1QXFA

Solution structure of 30s ribosomal protein s27e from archaeoglobus fulgidus: gr2, a nesg target protein
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVDQIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords 30S RIBOSOMAL PROTEIN S27E
total genus 2
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.100 Mainly Beta Single Sheet N-terminal domain of TfIIb Zn-binding ribosomal proteins 1qxfA00
1QXFA
chains in the Genus database with same CATH superfamily
3JAMb 2LEXA 4NBHA 3RZDI 3FQMA 3G4S1 2EGTA 3NH8A 4DQYB 3CCJZ 4MXUA 2WAQA 3CCU1 4QTTA 1AA6A 1JWHC 3CCRZ 4E32A 2RHBA 4X6AI 2JUBA 4DK1A 4S1TA 1RQFA 4RVHA 2E2II 4A3GI 1S721 3IX0A 5IT9b 4NOZA 3CCEZ 3GTPI 1NJI1 3CCJ1 2E2JI 4MONA 1K8A1 1N8R2 3CPWY 5C3EI 2QKDA 3S1MI 2NVQI 3VTNA 2GTHA 1M1K2 4Y7NI 3QWUA 4NB8A 3HOVI 2LFUA 3MZKB 3KIHA 3HOYI 3HOZI 3EEDA 3NFZA 2JS4A 3JAMf 5FLXb 4RV9A 1KD12 1FDOA 3I4NI 3CQZI 2E2HI 1I3QI 1VLAA 2KI7B 3TE5B 3H0GI 3S2HI 2JA8I 2QR1B 3MONA 4A3BI 3G71Z 1KRLA 2YADA 3VMGA 1K732 1TWGI 3S15I 1K83I 2VF1A 3NDJA 2PMZA 3CCLZ 2OZKA 1VQ81 1QVFZ 3VMIA 4A3LI 3BG0B 4A3II 2M6NA 2QRCB 5C4XI 3CCV1 1Q822 2NVYI 1VQKZ 3D6WA 4E33A 5D1PA 1QXFA 1PFTA 2IV2X 1VQN1 3CME1 3IFUA 2W03A 1Q812 1YIJZ 2P28A 3M3YI 5FLXf 3ESWA 2V8IA 5CM2M 2VPWA 2JNYA 2B63I 2HU9A 1VQ8Z 1P9NA 4XX2A 1WIIA 4A3CI 3CC21 1QVGZ 1VQ61 4NBFA 1TWHI 4MD9A 3TDHB 5IP9I 4NBCA 1WJ2A 2PK7A 2W04A 1VQL1 1YHQZ 3CMEZ 2VPYA 2DE7A 1KC81 2QA41 1X0TA 1YJ91 2V8JA 2F4MA 3F3FC 2QREB 2JIRA 1YI21 1QVFY 3EERA 1YIJ1 3Q87A 3PO3I 5C4JI 2RIQA 3CCR1 3CCUZ 1VQLZ 3D9XA 1VQ41 2JIMA 3CCE1 1VQO1 3CC71 1YJWZ 1K9M2 3GTJI 3FQQA 1TWFI 3CXCY 1USPB 3I551 1M1K1 1VQ51 2V3VA 3RZOI 3CCVZ 3K7AI 1VQOZ 2Y0SA 1ML8A 3IF8A 2VUGA 1NJI2 4A3JI 2QEX1 1KQSZ 2RT9A 4E30A 4RVGA 4BBRI 3GKQA 3VB9A 1VQPZ 3T4NB 2JA7I 1VQ4Z 3F3PC 3S17I 1QYPA 2VPZA 1VQ6Z 2GU2A 3S2DI 3FKII 4BBSI 3CC7Z 4NBAA 1YJW1 3GTKI 4NH1C 3GTOI 1Y1VS 3S1NI 3S1QI 4E2WA 2NVXI 2E9HA 4HGZA 2OOXB 3CC2Z 2P3YA 2RBLA 3CD61 5D1OA 3I07A 3J80f 2IZ3A 3NDIA 3I4MI 1USPA 4NBGA 5IT9f 1YUKA 2E7ZA 1Q862 3G711 2OTJ1 1ZB8A 