4BY1I

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by1I02
2E2II 1R9TI 4NB9A 3GTMS 4A3GI 3K7AI 1VLAA 2YU9I 3GTGI 3S16I 3GTMI 1TWGI 2NVTI 5CM2M 1NUIA 3H0GI 4NBAA 3HOUI 2R93I 3HOXI 3PO2I 3S15I 2F4OA 1ZB8A 4NBHA 1PFTA 2JA5I 3GTKI 2JNYA 3U50C 1WCMI 5IP9I 2JA7I 1Y1WI 2JA6I 4A3MI 4NBDA 1USPB 2DE5A 4NBBA 1I3QI 5C4JI 4X6AI 3S17I 3S1QI 1WW9A 3GTPI 4BBRI 3GKQA 1TWHI 2E2HI 1YUAA 3S14I 2P3YA 4A3EI 2AKLA 3I4MI 3H3VJ 1L1OC 3PO3S 4A3JI 4A3FI 1RO4A 4NBEA 2BJOA 3M4OI 2K5RA 4BY1I 3PO3I 3HOVI 3GTQI 4BY7I 1N2FA 2JS4A 4A3LI 4NBFA 5C44I 2NVQI 3D6WA 4NBCA 3Q87A 1SFOI 2B63I 4NBGA 4QTTA 2E2JI 4Y7NI 4A3BI 5FLMI 1I50I 3GTLI 1K83I 5IP7I 1RLYA 3ESWA 2JA8I 2R92I 3S2DI 3VMGA 1TWFI 1TWCI 3LUSA 3CQZI 2KPIA 1USPA 4BBSI 4Y52I 3M3YI 1X3ZA 3S1NI 2HF1A 3HOYI 2NVXI 5C4XI 4A93I 1ZB9A 1DL6A 4A3II 3S1RI 1Y1VS 2J6AA 4NOZA 4A3KI 3VMHA 3GTOI 2NVYI 2RBLA 3RZOI 3RZDI 1QYPA 2JR6A 2DE6A 3GTJI 1Y1VI 2VUMI 3VMIA 3S1MI 1LQLA 1I6HI 3I4NI 5C3EI 3HOZI 4BXXI 2PK7A 2F4MA 1TFIA 3VB9A 1TWAI 3GCFA 3I07A 1X3WA 4A3DI 3FKII 4MH4A 4QTUA 1ML8A 2R7ZI 4NB8A 3S2HI 4XX2A 2DE7A 3HOWI 3EERA 4A3CI
chains in the Genus database with same CATH superfamily
1R9TI 3GTMS 2JUBA 3NH8A 3GTMI 1NUIA 3MZKB 1YI21 2VF1A 1VQK1 2W03A 3J80f 3D9XA 3CCV1 3TDHB 3PO2I 1KRLA 4E2WA 3GTKI 1VQ91 3CC4Z 4A3MI 4MD8A 3S17I 1QXFA 3S14I 2AKLA 2M48A 4NBEA 2OTL1 2BJOA 2K5RA 1NP6A 4BY7I 2JS4A 4A3LI 1VQP1 1YJ9Z 1YIT1 1YHQZ 5IT9b 1VQ51 2OOXB 4NBGA 2JMOA 3EEDA 3CCQ1 1M901 1S72Z 2E2JI 5D1OB 4NFRA 1K83I 2JIRA 2R92I 3LUSA 3CQZI 4Y52I 3HKZA 1JJ2Y 1VQ6Z 1X3ZA 2HF1A 3CC71 1RQFA 3QWUA 2OZKA 3CCSZ 3CCLZ 1YJWZ 2ZAEB 1DL6A 2VPZA 1Y1VS 3GTOI 3MZLB 2RBLA 3G6E1 1KC81 4RVFA 1Z03A 1Y1VI 2OTJZ 3S1MI 1LQLA 1YI2Z 3CPWY 2AYDA 4EWCA 3CCVZ 3D2LA 1YUKA 1TFIA 2QEX1 1N8R1 1N8R2 4DQYB 2JIMA 1WZNA 3CCJZ 3JAMb 3CC2Z 2K3RA 4NB8A 3CXCZ 5FLXf 5D1OA 2P28A 4MD7A 3CMA1 3GTGI 2O53A 2YU9I 1JWHC 4NH1C 1YJN1 2HU9A 2NVTI 2OTLZ 4E2YA 3FQMA 1PFTA 2M6NA 3I551 2RIQA 1I3QI 2V8JA 3NFZA 3CCM1 4BBRI 2E2HI 1K9M1 1K9M2 4A3EI 3I4MI 1Q7Y1 4A3JI 4RV9A 2QA41 1Q862 1Q861 1VQ4Z 4BY1I 3GTQI 1RO0A 2IV2X 2EGTA 3G4S1 2QR1B 5A2Qf 3CC7Z 2NVQI 3D6WA 5LL6f 1YIJ1 1NJI1 3I561 1W2BZ 4CL1A 3CCUZ 3TE5B 2Q51A 