1QXFA

Solution structure of 30s ribosomal protein s27e from archaeoglobus fulgidus: gr2, a nesg target protein
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVDQIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords 30S RIBOSOMAL PROTEIN S27E
total genus 2
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.100 Mainly Beta Single Sheet N-terminal domain of TfIIb Zn-binding ribosomal proteins 1qxfA00
1QXFA
chains in the Genus database with same CATH superfamily
4E2WA 3G71Z 1VQOZ 2YADA 1YI2Z 4NBBA 3HOZI 1USPB 3RZOI 4MD9A 4E33A 1USPA 2JA5I 4DGLA 3IFUA 2RPRA 1S7MA 2JA6I 3CPWZ 2JUBA 4NOZA 4BY1I 1VQ5Z 2OOYB 1VQP1 1K8A1 2GU2A 3CCQZ 2AKLA 3HOUI 1DL6A 1YIT1 3BG0B 2QEXZ 2GTHA 4BBSI 2E2HI 4NBFA 2IV2X 2PMZA 2V45A 1JJ2Y 2E2II 1YJN1 4CL1A 5A2Qb 3GTJI 5T6BA 2V8KA 1L1OC 1VLAA 1Z03A 4NBCA 3GTQI 4NFRA 4A3CI 3CCL1 3CCLZ 1M902 3U50C 2E9HA 1VQ8Z 2WAQA 3CD6Z 4RS4A 1NJI2 4TNUA 3CC4Z 3NH4A 3S1MI 4BY7I 5FLMI 1Q811 2JA8I 3VMIA 1VQ41 2OTLZ 5LL6f 3S15I 1VQO1 2JS4A 3HOVI 3CCEZ 4A3FI 3GTGI 1M901 3EEDA 3S1RI 3TDHB 2JMOA 3M3YI 3D2LA 3CCUZ 4E2YA 4A3EI 4BBRI 5T64A 2M48A 2JNYA 4NBEA 4HGYA 1VQL1 1YHQZ 4MRIA 2RT9A 1S72Z 3FQQA 3I07A 3KIFA 3CME1 1TWAI 1ZH1A 1KD11 5FLXf 3GTKI 3FQMA 4MD7A 3CPWY 1YIJ1 4NB9A 1TFIA 3VTNA 2IZ3A 3CCRZ 2JIOA 4DK1A 3S1QI 3Q87A 3VMGA 3JAMb 2K3RA 4A3MI 1FDIA 4EWCA 4MONA 4Y7NI 5A2Qf 2HU9A 2DE7A 4NBDA 2B63I 2QA41 4A3JI 1K83I 1YJNZ 1RO0A 2LFUA 3GCFA 1VQ91 4E2ZA 5C3EI 1QVFY 3I55Z 4BXXI 1Q7Y1 2QKDA 3CCVZ 3CXCZ 3S14I 3CMEZ 2BJOA 3T4NB 3CCSZ 2O53A 2YU9I 1W2BY 3G4S1 3VMHA 1VQ71 3P5JB 1WW9A 1R9TI 4HH4A 3NH5A 2QEX1 1Z01A 2RBLA 3NDIA 2Q51A 2QA4Z 2VPXA 2R6MA 5CM2M 2JA7I 3F3FC 3S17I 1VQ4Z 1I6HI 4XX2A 1QF8A 4MH4A 1KC82 3M4OI 2P3YA 5C4JI 4E32A 2J6AA 3GTPI 4AYBA 1RO4A 2VPYA 3TE5B 3G6E1 2NAPA 1N2FA 1K9M2 3F3PC 3J80b 5IT9f 1K732 1Z02A 4QTUA 1VQNZ 1YJW1 1K9M1 2VPZA 3RZDI 1JJ2Z 3J80f 5IP7I 3VB9A 1KD12 1WJ2A 1WZNA 1TWFI 3PO2I 1NJI1 2RIQA 2JIQA 1YIJZ 3D6WA 4E30A 1KC81 2JIPA 1K731 1JWHC 3CCJZ 1Q861 1RLYA 2LEXA 1ML8A 1Y1VS 1M1K1 1VQMZ 3CCR1 1TWHI 3S2DI 2G2KA 