2JR6A 1S7MA 2QLVB 3CCQZ 1RO2A 5C44I 3GTQI 4A3MI 1X3ZA 2R7ZI 3D2LA 3PO3S 1YJN1 5LL6f 1QVGY 4A93I 1KD11 3P5JB 3LUSA 3MZLB 1YUAA 4HGYA 2AKLA 2HF1A 1VQ71 3GCFA 4NBDA 1VQNZ 3GTLI 1VQM1 1Z01A 2DE5A 3G6E1 1ZB9A 2QRDB 2R6MA 3J81b 3IR7A 4BY7I 2Q51A 1DL6A 2AYDA 2OOYB 5T6BA 2QEXZ 2QA4Z 4MH4A 3CC4Z 2R93I 1S72Z 2JA6I 3NH4A 3S14I 2J6AA 1VQP1 4MD8A 2VUMI 1YITZ 4RVFA 1TWCI 1KC82 3CXCZ 1JJ2Z 1VQK1 4BY1I 2VPXA 1VQ5Z 2IZ4A 3PO2I 1RO4A 1JJ2Y 2JMOA 4E2ZA 1SIWA 4E31A 4A3EI 2F4OA 1YIT1 1YHQ1 3CCSZ 3U50C 3CD6Z 3GTMI 1K9M1 4NFRA 3I561 4EWCA 1NUIA 2O53A 4RVDA 2NVTI 4E2XA 1Z02A 1I6HI 1YJNZ 4E2YA 1M901 1ZH1A 3J80b 3S16I 3CCQ1 3BG1B 1WZNA 2OTL1 1Q16A 1YI2Z 4BXXI 1K731 4NBEA 3G6EZ 4Y52I 1VQMZ 3CCM1 2ZAEB 5D1OB 2WB1A 2O4HA 1Q7Y2 4MRIA 4QTUA 2H85A 1Y8CA 3M4OI 1W2BY 4RS4A 1K8A2 1Q7Y1 3H3VJ 1L1OC 1RO0A 1TWAI 2GTIA 4CL1A 1W2BZ 1TFIA 5AN9F 3CPWZ 4DGLA 2K3RA 1R9TI 1FDIA 4A3KI 2BJOA 1N2FA 1I50I 1VQ91 1M902 2G2KA 5FLMI 1RNIA 3VMHA 2V8KA 4A3FI 2RPRA 3HKZA 1Q821 2NAPA 2M48A 3S1RI 4HH4A 4AYBA 5IP7I 1VQ7Z 2YU9I 2JIOA 2DE6A 2PM9A 3HOXI 1Y1VI 3CC41 1Q811 1Y1WI 1VQ9Z 4A3DI 5A2Qb 3CCL1 3I55Z 3HOUI 3CMAZ 3HOWI 2KPIA 3I56Z 1Q861 1SFOI 2OTLZ 3NH5A 1NP6A 3OW2Z 1LQLA 5T64A 1KQSY 5T67A 3CMA1 4MD7A 2R92I 1WCMI 2JIQA 2V45A 4NB9A 1YJ9Z 2I3CA 2LIYA 3OW2Y 4NBBA 3J7A4 1RLYA 1WW9A 5A2Qf 2JIPA 1QF8A 2K5RA 3G4SZ 3GTMS 2OTJZ 3J81f 3CCS1 3CCMZ 3GTGI 1N8R1 1Z03A 3KIFA 2Q4ZA 4TNUA 1X3WA 2JA5I
chains in the Genus database with same CATH topology
1QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXF A; 
#chains in the Genus database with same CATH topology
 3JAM b;  2LEX A;  4NBH A;  3RZD I;  3FQM A;  3G4S 1;  2EGT A;  3NH8 A;  4DQY B;  3CCJ Z;  4MXU A;  2WAQ A;  3CCU 1;  4QTT A;  1AA6 A;  1JWH C;  3CCR Z;  4E32 A;  2RHB A;  4X6A I;  2JUB A;  4DK1 A;  4S1T A;  1RQF A;  4RVH A;  2E2I I;  4A3G I;  1S72 1;  3IX0 A;  5IT9 b;  4NOZ A;  3CCE Z;  3GTP I;  1NJI 1;  3CCJ 1;  2E2J I;  4MON A;  1K8A 1;  1N8R 2;  3CPW Y;  5C3E I;  2QKD A;  3S1M I;  2NVQ I;  3VTN A;  2GTH A;  1M1K 2;  4Y7N I;  3QWU A;  