1Y8CA 4A3BI 1Q821 3GTLI 1VQLZ 1RLYA 3S2DI 3VMGA 1TWCI 1AA6A 1QVGZ 3CD61 1VQOZ 4RVGA 4E2ZA 3HOYI 3F3FC 2QRCB 5C4XI 4A93I 1Z02A 4A3II 4MD9A 2I3CA 3RZOI 3VMHA 5AN9F 3RZDI 1QYPA 1M902 2V8KA 3GTJI 3F3PC 2Y0SA 1I6HI 4E30A 1P9NA 2GU2A 2PK7A 2F4MA 4MRIA 1X0TA 1VQMZ 4A3DI 2GTIA 4MH4A 4QTUA 2R7ZI 1VQ71 3S2HI 1VQ81 3CCR1 2WAQA 3HOWI 4A3CI 2WB1A 3CCMZ 1Q811 5FLXb 1Q812 4NB9A 2LIYA 3CME1 1Q16A 4A3GI 1RNIA 3S16I 1KC82 1TWGI 1QVFZ 3BG1B 4NBAA 3HOUI 1VQKZ 2W04A 2R93I 5IT9f 3HOXI 3P5JB 3CC41 1VQ9Z 2JA7I 1Y1WI 2JA6I 3I56Z 4HGZA 1USPB 2E9HA 4NBBA 2PMZA 4S1TA 5C4JI 4X6AI 4TNUA 3S1QI 3GTPI 4E31A 3BG0B 3CXCY 5D1PA 3OW2Z 1S7MA 1YUAA 3PO3S 1RO4A 3M4OI 3J7A4 3PO3I 3HOVI 2JIOA 1KD11 1N2FA 1YJ91 1VQPZ 1KQSZ 2YADA 3J80b 1YHQ1 3IR7A 1VQN1 1YITZ 2GTHA 3KIFA 2VPYA 1VQ5Z 4HGYA 2R6MA 3Q87A 2B63I 2H85A 2JIQA 2QLVB 1S721 3CCQZ 2V45A 4QTTA 4Y7NI 2RPRA 1I50I 1ZH1A 4E32A 1Q7Y2 2E7ZA 3G711 1TWFI 2VPXA 1USPA 1K731 4E33A 2VPWA 1M1K1 1M1K2 2NVXI 3CCS1 3CCE1 4MONA 3CCL1 5T64A 1YJW1 3CCRZ 3IFUA 1NJI2 4RVDA 3S1RI 1Z01A 3CMEZ 3G6EZ 1W2BY 2OTJ1 2DE6A 3T4NB 3VMIA 3I4NI 5C3EI 1Q822 3HOZI 3VTNA 3J81f 2QEXZ 3CCJ1 3I07A 1X3WA 3CC21 1QVGY 2NAPA 2DE7A 3EERA 3NDJA 2LFUA 2E2II 2G2KA 4HH4A 3K7AI 1VLAA 3CMAZ 2V3VA 4RS4A 3NH4A 1YJNZ 2PM9A 5CM2M 3H0GI 3S15I 2F4OA 1ZB8A 4NBHA 4RVHA 1VQNZ 2JA5I 2JNYA 2RHBA 1WCMI 3U50C 5IP9I 3I55Z 4NBDA 4DK1A 2DE5A 2IZ3A 1WW9A 3GKQA 1TWHI 3MONA 2P3YA 3H3VJ 1L1OC 4A3FI 1VQ41 2QA4Z 1JJ2Z 3G71Z 1QVFY 4MXUA 2LEXA 4AYBA 2Q4ZA 4NBFA 3IX0A 3G4SZ 3FQQA 5C44I 3NDIA 3CCEZ 5T6BA 4NBCA 1YIJZ 5T67A 1SFOI 4E2XA 1QF8A 1RO2A 3CCU1 3CPWZ 1FDIA 1WIIA 2JIPA 5FLMI 1VQL1 3KIHA 5IP7I 3ESWA 3OW2Y 2JA8I 3NH5A 1WJ2A 2KPIA 1KD12 1VQO1 4BBSI 3CD6Z 3M3YI 3S1NI 2OOYB 3IF8A 1KQSY 1ZB9A 5A2Qb 2VUGA 2IZ4A 2J6AA 4NOZA 4A3KI 2NVYI 2RT9A 2JR6A 2QREB 2VUMI 2QRDB 2V8IA 1K8A1 1K8A2 4BXXI 1VQM1 3VB9A 3JAMf 1TWAI 3GCFA 2QKDA 3J81b 2KI7B 1K732 1VQ61 3FKII 1ML8A 2O4HA 1VQ7Z 4DGLA 1FDOA 1VQ8Z 4XX2A 1SIWA
chains in the Genus database with same CATH topology