2W03A 5C44I 1QVGY 1VQ7Z 2NVXI 2QRDB 4S1TA 2VF1A 3G4SZ 1VQPZ 3MONA 2IZ4A 2V8IA 1Q812 3CCU1 4A3GI 2QLVB 1Q821 3OW2Y 3CCV1 3J81b 1VQ51 5D1OB 1KRLA 2RHBA 4A3LI 4A3BI 3PO3S 5AN9F 1W2BZ 2WB1A 3HOWI 5C4XI 3HKZA 2QRCB 3CCMZ 2OTJZ 3CCM1 1VQ6Z 2OTJ1 5IT9b 2H85A 2KPIA 3GTMS 4E2XA 2W04A 1Y1VI 3CCJ1 1K8A2 2E2JI 4NB8A 1KQSZ 1X3WA 3D9XA 4RVGA 1VQN1 1Y8CA 1Q7Y2 3S2HI 2O4HA 3IR7A 3CMA1 4MXUA 1VQ81 2HF1A 4X6AI 1S721 1M1K2 3CCE1 3I56Z 2QR1B 4NBHA 1WIIA 3JAMf 2R93I 2JR6A 4A3DI 2DE5A 4NH1C 3CC71 3CC7Z 2JIRA 3NDJA 3GTMI 1NP6A 2M6NA 3EERA 1P9NA 4HGZA 3GTOI 1N8R2 1VQ9Z 3MZLB 5IP9I 3CD61 1X0TA 3I4MI 2OOXB 3CCQ1 1VQM1 1VQ61 1FDOA 3PO3I 4E31A 3CCS1 1N8R1 5FLXb 1VQKZ 2NVQI 3K7AI 3BG1B 4RVFA 2R92I 1I50I 3J81f 1X3ZA 1YJWZ 2K5RA 3IX0A 3CQZI 1VQLZ 3CC21 1LQLA 4DQYB 3IF8A 1NUIA 1RO2A 1KQSY 1YJ91 1Y1WI 2EGTA 1SFOI 1RNIA 2VUGA 1YI21 2PK7A 4MD8A 2V8JA 3QWUA 3CXCY 2NVYI 1Q862 1I3QI 2ZAEB 2Q4ZA 2P28A 1ZB8A 2GTIA 2DE6A 5D1PA 4RVHA 4QTTA 3OW2Z 1PFTA 2QREB 4Y52I 3GTLI 3ESWA 2LIYA 4A93I 3J7A4 1TWGI 2V3VA 3CC2Z 2PM9A 1YJ9Z 4A3KI 5D1OA 3I551 1YITZ 1VQK1 3I561 1Q822 3G6EZ 2I3CA 4A3II 4RV9A 2F4OA 1YHQ1 1QVFZ 2NVTI 1TWCI 4RVDA 1YUKA 1AA6A 1Q16A 2OTL1 2OZKA 2KI7B 3CC41 3MZKB 3NFZA 1YUAA 2VUMI 4NBGA 1SIWA 2F4MA 1QXFA 3HOXI 2JIMA 1QVGZ 2VPWA 3CMAZ 5T67A 3HOYI 2E7ZA 3H3VJ 2AYDA 3FKII 3NH8A 4NBAA 3KIHA 1ZB9A 3LUSA 3H0GI 1RQFA 2Y0SA 3GKQA 1QYPA 1WCMI 3I4NI 3S16I 3S1NI 2R7ZI 3G711
chains in the Genus database with same CATH topology
1QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXF A; 
#chains in the Genus database with same CATH topology
 4E2W A;  3G71 Z;  1VQO Z;  2YAD A;  1YI2 Z;  4NBB A;  3HOZ I;  1USP B;  3RZO I;  4MD9 A;  4E33 A;  1USP A;  2JA5 I;  4DGL A;  3IFU A;  2RPR A;  1S7M A;  2JA6 I;  3CPW Z;  2JUB A;  4NOZ A;  4BY1 I;  1VQ5 Z;  2OOY B;  1VQP 1;  1K8A 1;  2GU2 A;  3CCQ Z;  2AKL A;  3HOU I;  1DL6 A;  1YIT 1;  3BG0 B;  2QEX Z;  2GTH A;  4BBS I;  2E2H I;  4NBF A;  2IV2 X;  2PMZ A;  2V45 A;  1JJ2 Y;  2E2I I;  1YJN 1;  4CL1 A;  5A2Q b;  3GTJ I;  5T6B A;  2V8K A;  