4NB8 A;  3HOV I;  2LFU A;  3MZK B;  3KIH A;  3HOY I;  3HOZ I;  3EED A;  3NFZ A;  2JS4 A;  3JAM f;  5FLX b;  4RV9 A;  1KD1 2;  1FDO A;  3I4N I;  3CQZ I;  2E2H I;  1I3Q I;  1VLA A;  2KI7 B;  3TE5 B;  3H0G I;  3S2H I;  2JA8 I;  2QR1 B;  3MON A;  4A3B I;  3G71 Z;  1KRL A;  2YAD A;  3VMG A;  1K73 2;  1TWG I;  3S15 I;  1K83 I;  2VF1 A;  3NDJ A;  2PMZ A;  3CCL Z;  2OZK A;  1VQ8 1;  1QVF Z;  3VMI A;  4A3L I;  3BG0 B;  4A3I I;  2M6N A;  2QRC B;  5C4X I;  3CCV 1;  1Q82 2;  2NVY I;  1VQK Z;  3D6W A;  4E33 A;  5D1P A;  1QXF A;  1PFT A;  2IV2 X;  1VQN 1;  3CME 1;  3IFU A;  2W03 A;  1Q81 2;  1YIJ Z;  2P28 A;  3M3Y I;  5FLX f;  3ESW A;  2V8I A;  5CM2 M;  2VPW A;  2JNY A;  2B63 I;  2HU9 A;  1VQ8 Z;  1P9N A;  4XX2 A;  1WII A;  4A3C I;  3CC2 1;  1QVG Z;  1VQ6 1;  4NBF A;  1TWH I;  4MD9 A;  3TDH B;  5IP9 I;  4NBC A;  1WJ2 A;  2PK7 A;  2W04 A;  1VQL 1;  1YHQ Z;  3CME Z;  2VPY A;  2DE7 A;  1KC8 1;  2QA4 1;  1X0T A;  1YJ9 1;  2V8J A;  2F4M A;  3F3F C;  2QRE B;  2JIR A;  1YI2 1;  1QVF Y;  3EER A;  1YIJ 1;  3Q87 A;  3PO3 I;  5C4J I;  2RIQ A;  3CCR 1;  3CCU Z;  1VQL Z;  3D9X A;  1VQ4 1;  2JIM A;  3CCE 1;  1VQO 1;  3CC7 1;  1YJW Z;  1K9M 2;  3GTJ I;  3FQQ A;  1TWF I;  3CXC Y;  1USP B;  3I55 1;  1M1K 1;  1VQ5 1;  2V3V A;  3RZO I;  3CCV Z;  3K7A I;  1VQO Z;  2Y0S A;  1ML8 A;  3IF8 A;  2VUG A;  1NJI 2;  4A3J I;  2QEX 1;  1KQS Z;  2RT9 A;  4E30 A;  4RVG A;  4BBR I;  3GKQ A;  3VB9 A;  1VQP Z;  3T4N B;  2JA7 I;  1VQ4 Z;  3F3P C;  3S17 I;  1QYP A;  2VPZ A;  1VQ6 Z;  2GU2 A;  3S2D I;  3FKI I;  4BBS I;  3CC7 Z;  4NBA A;  1YJW 1;  3GTK I;  4NH1 C;  3GTO I;  1Y1V S;  3S1N I;  3S1Q I;  4E2W A;  2NVX I;  2E9H A;  4HGZ A;  2OOX B;  3CC2 Z;  2P3Y A;  2RBL A;  3CD6 1;  5D1O A;  3I07 A;  3J80 f;  2IZ3 A;  3NDI A;  3I4M I;  1USP A;  4NBG A;  5IT9 f;  1YUK A;  2E7Z A;  1Q86 2;  3G71 1;  2OTJ 1;  1ZB8 A;  2JR6 A;  1S7M A;  2QLV B;  3CCQ Z;  1RO2 A;  5C44 I;  3GTQ I;  4A3M I;  1X3Z A;  2R7Z I;  3D2L A;  3PO3 S;  1YJN 1;  5LL6 f;  1QVG Y;  4A93 I;  1KD1 1;  3P5J B;  3LUS A;  3MZL