1R9TI 3GTMS 2JUBA 3NH8A 3GTMI 1NUIA 3MZKB 1YI21 2VF1A 1VQK1 2W03A 3J80f 3D9XA 3CCV1 3TDHB 3PO2I 1KRLA 4E2WA 3GTKI 1VQ91 3CC4Z 4A3MI 4MD8A 3S17I 3S14I 2AKLA 2M48A 4NBEA 2OTL1 2BJOA 2K5RA 1NP6A 4BY7I 2JS4A 4A3LI 1VQP1 1YJ9Z 1YIT1 1YHQZ 5IT9b 1VQ51 2OOXB 4NBGA 2JMOA 3EEDA 3CCQ1 1M901 1S72Z 2E2JI 5D1OB 4NFRA 1K83I 2R92I 3LUSA 3CQZI 4Y52I 3HKZA 1JJ2Y 1VQ6Z 1X3ZA 2HF1A 3CC71 1RQFA 3QWUA 2OZKA 3CCSZ 3CCLZ 1YJWZ 2ZAEB 1DL6A 1Y1VS 3GTOI 3MZLB 2RBLA 3G6E1 1KC81 4RVFA 1Z03A 1Y1VI 2OTJZ 3S1MI 1LQLA 1YI2Z 3CPWY 4EWCA 3CCVZ 1YUKA 1TFIA 2QEX1 1N8R1 1N8R2 4DQYB 3CCJZ 3JAMb 3CC2Z 2K3RA 4NB8A 3CXCZ 5FLXf 5D1OA 2P28A 4MD7A 3CMA1 3GTGI 2O53A 2YU9I 1JWHC 4NH1C 1YJN1 2HU9A 2NVTI 2OTLZ 4E2YA 3FQMA 1PFTA 2M6NA 3I551 2RIQA 1I3QI 2V8JA 3NFZA 3CCM1 4BBRI 2E2HI 1K9M1 1K9M2 4A3EI 3I4MI 1Q7Y1 4A3JI 4RV9A 2QA41 1Q862 1Q861 1VQ4Z 4BY1I 3GTQI 1RO0A 2EGTA 3G4S1 2QR1B 5A2Qf 3CC7Z 2NVQI 3D6WA 5LL6f 1YIJ1 1NJI1 3I561 1W2BZ 4CL1A 3CCUZ 3TE5B 2Q51A 4A3BI 1Q821 3GTLI 1VQLZ 1RLYA 3S2DI 3VMGA 1TWCI 1QVGZ 3CD61 1VQOZ 4RVGA 4E2ZA 3HOYI 3F3FC 2QRCB 5C4XI 4A93I 1Z02A 4A3II 4MD9A 2I3CA 3RZOI 3VMHA 5AN9F 3RZDI 1QYPA 1M902 2V8KA 3GTJI 3F3PC 2Y0SA 1I6HI 4E30A 1P9NA 2GU2A 2PK7A 2F4MA 4MRIA 1X0TA 1VQMZ 4A3DI 2GTIA 4MH4A 4QTUA 2R7ZI 1VQ71 3S2HI 1VQ81 3CCR1 2WAQA 3HOWI 4A3CI 2WB1A 3CCMZ 1Q811 5FLXb 1Q812 4NB9A 2LIYA 3CME1 4A3GI 1RNIA 3S16I 1KC82 1TWGI 1QVFZ 3BG1B 4NBAA 3HOUI 1VQKZ 2W04A 2R93I 5IT9f 3HOXI 3P5JB 3CC41 1VQ9Z 2JA7I 1Y1WI 2JA6I 3I56Z 4HGZA 1USPB 2E9HA 4NBBA 2PMZA 4S1TA 5C4JI 4X6AI 4TNUA 3S1QI 3GTPI 4E31A 3BG0B 3CXCY 5D1PA 3OW2Z 1S7MA 1YUAA 3PO3S 1RO4A 3M4OI 3J7A4 3PO3I 3HOVI 1KD11 1N2FA 1YJ91 1VQPZ 1KQSZ 2YADA 3J80b 1YHQ1 1VQN1 1YITZ 2GTHA 3KIFA 1VQ5Z 4HGYA 2R6MA 3Q87A 2B63I 2H85A 2QLVB 1S721 3CCQZ 4QTTA 4Y7NI 2RPRA 1I50I 1ZH1A 4E32A 1Q7Y2 3G711 1TWFI 1USPA 1K731 4E33A 1M1K1 1M1K2 2NVXI 3CCS1 3CCE1 4MONA 3CCL1 5T64A 1YJW1 3CCRZ 3IFUA 1NJI2 4RVDA 3S1RI 1Z01A 3CMEZ 3G6EZ 1W2BY 2OTJ1 2DE6A 3T4NB 3VMIA 3I4NI 5C3EI 1Q822 3HOZI 3VTNA 3J81f 2QEXZ 3CCJ1 3I07A 1X3WA 3CC21 1QVGY 2DE7A 3EERA 3NDJA 2LFUA 2E2II 2G2KA 4HH4A 3K7AI 1VLAA 3CMAZ 4RS4A 3NH4A 1YJNZ 2PM9A 5CM2M 3H0GI 3S15I 2F4OA 1ZB8A 4NBHA 4RVHA 1VQNZ 2JA5I 2JNYA 2RHBA 1WCMI 3U50C 5IP9I 3I55Z 4NBDA 4DK1A 2DE5A 2IZ3A 1WW9A 3GKQA 1TWHI 3MONA 2P3YA 3H3VJ 1L1OC 4A3FI 1VQ41 2QA4Z 1JJ2Z 3G71Z 1QVFY 