1QXFA

Solution structure of 30s ribosomal protein s27e from archaeoglobus fulgidus: gr2, a nesg target protein
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVDQIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 30S RIBOSOMAL PROTEIN S27E
publication title The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 2
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.100 Mainly Beta Single Sheet N-terminal domain of TfIIb Zn-binding ribosomal proteins 1qxfA00
1QXFA
chains in the Genus database with same CATH superfamily
2H85A 4RV9A 2R93I 1N8R2 1Z01A 2JIMA 2PK7A 3GTJI 3CMEZ 4MH4A 2F4OA 3VMIA 1R9TI 5A2Qf 1YI2Z 4QTTA 5LL6f 3J81b 1TWHI 1VQN1 4NBAA 4QTUA 1Y1WI 2QREB 1YJN1 1NUIA 2KI7B 4Y7NI 3PO3I 3IR7A 3MZKB 2DE5A 1ML8A 1VQO1 3ESWA 4RS4A 1Z02A 5C3EI 1W2BY 3I561 1QVFY 2JA6I 3H0GI 1KD11 3M4OI 4A3LI 1KD12 1VQ4Z 1L1OC 5D1PA 1X3ZA 2O4HA 4A3DI 2QEXZ 1VQ81 2DE6A 3CCM1 3CCQZ 4BBRI 3GTGI 1Y1VS 3FQMA 3S17I 1TWFI 3CME1 3VMHA 1WW9A 3I07A 3PO2I 3GTMI 4RVFA 1JWHC 3M3YI 1YI21 1I3QI 2Q51A 2IZ3A 3CC7Z 3QWUA 3CCEZ 2YU9I 1JJ2Z 1QVGY 2P28A 3F3FC 4NB9A 2Y0SA 4A3CI 3NDJA 3CCJZ 2ZAEB 2GU2A 3GTOI 4NBGA 2OZKA 1WJ2A 3G4SZ 4BXXI 3OW2Y 3S1NI 1VQ9Z 3HOVI 3D2LA 3CC41 4XX2A 1Y8CA 4MRIA 4NB8A 2KPIA 3IF8A 3CPWZ 1LQLA 2LIYA 2JA8I 1VQ41 3NDIA 4X6AI 3RZDI 4NBEA 1KQSZ 1K9M1 3MONA 3CCQ1 2V3VA 2NVYI 1YUAA 3CCLZ 1K9M2 3HOXI 2QRCB 3NFZA 4E2XA 2E7ZA 2EGTA 1M902 3NH4A 3CCUZ 1SFOI 1WIIA 2OTLZ 2V8IA 3CC71 3CCE1 2JMOA 3PO3S 3MZLB 2JNYA 5IP9I 4A3JI 1VQ7Z 4HH4A 3CCJ1 1AA6A 1VQPZ 2QR1B 4NBCA 3S15I 1TWAI 4NH1C 2R92I 1ZB8A 5IT9f 3CC21 2E2JI 3S14I 3NH5A 4S1TA 3G4S1 2OTJZ 1VQ91 2VPWA 1K731 5D1OA 4A3EI 1I50I 2AYDA 3JAMb 3GTQI 2YADA 2NVQI 2NAPA 1Q16A 2P3YA 4MD7A 2JIRA 3I4NI 3HOZI 1FDIA 3CCL1 4A3MI 1QYPA 3CC4Z 5CM2M 3EEDA 5D1OB 1RQFA 3U50C 4CL1A 1X3WA 3CCU1 1KC81 2V45A 1YHQ1 3I4MI 1TWGI 1RO2A 2OTL1 2BJOA 2JUBA 2JIOA 5C4XI 5FLXf 1RLYA 1RNIA 2R6MA 2LEXA 4NBFA 3S1MI 1VQ71 1VQP1 4MD9A 3CD61 3G71Z 4MONA 1S721 4E31A 5FLMI 3CCRZ 1Q821 4RVHA 2OTJ1 4NBBA 3CMAZ 3I55Z 2E2II 3BG1B 2IZ4A 3G6EZ 3J81f 1RO4A 