1L1O C;  1VLA A;  1Z03 A;  4NBC A;  3GTQ I;  4NFR A;  4A3C I;  3CCL 1;  3CCL Z;  1M90 2;  3U50 C;  2E9H A;  1VQ8 Z;  2WAQ A;  3CD6 Z;  4RS4 A;  1NJI 2;  4TNU A;  3CC4 Z;  3NH4 A;  3S1M I;  4BY7 I;  5FLM I;  1Q81 1;  2JA8 I;  3VMI A;  1VQ4 1;  2OTL Z;  5LL6 f;  3S15 I;  1VQO 1;  2JS4 A;  3HOV I;  3CCE Z;  4A3F I;  3GTG I;  1M90 1;  3EED A;  3S1R I;  3TDH B;  2JMO A;  3M3Y I;  3D2L A;  3CCU Z;  4E2Y A;  4A3E I;  4BBR I;  5T64 A;  2M48 A;  2JNY A;  4NBE A;  4HGY A;  1VQL 1;  1YHQ Z;  4MRI A;  2RT9 A;  1S72 Z;  3FQQ A;  3I07 A;  3KIF A;  3CME 1;  1TWA I;  1ZH1 A;  1KD1 1;  5FLX f;  3GTK I;  3FQM A;  4MD7 A;  3CPW Y;  1YIJ 1;  4NB9 A;  1TFI A;  3VTN A;  2IZ3 A;  3CCR Z;  2JIO A;  4DK1 A;  3S1Q I;  3Q87 A;  3VMG A;  3JAM b;  2K3R A;  4A3M I;  1FDI A;  4EWC A;  4MON A;  4Y7N I;  5A2Q f;  2HU9 A;  2DE7 A;  4NBD A;  2B63 I;  2QA4 1;  4A3J I;  1K83 I;  1YJN Z;  1RO0 A;  2LFU A;  3GCF A;  1VQ9 1;  4E2Z A;  5C3E I;  1QVF Y;  3I55 Z;  4BXX I;  1Q7Y 1;  2QKD A;  3CCV Z;  3CXC Z;  3S14 I;  3CME Z;  2BJO A;  3T4N B;  3CCS Z;  2O53 A;  2YU9 I;  1W2B Y;  3G4S 1;  3VMH A;  1VQ7 1;  3P5J B;  1WW9 A;  1R9T I;  4HH4 A;  3NH5 A;  2QEX 1;  1Z01 A;  2RBL A;  3NDI A;  2Q51 A;  2QA4 Z;  2VPX A;  2R6M A;  5CM2 M;  2JA7 I;  3F3F C;  3S17 I;  1VQ4 Z;  1I6H I;  4XX2 A;  1QF8 A;  4MH4 A;  1KC8 2;  3M4O I;  2P3Y A;  5C4J I;  4E32 A;  2J6A A;  3GTP I;  4AYB A;  1RO4 A;  2VPY A;  3TE5 B;  3G6E 1;  2NAP A;  1N2F A;  1K9M 2;  3F3P C;  3J80 b;  5IT9 f;  1K73 2;  1Z02 A;  4QTU A;  1VQN Z;  1YJW 1;  1K9M 1;  2VPZ A;  3RZD I;  1JJ2 Z;  3J80 f;  5IP7 I;  3VB9 A;  1KD1 2;  1WJ2 A;  1WZN A;  1TWF I;  3PO2 I;  1NJI 1;  2RIQ A;  2JIQ A;  1YIJ Z;  3D6W A;  4E30 A;  1KC8 1;  2JIP A;  1K73 1;  1JWH C;  3CCJ Z;  1Q86 1;  1RLY A;  2LEX A;  1ML8 A;  1Y1V S;  1M1K 1;  1VQM Z;  3CCR 1;  1TWH I;  3S2D I;  2G2K A;  2W03 A;  5C44 I;  1QVG Y;  1VQ7 Z;  2NVX I;  2QRD B;  4S1T A;  2VF1 A;  3G4S Z;  1VQP Z;  3MON A;  2IZ4 A;  2V8I A;  1Q81 2;  3CCU 1;  4A3G I;  2QLV B;  1Q82 1;  3OW2 Y;  3CCV 