4MXUA 4AYBA 2Q4ZA 4NBFA 3IX0A 3G4SZ 3FQQA 5C44I 3NDIA 3CCEZ 5T6BA 4NBCA 1YIJZ 5T67A 1SFOI 4E2XA 1QF8A 1RO2A 3CCU1 3CPWZ 1WIIA 5FLMI 1VQL1 3KIHA 5IP7I 3ESWA 3OW2Y 2JA8I 3NH5A 2KPIA 1KD12 1VQO1 4BBSI 3CD6Z 3M3YI 3S1NI 2OOYB 3IF8A 1KQSY 1ZB9A 5A2Qb 2VUGA 2IZ4A 4A3KI 2J6AA 4NOZA 2NVYI 2RT9A 2JR6A 2QREB 2VUMI 2QRDB 2V8IA 1K8A1 1K8A2 4BXXI 1VQM1 3VB9A 3JAMf 1TWAI 3GCFA 2QKDA 3J81b 2KI7B 1K732 1VQ61 3FKII 1ML8A 2O4HA 1VQ7Z 4DGLA 1VQ8Z 4XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I I;  1R9T I;  4NB9 A;  3GTM S;  4A3G I;  3K7A I;  1VLA A;  2YU9 I;  3GTG I;  3S16 I;  3GTM I;  1TWG I;  2NVT I;  5CM2 M;  1NUI A;  3H0G I;  4NBA A;  3HOU I;  2R93 I;  3HOX I;  3PO2 I;  3S15 I;  2F4O A;  1ZB8 A;  4NBH A;  1PFT A;  2JA5 I;  3GTK I;  2JNY A;  3U50 C;  1WCM I;  5IP9 I;  2JA7 I;  1Y1W I;  2JA6 I;  4A3M I;  4NBD A;  1USP B;  2DE5 A;  4NBB A;  1I3Q I;  5C4J I;  4X6A I;  3S17 I;  3S1Q I;  1WW9 A;  3GTP I;  4BBR I;  3GKQ A;  1TWH I;  2E2H I;  1YUA A;  3S14 I;  2P3Y A;  4A3E I;  2AKL A;  3I4M I;  3H3V J;  1L1O C;  3PO3 S;  4A3J I;  4A3F I;  1RO4 A;  4NBE A;  2BJO A;  3M4O I;  2K5R A;  4BY1 I;  3PO3 I;  3HOV I;  3GTQ I;  4BY7 I;  1N2F A;  2JS4 A;  4A3L I;  4NBF A;  5C44 I;  2NVQ I;  3D6W A;  4NBC A;  3Q87 A;  1SFO I;  2B63 I;  4NBG A;  4QTT A;  2E2J I;  4Y7N I;  4A3B I;  5FLM I;  1I50 I;  3GTL I;  1K83 I;  5IP7 I;  1RLY A;  3ESW A;  2JA8 I;  2R92 I;  3S2D I;  3VMG A;  1TWF I;  1TWC I;  3LUS A;  3CQZ I;  2KPI A;  1USP A;  4BBS I;  4Y52 I;  3M3Y I;  1X3Z A;  3S1N I;  2HF1 A;  3HOY I;  2NVX I;  5C4X I;  4A93 I;  1ZB9 A;  1DL6 A;  4A3I I;  3S1R I;  1Y1V S;  2J6A A;  4NOZ A;  4A3K I;  3VMH A;  3GTO I;  2NVY I;  2RBL A;  3RZO I;  3RZD I;  1QYP A;  2JR6 A;  2DE6 A;  3GTJ I;  1Y1V I;  2VUM I;  3VMI A;  3S1M I;  1LQL A;  1I6H I;  3I4N I;  5C3E I;  3HOZ I;  4BXX I;  2PK7 A;  2F4M A;  1TFI A;  3VB9 A;  1TWA I;  3GCF A;  3I07 A;  1X3W A;  4A3D I;  3FKI I;  4MH4 A;  4QTU A;  1ML8 A;  2R7Z I;  4NB8 A;  3S2H I;  4XX2 A;  2DE7 A;  3HOW I;  3EER A;  4A3C I; 
#chains in the Genus database with same CATH topology