2M48A 5AN9F 1YJW1 3VMGA 3J7A4 4TNUA 1YJ91 2OOYB 3HOYI 2E9HA 3CC2Z 3KIFA 2PMZA 4E30A 4E2WA 4BY1I 5A2Qb 5T67A 4A3FI 5IT9b 1X0TA 2K3RA 2VPXA 2W03A 1Q811 1Y1VI 2IV2X 1VQMZ 3GKQA 3CCSZ 2QRDB 1ZH1A 1Q861 4RVGA 1M1K1 2RPRA 2I3CA 4DK1A 2VUMI 2W04A 3J80f 1NP6A 3CPWY 3G711 2RIQA 3LUSA 3CCR1 1YHQZ 3CXCZ 2F4MA 4E2ZA 2JA7I 3CMA1 3I551 1K83I 3GTKI 3EERA 2GTIA 2RT9A 3G6E1 2LFUA 1Z03A 3TE5B 1VQKZ 3CCVZ 1S7MA 4HGZA 1I6HI 3CD6Z 3P5JB 3H3VJ 1S72Z 1Q7Y1 4NBDA 2RHBA 1QXFA 2HF1A 3S1QI 1VLAA 2AKLA 1N8R1 2VPZA 1USPB 1K732 1VQ6Z 4NBHA 3FKII 4A93I 2VF1A 1YJWZ 1P9NA 2WB1A 4DQYB 1VQ5Z 3D6WA 1YJ9Z 2JS4A 2JR6A 1VQM1 3CCS1 3GTMS 2DE7A 2RBLA 3VTNA 1PFTA 1W2BZ 1QVFZ 2OOXB 1RO0A 2V8JA 2QKDA 2O53A 4HGYA 1YUKA 2NVXI 1KC82 1NJI1 1YIJ1 1QF8A 5T6BA 1NJI2 1TFIA 2Q4ZA 2B63I 3S2DI 3Q87A 1VQK1 3K7AI 2QA4Z 3CCV1 2HU9A 4A3KI 3D9XA 2PM9A 3NH8A 1YITZ 4A3GI 1VQLZ 4EWCA 1Q822 3F3PC 4E32A 1KRLA 5IP7I 3J80b 3KIHA 4E33A 1QVGZ 2GTHA 2K5RA 2NVTI 3BG0B 1VQ61 2E2HI 1TWCI 3GCFA 1DL6A 1VQ51 4Y52I 2WAQA 3T4NB 3HKZA 3JAMf 3S2HI 4DGLA 1SIWA 1JJ2Y 3OW2Z 3CQZI 4A3II 5T64A 2M6NA 2V8KA 2R7ZI 4NFRA 4AYBA 3FQQA 1FDOA 4MXUA 1Q812 3IFUA 4NOZA 3RZOI 1VQNZ 3TDHB 4RVDA 5C44I 1Q862 2QA41 3VB9A 1M1K2 1K8A1 1YJNZ 2JIPA 3IX0A 1YIT1 3GTPI 1K8A2 4BY7I 2QLVB 1KQSY 4MD8A 1VQL1 5C4JI 2JA5I 3S16I 2QEX1 1USPA 1YIJZ 1VQOZ 4BBSI 4E2YA 1ZB9A 2JIQA 1WCMI 3GTLI 3S1RI 3I56Z 2VUGA 1M901 3HOWI 2G2KA 5FLXb 2J6AA 3CXCY 3HOUI 1Q7Y2 1N2FA 1WZNA 1VQ8Z 3CCMZ 2VPYA 4A3BI
chains in the Genus database with same CATH topology
1QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXF A; 
#chains in the Genus database with same CATH topology
 2H85 A;  4RV9 A;  2R93 I;  1N8R 2;  1Z01 A;  2JIM A;  2PK7 A;  3GTJ I;  3CME Z;  4MH4 A;  2F4O A;  3VMI A;  1R9T I;  5A2Q f;  1YI2 Z;  4QTT A;  5LL6 f;  3J81 b;  1TWH I;  1VQN 1;  4NBA A;  4QTU A;  1Y1W I;  2QRE B;  1YJN 1;  1NUI A;  2KI7 B;  4Y7N I;  3PO3 I;  3IR7 A;  3MZK B;  2DE5 A;  1ML8 A;  1VQO 1;  3ESW A;  4RS4 A;  1Z02 A;  5C3E I;  1W2B Y;  3I56 1;  1QVF Y;  2JA6 I;  3H0G I;  1KD1 1;  3M4O I;  4A3L I;  