1QXFA

Solution structure of 30s ribosomal protein s27e from archaeoglobus fulgidus: gr2, a nesg target protein
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
b'MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVDQIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S RIBOSOMAL PROTEIN S27E
publication title The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 2
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.100 Mainly Beta Single Sheet N-terminal domain of TfIIb Zn-binding ribosomal proteins 1qxfA00
1QXFA
chains in the Genus database with same CATH superfamily
2G2KA 2AYDA 4A3KI 1JJ2Z 1ML8A 2O4HA 2JIMA 2QA41 2RIQA 4E2WA 2VUMI 3EERA 2OZKA 3CPWY 2DE5A 2V8JA 1KC82 3HOVI 4NBFA 4NB9A 1PFTA 1YUKA 3I4MI 3G4S1 1Q812 2B63I 2P28A 1FDIA 1TWCI 5D1PA 3J81f 2Y0SA 1S721 1KD11 3NFZA 1Q822 1KC81 4BBRI 3HOZI 4NB8A 1YJNZ 3CMEZ 1YIT1 3NH4A 2QLVB 2PMZA 3CC71 2V45A 2JA7I 4QTUA 2RPRA 4NOZA 3CCM1 1Q821 3CMAZ 1WJ2A 1VQNZ 2QRCB 3JAMf 1S7MA 1VQMZ 3CCJZ 1Q7Y2 1WW9A 2IZ4A 3CCQ1 1L1OC 2LEXA 2AKLA 3CCR1 3M3YI 1N8R1 3GTPI 3GTKI 3CPWZ 3F3FC 4A3FI 3HKZA 3GKQA 3LUSA 5D1OB 1QVGY 2NVXI 1ZH1A 2IZ3A 4A3BI 4A93I 3D9XA 3P5JB 1VQLZ 2VPWA 3NDJA 1YJW1 1N2FA 2RBLA 2NVTI 4RVDA 2PK7A 2R93I 4E2YA 1VQ51 1X3WA 2JUBA 5C44I 3S15I 4A3CI 4A3EI 3PO2I 4NH1C 4NBCA 1VQL1 3CCLZ 3CC2Z 3EEDA 1RO2A 1RNIA 3FQQA 3J7A4 3JAMb 3J80f 1TWAI 4MH4A 3VB9A 3G6E1 2VUGA 3BG0B 1YIJ1 1TWFI 3BG1B 1VQOZ 1KQSY 3I561 2QA4Z 4RS4A 2K3RA 3CXCY 5FLXb 3HOXI 4S1TA 4A3DI 3CC41 3G711 1QVGZ 1M901 2R7ZI 2E9HA 2RT9A 1SIWA 1TFIA 3Q87A 3U50C 4E33A 3G4SZ 1I50I 1RO0A 2R92I 2E7ZA 5T67A 1K83I 2YADA 3CCV1 4Y52I 1S72Z 4RVHA 1VQO1 1Z02A 2NAPA 4NBBA 1YI21 1YITZ 2E2HI 1KD12 3CC7Z 5FLMI 4E30A 2EGTA 1ZB9A 3VTNA 4NBHA 4MXUA 4NBAA 3CCMZ 3GTOI 1ZB8A 2QKDA 2KI7B 4MRIA 5C3EI 3HOWI 2LIYA 1TWGI 2H85A 3CCQZ 2E2JI 1KQSZ 2W03A 3CCRZ 5IT9f 1Y1WI 2V8KA 4E2ZA 3CXCZ 1RQFA 2F4OA 4RV9A 5A2Qf 1N8R2 5D1OA 3K7AI 3S16I 2JA5I 3RZDI 4A3GI 4MD7A 1WIIA 4RVGA 1QXFA 1Z01A 4MD8A 1YJWZ 1K732 2R6MA 3MZKB 1VQ81 1VQ5Z 3NH8A 1VQPZ 2GU2A 2JA8I 3S1MI 5T6BA 3GTQI 2W04A 1VQ71 2NVQI 4DGLA 