8 1;  3CXC Z;  2VPY A;  3CMA Z;  2WAQ A;  5C44 I;  1Z01 A;  2LIY A;  1K9M 1;  3HKZ A;  1Y8C A;  4NOZ A;  1JJ2 Z;  1P9N A;  3NH4 A;  3GTG I;  3IR7 A;  4NB8 A;  3CME 1;  2DE5 A;  1TWH I;  5FLX f;  1Q7Y 1;  2RHB A;  3HOX I;  4A3L I;  1VQN 1;  4NBB A;  5IT9 b;  1Q82 1;  2Q51 A;  3CME Z;  2GTH A;  3EED A;  4RVH A;  3RZD I;  3CCE 1;  2KI7 B;  3HOZ I;  1VQN Z;  1N8R 2;  1M90 1;  2JMO A;  3CCE Z;  2Q4Z A;  3GTL I;  3HOY I;  1RLY A;  2JA5 I;  2QA4 1;  1M1K 2;  2LFU A;  4BY1 I;  2E2H I;  1RQF A;  1YJ9 1;  1PFT A;  1USP B;  1SFO I;  1YUK A;  2QA4 Z;  4A3C I;  3T4N B;  3J81 f;  1USP A;  2VPW A;  3G4S Z;  2OZK A;  3J80 b;  3GKQ A;  4A3G I;  1YJ9 Z;  2JA8 I;  1K73 2;  3D9X A;  4MD8 A;  2R92 I;  2RPR A;  2GU2 A;  3G6E 1;  2B63 I;  3JAM f;  3CPW Y;  4DQY B;  2PK7 A;  1LQL A;  2RT9 A;  1ML8 A;  3F3P C;  1WZN A;  1X3Z A;  1ZB8 A;  3FQQ A;  3G6E Z;  2JA7 I;  3I55 1;  3F3F C;  3CC2 1;  1QF8 A;  2K5R A;  2O53 A;  1R9T I;  2V45 A;  2YAD A;  4E2Y A;  4HH4 A;  4NBH A;  3VTN A;  3I55 Z;  4E33 A;  3CC2 Z;  4Y52 I;  3VB9 A;  4MXU A;  3J81 b;  2QLV B;  2IZ4 A;  2NAP A;  1YI2 Z;  3S15 I;  2V8K A;  4A93 I;  1M1K 1;  3TDH B;  2JUB A;  2NVY I;  3CD6 1;  3D6W A;  3S1Q I;  1M90 2;  4E2X A;  1VQ8 1;  1YUA A;  1TWC I;  4MON A;  5C4J I;  1VQO 1;  2OTJ 1;  1K73 1;  2OOY B;  3TE5 B;  3GTK I;  3H0G I;  1VQ8 Z;  2I3C A;  4S1T A;  3CQZ I;  4NBG A;  1VQO Z;  2OTJ Z;  4MD9 A;  2VUM I;  4BY7 I;  3S1R I;  5D1O B;  3CC4 1;  2NVQ I;  3CCR 1;  5D1O A;  2E9H A;  2ZAE B;  3M4O I;  1TFI A;  3S17 I;  2JIR A;  3S2D I;  2J6A A;  4BBS I;  2O4H A;  1VQ7 1;  1KQS Z;  3CC4 Z;  4RVF A;  2BJO A;  2VUG A;  3CCR Z;  4NBD A;  1YJN 1;  3OW2 Y;  3GCF A;  5LL6 f;  1YIT 1;  1QVF Y;  1QVG Z;  1QYP A;  1K8A 2;  1VQ7 Z;  3CCJ 1;  1ZH1 A;  1YJN Z; 
#chains in the Genus database with same CATH homology