1KD1 2;  1VQ4 Z;  1L1O C;  5D1P A;  1X3Z A;  2O4H A;  4A3D I;  2QEX Z;  1VQ8 1;  2DE6 A;  3CCM 1;  3CCQ Z;  4BBR I;  3GTG I;  1Y1V S;  3FQM A;  3S17 I;  1TWF I;  3CME 1;  3VMH A;  1WW9 A;  3I07 A;  3PO2 I;  3GTM I;  4RVF A;  1JWH C;  3M3Y I;  1YI2 1;  1I3Q I;  2Q51 A;  2IZ3 A;  3CC7 Z;  3QWU A;  3CCE Z;  2YU9 I;  1JJ2 Z;  1QVG Y;  2P28 A;  3F3F C;  4NB9 A;  2Y0S A;  4A3C I;  3NDJ A;  3CCJ Z;  2ZAE B;  2GU2 A;  3GTO I;  4NBG A;  2OZK A;  1WJ2 A;  3G4S Z;  4BXX I;  3OW2 Y;  3S1N I;  1VQ9 Z;  3HOV I;  3D2L A;  3CC4 1;  4XX2 A;  1Y8C A;  4MRI A;  4NB8 A;  2KPI A;  3IF8 A;  3CPW Z;  1LQL A;  2LIY A;  2JA8 I;  1VQ4 1;  3NDI A;  4X6A I;  3RZD I;  4NBE A;  1KQS Z;  1K9M 1;  3MON A;  3CCQ 1;  2V3V A;  2NVY I;  1YUA A;  3CCL Z;  1K9M 2;  3HOX I;  2QRC B;  3NFZ A;  4E2X A;  2E7Z A;  2EGT A;  1M90 2;  3NH4 A;  3CCU Z;  1SFO I;  1WII A;  2OTL Z;  2V8I A;  3CC7 1;  3CCE 1;  2JMO A;  3PO3 S;  3MZL B;  2JNY A;  5IP9 I;  4A3J I;  1VQ7 Z;  4HH4 A;  3CCJ 1;  1AA6 A;  1VQP Z;  2QR1 B;  4NBC A;  3S15 I;  1TWA I;  4NH1 C;  2R92 I;  1ZB8 A;  5IT9 f;  3CC2 1;  2E2J I;  3S14 I;  3NH5 A;  4S1T A;  3G4S 1;  2OTJ Z;  1VQ9 1;  2VPW A;  1K73 1;  5D1O A;  4A3E I;  1I50 I;  2AYD A;  3JAM b;  3GTQ I;  2YAD A;  2NVQ I;  2NAP A;  1Q16 A;  2P3Y A;  4MD7 A;  2JIR A;  3I4N I;  3HOZ I;  1FDI A;  3CCL 1;  4A3M I;  1QYP A;  3CC4 Z;  5CM2 M;  3EED A;  5D1O B;  1RQF A;  3U50 C;  4CL1 A;  1X3W A;  3CCU 1;  1KC8 1;  2V45 A;  1YHQ 1;  3I4M I;  1TWG I;  1RO2 A;  2OTL 1;  2BJO A;  2JUB A;  2JIO A;  5C4X I;  5FLX f;  1RLY A;  1RNI A;  2R6M A;  2LEX A;  4NBF A;  3S1M I;  1VQ7 1;  1VQP 1;  4MD9 A;  3CD6 1;  3G71 Z;  4MON A;  1S72 1;  4E31 A;  5FLM I;  3CCR Z;  1Q82 1;  4RVH A;  2OTJ 1;  4NBB A;  3CMA Z;  3I55 Z;  2E2I I;  3BG1 B;  2IZ4 A;  3G6E Z;  3J81 f;  1RO4 A;  2M48 A;  5AN9 F;  1YJW 1;  3VMG A;  3J7A 4;  4TNU A;  1YJ9 1;  2OOY B;  3HOY I;  2E9H A;  3CC2 Z;  3KIF A;  2PMZ A;  4E30 A;  4E2W A;  4BY1 I;  5A2Q b;  5T67 A;  4A3F I;  5IT9 b;  1X0T A;  2K3R A;  2VPX A;  2W03 A;  1Q81 1;  1Y1V