1;  3J81 b;  1VQ5 1;  5D1O B;  1KRL A;  2RHB A;  4A3L I;  4A3B I;  3PO3 S;  5AN9 F;  1W2B Z;  2WB1 A;  3HOW I;  5C4X I;  3HKZ A;  2QRC B;  3CCM Z;  2OTJ Z;  3CCM 1;  1VQ6 Z;  2OTJ 1;  5IT9 b;  2H85 A;  2KPI A;  3GTM S;  4E2X A;  2W04 A;  1Y1V I;  3CCJ 1;  1K8A 2;  2E2J I;  4NB8 A;  1KQS Z;  1X3W A;  3D9X A;  4RVG A;  1VQN 1;  1Y8C A;  1Q7Y 2;  3S2H I;  2O4H A;  3IR7 A;  3CMA 1;  4MXU A;  1VQ8 1;  2HF1 A;  4X6A I;  1S72 1;  1M1K 2;  3CCE 1;  3I56 Z;  2QR1 B;  4NBH A;  1WII A;  3JAM f;  2R93 I;  2JR6 A;  4A3D I;  2DE5 A;  4NH1 C;  3CC7 1;  3CC7 Z;  2JIR A;  3NDJ A;  3GTM I;  1NP6 A;  2M6N A;  3EER A;  1P9N A;  4HGZ A;  3GTO I;  1N8R 2;  1VQ9 Z;  3MZL B;  5IP9 I;  3CD6 1;  1X0T A;  3I4M I;  2OOX B;  3CCQ 1;  1VQM 1;  1VQ6 1;  1FDO A;  3PO3 I;  4E31 A;  3CCS 1;  1N8R 1;  5FLX b;  1VQK Z;  2NVQ I;  3K7A I;  3BG1 B;  4RVF A;  2R92 I;  1I50 I;  3J81 f;  1X3Z A;  1YJW Z;  2K5R A;  3IX0 A;  3CQZ I;  1VQL Z;  3CC2 1;  1LQL A;  4DQY B;  3IF8 A;  1NUI A;  1RO2 A;  1KQS Y;  1YJ9 1;  1Y1W I;  2EGT A;  1SFO I;  1RNI A;  2VUG A;  1YI2 1;  2PK7 A;  4MD8 A;  2V8J A;  3QWU A;  3CXC Y;  2NVY I;  1Q86 2;  1I3Q I;  2ZAE B;  2Q4Z A;  2P28 A;  1ZB8 A;  2GTI A;  2DE6 A;  5D1P A;  4RVH A;  4QTT A;  3OW2 Z;  1PFT A;  2QRE B;  4Y52 I;  3GTL I;  3ESW A;  2LIY A;  4A93 I;  3J7A 4;  1TWG I;  2V3V A;  3CC2 Z;  2PM9 A;  1YJ9 Z;  4A3K I;  5D1O A;  3I55 1;  1YIT Z;  1VQK 1;  3I56 1;  1Q82 2;  3G6E Z;  2I3C A;  4A3I I;  4RV9 A;  2F4O A;  1YHQ 1;  1QVF Z;  2NVT I;  1TWC I;  4RVD A;  1YUK A;  1AA6 A;  1Q16 A;  2OTL 1;  2OZK A;  2KI7 B;  3CC4 1;  3MZK B;  3NFZ A;  1YUA A;  2VUM I;  4NBG A;  1SIW A;  2F4M A;  1QXF A;  3HOX I;  2JIM A;  1QVG Z;  2VPW A;  3CMA Z;  5T67 A;  3HOY I;  2E7Z A;  3H3V J;  2AYD A;  3FKI I;  3NH8 A;  4NBA A;  3KIH A;  1ZB9 A;  3LUS A;  3H0G I;  1RQF A;  2Y0S A;  3GKQ A;  1QYP A;  1WCM I;  3I4N I;  3S16 I;  3S1N I;  2R7Z I;  3G71 1; 
#chains in the Genus database with same CATH homology
 1QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...