 4A3B I;  4NFR A;  1YIT Z;  1I6H I;  2R7Z I;  3CXC Y;  5T67 A;  3CCJ Z;  2QRC B;  2V8I A;  1Y1W I;  1VQ5 1;  1RO0 A;  1VQL 1;  3I56 1;  5T6B A;  2JS4 A;  4DK1 A;  2OTL 1;  1RO4 A;  5FLX b;  1VQM 1;  4MH4 A;  3PO3 S;  1VQ5 Z;  3J7A 4;  3CCU 1;  1VQL Z;  2QR1 B;  1W2B Z;  3I56 Z;  2K3R A;  2OTL Z;  1VQM Z;  2Y0S A;  4NBA A;  3FQM A;  1Z03 A;  3CCU Z;  3S1M I;  4CL1 A;  4A3D I;  4RVG A;  4Y7N I;  1K8A 1;  2P28 A;  2JR6 A;  3NFZ A;  3CC7 1;  3QWU A;  3EER A;  2KPI A;  2PMZ A;  3GTM S;  4DGL A;  3PO3 I;  5A2Q f;  1VQ9 1;  2AKL A;  4NBE A;  1RNI A;  3GTP I;  3HOU I;  4A3M I;  4E2W A;  2IZ3 A;  1VQ9 Z;  2E2J I;  3CCS 1;  3JAM b;  2YU9 I;  1X0T A;  1KRL A;  3VMG A;  3S16 I;  3S14 I;  3CCL 1;  3CD6 Z;  4A3F I;  1KD1 2;  4E31 A;  4QTU A;  2RIQ A;  2OOX B;  3BG0 B;  2QRD B;  3CCL Z;  3P5J B;  4RVD A;  5D1P A;  3GTM I;  3U50 C;  2G2K A;  1NJI 2;  3CCM 1;  3M3Y I;  4A3K I;  2M6N A;  2EGT A;  1Z02 A;  3HOV I;  1Q81 1;  3I4M I;  2R6M A;  5C3E I;  4HGZ A;  3CCM Z;  5IP7 I;  5AN9 F;  4HGY A;  1VQ6 1;  2E2I I;  5T64 A;  1WCM I;  1X3W A;  1VLA A;  2PM9 A;  4XX2 A;  2HF1 A;  1TWG I;  1VQK 1;  1VQ6 Z;  3CCQ 1;  3NH5 A;  2F4O A;  2GTI A;  2VF1 A;  3CCV 1;  1K83 I;  1VQK Z;  3S2H I;  3CCQ Z;  2QRE B;  3J80 f;  3CPW Z;  3K7A I;  1KD1 1;  3PO2 I;  3IFU A;  3CCV Z;  1VQ4 1;  4A3I I;  1JJ2 Y;  2H85 A;  4NB9 A;  4A3J I;  4MRI A;  2QKD A;  3BG1 B;  2R93 I;  3NDJ A;  1WW9 A;  5FLM I;  4RV9 A;  1VQ4 Z;  3I4N I;  1NJI 1;  3KIF A;  3NDI A;  3S1N I;  3IX0 A;  4NBF A;  1L1O C;  4MD7 A;  4A3E I;  2QEX 1;  3ESW A;  1WII A;  3VMH A;  3G4S 1;  1I50 I;  3IF8 A;  1KQS Y;  4EWC A;  1DL6 A;  2RBL A;  2JNY A;  3Q87 A;  2V8J A;  4QTT A;  5CM2 M;  1Q86 2;  3RZO I;  2DE7 A;  4TNU A;  1QVG Y;  2QEX Z;  2JA6 I;  4AYB A;  1Q81 2;  1YJW 1;  1KC8 2;  4E2Z A;  1I3Q I;  1K9M 2;  2F4M A;  2WB1 A;  2HU9 A;  1YJW Z;  2NVX I;  1N2F A;  3LUS A;  1Y1V S;  2M48 A;  1ZB9 A;  3CC7 Z;  3H3V J;  2W04 A;  3GTO I;  1NP6 A;  1S72 1;  3GTQ I;  1RO2 A;  3KIH A;  1Q7Y 2;  1N8R 1;  1YI2 1;  4BXX I;  4X6A I;  1W2B Y;  2P3Y A;  3G71 1;  3GTJ I;  1VQP 1;  1S7M A;  1Q82 2;  4E32 A;  1S72 Z;  3CCS Z;  4BBR I;  3HOW I;  1JWH C;  5C4X I;  1NUI A;  4E30 A;  2DE6 A;  