I;  2IV2 X;  1VQM Z;  3GKQ A;  3CCS Z;  2QRD B;  1ZH1 A;  1Q86 1;  4RVG A;  1M1K 1;  2RPR A;  2I3C A;  4DK1 A;  2VUM I;  2W04 A;  3J80 f;  1NP6 A;  3CPW Y;  3G71 1;  2RIQ A;  3LUS A;  3CCR 1;  1YHQ Z;  3CXC Z;  2F4M A;  4E2Z A;  2JA7 I;  3CMA 1;  3I55 1;  1K83 I;  3GTK I;  3EER A;  2GTI A;  2RT9 A;  3G6E 1;  2LFU A;  1Z03 A;  3TE5 B;  1VQK Z;  3CCV Z;  1S7M A;  4HGZ A;  1I6H I;  3CD6 Z;  3P5J B;  3H3V J;  1S72 Z;  1Q7Y 1;  4NBD A;  2RHB A;  1QXF A;  2HF1 A;  3S1Q I;  1VLA A;  2AKL A;  1N8R 1;  2VPZ A;  1USP B;  1K73 2;  1VQ6 Z;  4NBH A;  3FKI I;  4A93 I;  2VF1 A;  1YJW Z;  1P9N A;  2WB1 A;  4DQY B;  1VQ5 Z;  3D6W A;  1YJ9 Z;  2JS4 A;  2JR6 A;  1VQM 1;  3CCS 1;  3GTM S;  2DE7 A;  2RBL A;  3VTN A;  1PFT A;  1W2B Z;  1QVF Z;  2OOX B;  1RO0 A;  2V8J A;  2QKD A;  2O53 A;  4HGY A;  1YUK A;  2NVX I;  1KC8 2;  1NJI 1;  1YIJ 1;  1QF8 A;  5T6B A;  1NJI 2;  1TFI A;  2Q4Z A;  2B63 I;  3S2D I;  3Q87 A;  1VQK 1;  3K7A I;  2QA4 Z;  3CCV 1;  2HU9 A;  4A3K I;  3D9X A;  2PM9 A;  3NH8 A;  1YIT Z;  4A3G I;  1VQL Z;  4EWC A;  1Q82 2;  3F3P C;  4E32 A;  1KRL A;  5IP7 I;  3J80 b;  3KIH A;  4E33 A;  1QVG Z;  2GTH A;  2K5R A;  2NVT I;  3BG0 B;  1VQ6 1;  2E2H I;  1TWC I;  3GCF A;  1DL6 A;  1VQ5 1;  4Y52 I;  2WAQ A;  3T4N B;  3HKZ A;  3JAM f;  3S2H I;  4DGL A;  1SIW A;  1JJ2 Y;  3OW2 Z;  3CQZ I;  4A3I I;  5T64 A;  2M6N A;  2V8K A;  2R7Z I;  4NFR A;  4AYB A;  3FQQ A;  1FDO A;  4MXU A;  1Q81 2;  3IFU A;  4NOZ A;  3RZO I;  1VQN Z;  3TDH B;  4RVD A;  5C44 I;  1Q86 2;  2QA4 1;  3VB9 A;  1M1K 2;  1K8A 1;  1YJN Z;  2JIP A;  3IX0 A;  1YIT 1;  3GTP I;  1K8A 2;  4BY7 I;  2QLV B;  1KQS Y;  4MD8 A;  1VQL 1;  5C4J I;  2JA5 I;  3S16 I;  2QEX 1;  1USP A;  1YIJ Z;  1VQO Z;  4BBS I;  4E2Y A;  1ZB9 A;  2JIQ A;  1WCM I;  3GTL I;  3S1R I;  3I56 Z;  2VUG A;  1M90 1;  3HOW I;  2G2K A;  5FLX b;  2J6A A;  3CXC Y;  3HOU I;  1Q7Y 2;  1N2F A;  1WZN A;  1VQ8 Z;  3CCM Z;  2VPY A;  4A3B I; 
#chains in the Genus database with same CATH homology
 1QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...