1K731 3M4OI 3NH5A 3PO3S 1QF8A 3CCE1 2JIOA 4HGYA 1Q862 3CD61 3IR7A 1K8A1 3KIFA 3G6EZ 3J81b 3CCSZ 3S14I 1YIJZ 3HOYI 3VMGA 3GTJI 4A3JI 3H3VJ 5C4JI 3GTMS 1VQP1 3I56Z 3GTMI 1Y1VS 1YUAA 2F4MA 2DE7A 1Q861 3CC4Z 1Y1VI 3G71Z 2JIQA 1VQ61 1WZNA 3TE5B 1I3QI 1NP6A 4E2XA 4BY1I 3VMHA 2M6NA 4BXXI 1M902 2JMOA 3CCS1 1VQ9Z 2YU9I 1QVFY 1SFOI 2QREB 4MONA 3CCVZ 3QWUA 5IP9I 2OOYB 3I551 1AA6A 1YI2Z 5AN9F 3TDHB 5CM2M 2PM9A 2HU9A 2JS4A 3IX0A 4A3II 2JIPA 1NJI1 2JR6A 2V8IA 1VQ91 1Y8CA 5IP7I 3S2DI 2J6AA 4EWCA 2Q4ZA 1QYPA 4NBEA 2JNYA 1W2BY 1K9M2 3MONA 4XX2A 1I6HI 4DQYB 3CQZI 1P9NA 5C4XI 3H0GI 3RZOI 1YHQ1 2P3YA 2WAQA 1K9M1 3F3PC 2VF1A 1WCMI 2V3VA 3FKII 4E32A 4MD9A 1QVFZ 2O53A 1TWHI 3VMIA 3J80b 2QEXZ 3S1QI 4A3MI 4E31A 2JA6I 4DK1A 1X3ZA 2RHBA 1VQ8Z 1YJ91 2OTL1 2BJOA 4HH4A 1VQ7Z 4BY7I 1FDOA 3IF8A 2GTHA 1M1K2 1DL6A 3CCEZ 1Q811 4BBSI 2IV2X 2QEX1 3CD6Z 2DE6A 2M48A 1VLAA 1W2BZ 2I3CA 1M1K1 1K8A2 4A3LI 3GTLI 2VPZA 2OTJZ 4NBGA 4X6AI 4TNUA 3OW2Y 1X0TA 1VQ6Z 2OOXB 1YJN1 1VQKZ 3CME1 2VPYA 3PO3I 3MZLB 5FLXf 3KIHA 2E2II 3S17I 1Q7Y1 3CMA1 1JWHC 5LL6f 1VQN1 5IT9b 3I55Z 2OTJ1 1VQM1 3CCJ1 2K5RA 3GTGI 3HOUI 3ESWA 4NBDA 2KPIA 1VQK1 3GCFA 1JJ2Y 2LFUA 1LQLA 5A2Qb 4HGZA 1Q16A 3S2HI 2WB1A 2Q51A 4QTTA 3S1NI 3I07A 1VQ4Z 1NJI2 5T64A 2NVYI 2GTIA 4CL1A 3S1RI 3T4NB 3D2LA 3OW2Z 4AYBA 3CCUZ 1RLYA 1YHQZ 1USPA 3NDIA 4RVFA 3IFUA 3I4NI 4Y7NI 2QR1B 2ZAEB 1VQ41 1KRLA 2QRDB 2VPXA 1R9TI 2JIRA 1RO4A 1NUIA 1Z03A 3CCL1 3CC21 3D6WA 1YJ9Z 2OTLZ 3FQMA 1USPB 4NFRA 3CCU1 2HF1A
chains in the Genus database with same CATH topology
1QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXF A; 
#chains in the Genus database with same CATH topology
 2G2K A;  2AYD A;  4A3K I;  1JJ2 Z;  1ML8 A;  2O4H A;  2JIM A;  2QA4 1;  2RIQ A;  4E2W A;  2VUM I;  3EER A;  2OZK A;  3CPW Y;  2DE5 A;  2V8J A;  1KC8 2;  3HOV I;  4NBF A;  4NB9 A;  1PFT A;  1YUK A;  3I4M I;  3G4S 1;  1Q81 2;  2B63 I;  2P28 A;  1FDI A;  1TWC I;  5D1P A;  3J81 f;  2Y0S A;  1S72 1;  1KD1 1;  3NFZ A;  1Q82 2;  1KC8 1;  4BBR I;  3HOZ I;  4NB8 A;  1YJN Z;  3CME Z;  1YIT 1;  3NH4 A;  2QLV B;  2PMZ A;  