5IP9 I;  3G71 Z;  1VQP Z;  3OW2 Z;  1QVF Z;  3MZK B;  1YIJ 1;  1TWA I;  1YHQ 1;  4NBC A;  3FKI I;  5IT9 f;  3MZL B;  1Y1V I;  1Q86 1;  2W03 A;  3I07 A;  3CMA 1;  5A2Q b;  3VMI A;  3NH8 A;  2NVT I;  4RS4 A;  1TWF I;  1YIJ Z;  1YHQ Z;  4NH1 C;  3MON A;  1KC8 1;  3CXC Z;  3CMA Z;  2WAQ A;  5C44 I;  1Z01 A;  2LIY A;  1K9M 1;  3HKZ A;  4NOZ A;  1JJ2 Z;  1P9N A;  3NH4 A;  3GTG I;  4NB8 A;  3CME 1;  2DE5 A;  1TWH I;  5FLX f;  1Q7Y 1;  2RHB A;  3HOX I;  4A3L I;  1VQN 1;  4NBB A;  5IT9 b;  1Q82 1;  2Q51 A;  3CME Z;  2GTH A;  3EED A;  4RVH A;  3RZD I;  3CCE 1;  2KI7 B;  3HOZ I;  1VQN Z;  1N8R 2;  1M90 1;  2JMO A;  3CCE Z;  2Q4Z A;  3GTL I;  3HOY I;  1RLY A;  2JA5 I;  2QA4 1;  1M1K 2;  2LFU A;  4BY1 I;  2E2H I;  1RQF A;  1YJ9 1;  1PFT A;  1USP B;  1SFO I;  1YUK A;  2QA4 Z;  4A3C I;  3T4N B;  3J81 f;  1USP A;  3G4S Z;  2OZK A;  3J80 b;  3GKQ A;  4A3G I;  1YJ9 Z;  2JA8 I;  1K73 2;  3D9X A;  4MD8 A;  2R92 I;  2RPR A;  2GU2 A;  3G6E 1;  2B63 I;  3JAM f;  3CPW Y;  4DQY B;  2PK7 A;  1LQL A;  2RT9 A;  1ML8 A;  3F3P C;  1X3Z A;  1ZB8 A;  3FQQ A;  3G6E Z;  2JA7 I;  3I55 1;  3F3F C;  3CC2 1;  1QF8 A;  2K5R A;  2O53 A;  1R9T I;  2YAD A;  4E2Y A;  4HH4 A;  4NBH A;  3VTN A;  3I55 Z;  4E33 A;  3CC2 Z;  4Y52 I;  3VB9 A;  4MXU A;  3J81 b;  2QLV B;  2IZ4 A;  1YI2 Z;  3S15 I;  2V8K A;  4A93 I;  1M1K 1;  3TDH B;  2JUB A;  2NVY I;  3CD6 1;  3D6W A;  3S1Q I;  1M90 2;  4E2X A;  1VQ8 1;  1YUA A;  1TWC I;  4MON A;  5C4J I;  1VQO 1;  2OTJ 1;  1K73 1;  2OOY B;  3TE5 B;  3GTK I;  3H0G I;  1VQ8 Z;  2I3C A;  4S1T A;  3CQZ I;  4NBG A;  1VQO Z;  2OTJ Z;  4MD9 A;  2VUM I;  4BY7 I;  3S1R I;  5D1O B;  3CC4 1;  2NVQ I;  3CCR 1;  5D1O A;  2E9H A;  2ZAE B;  3M4O I;  1TFI A;  3S17 I;  3S2D I;  2J6A A;  4BBS I;  2O4H A;  1VQ7 1;  1KQS Z;  3CC4 Z;  4RVF A;  2BJO A;  2VUG A;  3CCR Z;  4NBD A;  1YJN 1;  3OW2 Y;  3GCF A;  5LL6 f;  1YIT 1;  1QVF Y;  1QVG Z;  1QYP A;  1K8A 2;  1VQ7 Z;  3CCJ 1;  1ZH1 A;  1YJN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...