 1R9T I;  3GTM S;  2JUB A;  3NH8 A;  3GTM I;  1NUI A;  3MZK B;  1YI2 1;  2VF1 A;  1VQK 1;  2W03 A;  3J80 f;  3D9X A;  3CCV 1;  3TDH B;  3PO2 I;  1KRL A;  4E2W A;  3GTK I;  1VQ9 1;  3CC4 Z;  4A3M I;  4MD8 A;  3S17 I;  1QXF A;  3S14 I;  2AKL A;  2M48 A;  4NBE A;  2OTL 1;  2BJO A;  2K5R A;  1NP6 A;  4BY7 I;  2JS4 A;  4A3L I;  1VQP 1;  1YJ9 Z;  1YIT 1;  1YHQ Z;  5IT9 b;  1VQ5 1;  2OOX B;  4NBG A;  2JMO A;  3EED A;  3CCQ 1;  1M90 1;  1S72 Z;  2E2J I;  5D1O B;  4NFR A;  1K83 I;  2JIR A;  2R92 I;  3LUS A;  3CQZ I;  4Y52 I;  3HKZ A;  1JJ2 Y;  1VQ6 Z;  1X3Z A;  2HF1 A;  3CC7 1;  1RQF A;  3QWU A;  2OZK A;  3CCS Z;  3CCL Z;  1YJW Z;  2ZAE B;  1DL6 A;  2VPZ A;  1Y1V S;  3GTO I;  3MZL B;  2RBL A;  3G6E 1;  1KC8 1;  4RVF A;  1Z03 A;  1Y1V I;  2OTJ Z;  3S1M I;  1LQL A;  1YI2 Z;  3CPW Y;  2AYD A;  4EWC A;  3CCV Z;  3D2L A;  1YUK A;  1TFI A;  2QEX 1;  1N8R 1;  1N8R 2;  4DQY B;  2JIM A;  1WZN A;  3CCJ Z;  3JAM b;  3CC2 Z;  2K3R A;  4NB8 A;  3CXC Z;  5FLX f;  5D1O A;  2P28 A;  4MD7 A;  3CMA 1;  3GTG I;  2O53 A;  2YU9 I;  1JWH C;  4NH1 C;  1YJN 1;  2HU9 A;  2NVT I;  2OTL Z;  4E2Y A;  3FQM A;  1PFT A;  2M6N A;  3I55 1;  2RIQ A;  1I3Q I;  2V8J A;  3NFZ A;  3CCM 1;  4BBR I;  2E2H I;  1K9M 1;  1K9M 2;  4A3E I;  3I4M I;  1Q7Y 1;  4A3J I;  4RV9 A;  2QA4 1;  1Q86 2;  1Q86 1;  1VQ4 Z;  4BY1 I;  3GTQ I;  1RO0 A;  2IV2 X;  2EGT A;  3G4S 1;  2QR1 B;  5A2Q f;  3CC7 Z;  2NVQ I;  3D6W A;  5LL6 f;  1YIJ 1;  1NJI 1;  3I56 1;  1W2B Z;  4CL1 A;  3CCU Z;  3TE5 B;  2Q51 A;  1Y8C A;  4A3B I;  1Q82 1;  3GTL I;  1VQL Z;  1RLY A;  3S2D I;  3VMG A;  1TWC I;  1AA6 A;  1QVG Z;  3CD6 1;  1VQO Z;  4RVG A;  4E2Z A;  3HOY I;  3F3F C;  2QRC B;  5C4X I;  4A93 I;  1Z02 A;  4A3I I;  4MD9 A;  2I3C A;  3RZO I;  3VMH A;  5AN9 F;  3RZD I;  1QYP A;  1M90 2;  2V8K A;  3GTJ I;  3F3P C;  2Y0S A;  1I6H I;  4E30 A;  1P9N A;  2GU2 A;  2PK7 A;  2F4M A;  4MRI A;  1X0T A;  1VQM Z;  4A3D I;  2GTI A;  4MH4 A;  4QTU A;  2R7Z I;  1VQ7 1;  3S2H I;  1VQ8 1;  3CCR 1;  2WAQ A;  3HOW I;  4A3C I;  2WB1 A;  3CCM Z;  1Q81 1;  5FLX b;  1Q81 2;  4NB9 A;  2LIY A;  3CME 1;  1Q16 A;  4A3G I;  1RNI A;  3S16 I;  1KC8 2;  1TWG I;  1QVF Z;  3BG1 B;  4NBA A;  3HOU I;  1VQK Z;  2W04 A;  2R93 I;  