B;  1YUA A;  4HGY A;  2AKL A;  2HF1 A;  1VQ7 1;  3GCF A;  4NBD A;  1VQN Z;  3GTL I;  1VQM 1;  1Z01 A;  2DE5 A;  3G6E 1;  1ZB9 A;  2QRD B;  2R6M A;  3J81 b;  3IR7 A;  4BY7 I;  2Q51 A;  1DL6 A;  2AYD A;  2OOY B;  5T6B A;  2QEX Z;  2QA4 Z;  4MH4 A;  3CC4 Z;  2R93 I;  1S72 Z;  2JA6 I;  3NH4 A;  3S14 I;  2J6A A;  1VQP 1;  4MD8 A;  2VUM I;  1YIT Z;  4RVF A;  1TWC I;  1KC8 2;  3CXC Z;  1JJ2 Z;  1VQK 1;  4BY1 I;  2VPX A;  1VQ5 Z;  2IZ4 A;  3PO2 I;  1RO4 A;  1JJ2 Y;  2JMO A;  4E2Z A;  1SIW A;  4E31 A;  4A3E I;  2F4O A;  1YIT 1;  1YHQ 1;  3CCS Z;  3U50 C;  3CD6 Z;  3GTM I;  1K9M 1;  4NFR A;  3I56 1;  4EWC A;  1NUI A;  2O53 A;  4RVD A;  2NVT I;  4E2X A;  1Z02 A;  1I6H I;  1YJN Z;  4E2Y A;  1M90 1;  1ZH1 A;  3J80 b;  3S16 I;  3CCQ 1;  3BG1 B;  1WZN A;  2OTL 1;  1Q16 A;  1YI2 Z;  4BXX I;  1K73 1;  4NBE A;  3G6E Z;  4Y52 I;  1VQM Z;  3CCM 1;  2ZAE B;  5D1O B;  2WB1 A;  2O4H A;  1Q7Y 2;  4MRI A;  4QTU A;  2H85 A;  1Y8C A;  3M4O I;  1W2B Y;  4RS4 A;  1K8A 2;  1Q7Y 1;  3H3V J;  1L1O C;  1RO0 A;  1TWA I;  2GTI A;  4CL1 A;  1W2B Z;  1TFI A;  5AN9 F;  3CPW Z;  4DGL A;  2K3R A;  1R9T I;  1FDI A;  4A3K I;  2BJO A;  1N2F A;  1I50 I;  1VQ9 1;  1M90 2;  2G2K A;  5FLM I;  1RNI A;  3VMH A;  2V8K A;  4A3F I;  2RPR A;  3HKZ A;  1Q82 1;  2NAP A;  2M48 A;  3S1R I;  4HH4 A;  4AYB A;  5IP7 I;  1VQ7 Z;  2YU9 I;  2JIO A;  2DE6 A;  2PM9 A;  3HOX I;  1Y1V I;  3CC4 1;  1Q81 1;  1Y1W I;  1VQ9 Z;  4A3D I;  5A2Q b;  3CCL 1;  3I55 Z;  3HOU I;  3CMA Z;  3HOW I;  2KPI A;  3I56 Z;  1Q86 1;  1SFO I;  2OTL Z;  3NH5 A;  1NP6 A;  3OW2 Z;  1LQL A;  5T64 A;  1KQS Y;  5T67 A;  3CMA 1;  4MD7 A;  2R92 I;  1WCM I;  2JIQ A;  2V45 A;  4NB9 A;  1YJ9 Z;  2I3C A;  2LIY A;  3OW2 Y;  4NBB A;  3J7A 4;  1RLY A;  1WW9 A;  5A2Q f;  2JIP A;  1QF8 A;  2K5R A;  3G4S Z;  3GTM S;  2OTJ Z;  3J81 f;  3CCS 1;  3CCM Z;  3GTG I;  1N8R 1;  1Z03 A;  3KIF A;  2Q4Z A;  4TNU A;  1X3W A;  2JA5 I; 
#chains in the Genus database with same CATH homology
 1QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...