5IT9 f;  3HOX I;  3P5J B;  3CC4 1;  1VQ9 Z;  2JA7 I;  1Y1W I;  2JA6 I;  3I56 Z;  4HGZ A;  1USP B;  2E9H A;  4NBB A;  2PMZ A;  4S1T A;  5C4J I;  4X6A I;  4TNU A;  3S1Q I;  3GTP I;  4E31 A;  3BG0 B;  3CXC Y;  5D1P A;  3OW2 Z;  1S7M A;  1YUA A;  3PO3 S;  1RO4 A;  3M4O I;  3J7A 4;  3PO3 I;  3HOV I;  2JIO A;  1KD1 1;  1N2F A;  1YJ9 1;  1VQP Z;  1KQS Z;  2YAD A;  3J80 b;  1YHQ 1;  3IR7 A;  1VQN 1;  1YIT Z;  2GTH A;  3KIF A;  2VPY A;  1VQ5 Z;  4HGY A;  2R6M A;  3Q87 A;  2B63 I;  2H85 A;  2JIQ A;  2QLV B;  1S72 1;  3CCQ Z;  2V45 A;  4QTT A;  4Y7N I;  2RPR A;  1I50 I;  1ZH1 A;  4E32 A;  1Q7Y 2;  2E7Z A;  3G71 1;  1TWF I;  2VPX A;  1USP A;  1K73 1;  4E33 A;  2VPW A;  1M1K 1;  1M1K 2;  2NVX I;  3CCS 1;  3CCE 1;  4MON A;  3CCL 1;  5T64 A;  1YJW 1;  3CCR Z;  3IFU A;  1NJI 2;  4RVD A;  3S1R I;  1Z01 A;  3CME Z;  3G6E Z;  1W2B Y;  2OTJ 1;  2DE6 A;  3T4N B;  3VMI A;  3I4N I;  5C3E I;  1Q82 2;  3HOZ I;  3VTN A;  3J81 f;  2QEX Z;  3CCJ 1;  3I07 A;  1X3W A;  3CC2 1;  1QVG Y;  2NAP A;  2DE7 A;  3EER A;  3NDJ A;  2LFU A;  2E2I I;  2G2K A;  4HH4 A;  3K7A I;  1VLA A;  3CMA Z;  2V3V A;  4RS4 A;  3NH4 A;  1YJN Z;  2PM9 A;  5CM2 M;  3H0G I;  3S15 I;  2F4O A;  1ZB8 A;  4NBH A;  4RVH A;  1VQN Z;  2JA5 I;  2JNY A;  2RHB A;  1WCM I;  3U50 C;  5IP9 I;  3I55 Z;  4NBD A;  4DK1 A;  2DE5 A;  2IZ3 A;  1WW9 A;  3GKQ A;  1TWH I;  3MON A;  2P3Y A;  3H3V J;  1L1O C;  4A3F I;  1VQ4 1;  2QA4 Z;  1JJ2 Z;  3G71 Z;  1QVF Y;  4MXU A;  2LEX A;  4AYB A;  2Q4Z A;  4NBF A;  3IX0 A;  3G4S Z;  3FQQ A;  5C44 I;  3NDI A;  3CCE Z;  5T6B A;  4NBC A;  1YIJ Z;  5T67 A;  1SFO I;  4E2X A;  1QF8 A;  1RO2 A;  3CCU 1;  3CPW Z;  1FDI A;  1WII A;  2JIP A;  5FLM I;  1VQL 1;  3KIH A;  5IP7 I;  3ESW A;  3OW2 Y;  2JA8 I;  3NH5 A;  1WJ2 A;  2KPI A;  1KD1 2;  1VQO 1;  4BBS I;  3CD6 Z;  3M3Y I;  3S1N I;  2OOY B;  3IF8 A;  1KQS Y;  1ZB9 A;  5A2Q b;  2VUG A;  2IZ4 A;  2J6A A;  4NOZ A;  4A3K I;  2NVY I;  2RT9 A;  2JR6 A;  2QRE B;  2VUM I;  2QRD B;  2V8I A;  1K8A 1;  1K8A 2;  4BXX I;  1VQM 1;  3VB9 A;  3JAM f;  1TWA I;  3GCF A;  2QKD A;  3J81 b;  2KI7 B;  1K73 2;  1VQ6 1;  3FKI I;  1ML8 A;  2O4H A;  1VQ7 Z;  4DGL A;  1FDO A;  1VQ8 Z;  4XX2 A;  1SIW A; 
#chains in the Genus database with same CATH homology
 1R9T I;  3GTM S;  2JUB A;  3NH8 A;  3GTM I;  1NUI A;  3MZK B;  1YI2 1;  2VF1 A;  1VQK 1;  2W03 A;  3J80 f;  3D9X A;  3CCV 1;  3TDH B;  3PO2 I;  1KRL A;  4E2W A;  3GTK I;  1VQ9 1;  3CC4 Z;  4A3M I;  4MD8 A;  3S17 I;  3S14 I;  2AKL A;  2M48 A;  4NBE A;  2OTL 1;  2BJO A;  2K5R A;  1NP6 A;  4BY7 I;  2JS4 A;  4A3L I;  1VQP 1;  1YJ9 Z;  1YIT 1;  1YHQ Z;  5IT9 b;  1VQ5 1;  2OOX B;  4NBG A;  2JMO A;  3EED A;  3CCQ 1;  1M90 1;  1S72 Z;  2E2J I;  5D1O B;  4NFR A;  1K83 I;  2R92 I;  3LUS A;  3CQZ I;  4Y52 I;  3HKZ A;  1JJ2 Y;  1VQ6 Z;  1X3Z A;  2HF1 A;  3CC7 1;  1RQF A;  3QWU A;  2OZK A;  3CCS Z;  3CCL Z;  1YJW Z;  2ZAE B;  1DL6 A;  1Y1V S;  3GTO I;  3MZL B;  2RBL A;  3G6E 1;  1KC8 1;  4RVF A;  1Z03 A;  1Y1V I;  2OTJ Z;  3S1M I;  1LQL A;  1YI2 Z;  3CPW Y;  4EWC A;  3CCV Z;  1YUK A;  1TFI A;  2QEX 1;  1N8R 1;  1N8R 2;  4DQY B;  3CCJ Z;  3JAM b;  3CC2 Z;  2K3R A;  4NB8 A;  3CXC Z;  5FLX f;  5D1O A;  2P28 A;  4MD7 A;  3CMA 1;  3GTG I;  2O53 A;  2YU9 I;  1JWH C;  4NH1 C;  1YJN 1;  2HU9 A;  2NVT I;  2OTL Z;  4E2Y A;  3FQM A;  1PFT A;  2M6N A;  3I55 1;  2RIQ A;  1I3Q I;  2V8J A;  3NFZ A;  3CCM 1;  4BBR I;  2E2H I;  1K9M 1;  1K9M 2;  4A3E I;  3I4M I;  1Q7Y 1;  4A3J I;  4RV9 A;  2QA4 1;  1Q86 2;  1Q86 1;  1VQ4 Z;  4BY1 I;  3GTQ I;  1RO0 A;  2EGT A;  3G4S 1;  2QR1 B;  5A2Q f;  3CC7 Z;  2NVQ I;  3D6W A;  5LL6 f;  1YIJ 1;  1NJI 1;  3I56 1;  1W2B Z;  4CL1 A;  3CCU Z;  3TE5 B;  2Q51 A;  4A3B I;  1Q82 1;  3GTL I;  1VQL Z;  1RLY A;  3S2D I;  3VMG A;  1TWC I;  1QVG Z;  3CD6 1;  1VQO Z;  4RVG A;  4E2Z A;  3HOY I;  3F3F C;  2QRC B;  5C4X I;  4A93 I;  1Z02 A;  4A3I I;  4MD9 A;  2I3C A;  3RZO I;  3VMH A;  5AN9 F;  3RZD I;  1QYP A;  1M90 2;  2V8K A;  3GTJ I;  3F3P C;  2Y0S A;  1I6H I;  4E30 A;  1P9N A;  2GU2 A;  2PK7 A;  2F4M A;  4MRI A;  1X0T A;  1VQM Z;  4A3D I;  2GTI A;  4MH4 A;  4QTU A;  2R7Z I;  1VQ7 1;  3S2H I;  1VQ8 1;  3CCR 1;  2WAQ A;  3HOW I;  4A3C I;  2WB1 A;  3CCM Z;  1Q81 1;  5FLX b;  1Q81 2;  4NB9 A;  2LIY A;  3CME 1;  4A3G I;  1RNI A;  3S16 I;  1KC8 2;  1TWG I;  1QVF Z;  3BG1 B;  4NBA A;  3HOU I;  1VQK Z;  2W04 A;  2R93 I;  5IT9 f;  3HOX I;  3P5J B;  3CC4 1;  1VQ9 Z;  2JA7 I;  1Y1W I;  2JA6 I;  3I56 Z;  4HGZ A;  1USP B;  2E9H A;  4NBB A;  2PMZ A;  4S1T A;  5C4J I;  4X6A I;  4TNU A;  3S1Q I;  3GTP I;  4E31 A;  3BG0 B;  3CXC Y;  5D1P A;  3OW2 Z;  1S7M A;  1YUA A;  3PO3 S;  1RO4 A;  3M4O I;  3J7A 4;  3PO3 I;  3HOV I;  1KD1 1;  1N2F A;  1YJ9 1;  1VQP Z;  1KQS Z;  2YAD A;  3J80 b;  1YHQ 1;  1VQN 1;  1YIT Z;  2GTH A;  3KIF A;  1VQ5 Z;  4HGY A;  2R6M A;  3Q87 A;  2B63 I;  2H85 A;  2QLV B;  1S72 1;  3CCQ Z;  4QTT A;  4Y7N I;  2RPR A;  1I50 I;  1ZH1 A;  4E32 A;  1Q7Y 2;  3G71 1;  1TWF I;  1USP A;  1K73 1;  4E33 A;  1M1K 1;  1M1K 2;  2NVX I;  3CCS 1;  3CCE 1;  4MON A;  3CCL 1;  5T64 A;  1YJW 1;  3CCR Z;  3IFU A;  1NJI 2;  4RVD A;  3S1R I;  1Z01 A;  3CME Z;  3G6E Z;  1W2B Y;  2OTJ 1;  2DE6 A;  3T4N B;  3VMI A;  3I4N I;  5C3E I;  1Q82 2;  3HOZ I;  3VTN A;  3J81 f;  2QEX Z;  3CCJ 1;  3I07 A;  1X3W A;  3CC2 1;  1QVG Y;  2DE7 A;  3EER A;  3NDJ A;  2LFU A;  2E2I I;  2G2K A;  4HH4 A;  3K7A I;  1VLA A;  3CMA Z;  4RS4 A;  3NH4 A;  1YJN Z;  2PM9 A;  5CM2 M;  3H0G I;  3S15 I;  2F4O A;  1ZB8 A;  4NBH A;  4RVH A;  1VQN Z;  2JA5 I;  2JNY A;  2RHB A;  1WCM I;  3U50 C;  5IP9 I;  3I55 Z;  4NBD A;  4DK1 A;  2DE5 A;  2IZ3 A;  1WW9 A;  3GKQ A;  1TWH I;  3MON A;  2P3Y A;  3H3V J;  1L1O C;  4A3F I;  1VQ4 1;  2QA4 Z;  1JJ2 Z;  3G71 Z;  1QVF Y;  4MXU A;  4AYB A;  2Q4Z A;  4NBF A;  3IX0 A;  3G4S Z;  3FQQ A;  5C44 I;  3NDI A;  3CCE Z;  5T6B A;  4NBC A;  1YIJ Z;  5T67 A;  1SFO I;  4E2X A;  1QF8 A;  1RO2 A;  3CCU 1;  3CPW Z;  1WII A;  5FLM I;  1VQL 1;  3KIH A;  5IP7 I;  3ESW A;  3OW2 Y;  2JA8 I;  3NH5 A;  2KPI A;  1KD1 2;  1VQO 1;  4BBS I;  3CD6 Z;  3M3Y I;  3S1N I;  2OOY B;  3IF8 A;  1KQS Y;  1ZB9 A;  5A2Q b;  2VUG A;  2IZ4 A;  4A3K I;  2J6A A;  4NOZ A;  2NVY I;  2RT9 A;  2JR6 A;  2QRE B;  2VUM I;  2QRD B;  2V8I A;  1K8A 1;  1K8A 2;  4BXX I;  1VQM 1;  3VB9 A;  3JAM f;  1TWA I;  3GCF A;  2QKD A;  3J81 b;  2KI7 B;  1K73 2;  1VQ6 1;  3FKI I;  1ML8 A;  2O4H A;  1VQ7 Z;  4DGL A;  1VQ8 Z;  4XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...