3CC7 1;  2V45 A;  2JA7 I;  4QTU A;  2RPR A;  4NOZ A;  3CCM 1;  1Q82 1;  3CMA Z;  1WJ2 A;  1VQN Z;  2QRC B;  3JAM f;  1S7M A;  1VQM Z;  3CCJ Z;  1Q7Y 2;  1WW9 A;  2IZ4 A;  3CCQ 1;  1L1O C;  2LEX A;  2AKL A;  3CCR 1;  3M3Y I;  1N8R 1;  3GTP I;  3GTK I;  3CPW Z;  3F3F C;  4A3F I;  3HKZ A;  3GKQ A;  3LUS A;  5D1O B;  1QVG Y;  2NVX I;  1ZH1 A;  2IZ3 A;  4A3B I;  4A93 I;  3D9X A;  3P5J B;  1VQL Z;  2VPW A;  3NDJ A;  1YJW 1;  1N2F A;  2RBL A;  2NVT I;  4RVD A;  2PK7 A;  2R93 I;  4E2Y A;  1VQ5 1;  1X3W A;  2JUB A;  5C44 I;  3S15 I;  4A3C I;  4A3E I;  3PO2 I;  4NH1 C;  4NBC A;  1VQL 1;  3CCL Z;  3CC2 Z;  3EED A;  1RO2 A;  1RNI A;  3FQQ A;  3J7A 4;  3JAM b;  3J80 f;  1TWA I;  4MH4 A;  3VB9 A;  3G6E 1;  2VUG A;  3BG0 B;  1YIJ 1;  1TWF I;  3BG1 B;  1VQO Z;  1KQS Y;  3I56 1;  2QA4 Z;  4RS4 A;  2K3R A;  3CXC Y;  5FLX b;  3HOX I;  4S1T A;  4A3D I;  3CC4 1;  3G71 1;  1QVG Z;  1M90 1;  2R7Z I;  2E9H A;  2RT9 A;  1SIW A;  1TFI A;  3Q87 A;  3U50 C;  4E33 A;  3G4S Z;  1I50 I;  1RO0 A;  2R92 I;  2E7Z A;  5T67 A;  1K83 I;  2YAD A;  3CCV 1;  4Y52 I;  1S72 Z;  4RVH A;  1VQO 1;  1Z02 A;  2NAP A;  4NBB A;  1YI2 1;  1YIT Z;  2E2H I;  1KD1 2;  3CC7 Z;  5FLM I;  4E30 A;  2EGT A;  1ZB9 A;  3VTN A;  4NBH A;  4MXU A;  4NBA A;  3CCM Z;  3GTO I;  1ZB8 A;  2QKD A;  2KI7 B;  4MRI A;  5C3E I;  3HOW I;  2LIY A;  1TWG I;  2H85 A;  3CCQ Z;  2E2J I;  1KQS Z;  2W03 A;  3CCR Z;  5IT9 f;  1Y1W I;  2V8K A;  4E2Z A;  3CXC Z;  1RQF A;  2F4O A;  4RV9 A;  5A2Q f;  1N8R 2;  5D1O A;  3K7A I;  3S16 I;  2JA5 I;  3RZD I;  4A3G I;  4MD7 A;  1WII A;  4RVG A;  1QXF A;  1Z01 A;  4MD8 A;  1YJW Z;  1K73 2;  2R6M A;  3MZK B;  1VQ8 1;  1VQ5 Z;  3NH8 A;  1VQP Z;  2GU2 A;  2JA8 I;  3S1M I;  5T6B A;  3GTQ I;  2W04 A;  1VQ7 1;  2NVQ I;  4DGL A;  1K73 1;  3M4O I;  3NH5 A;  3PO3 S;  1QF8 A;  3CCE 1;  2JIO A;  4HGY A;  1Q86 2;  3CD6 1;  3IR7 A;  1K8A 1;  3KIF A;  3G6E Z;  3J81 b;  3CCS Z;  3S14 I;  1YIJ Z;  3HOY I;  3VMG A;  3GTJ I;  4A3J I;  3H3V J;  5C4J I;  3GTM S;  1VQP 1;  3I56 Z;  3GTM I;  1Y1V S;  1YUA A;  2F4M A;  2DE7 A;  1Q86 1;  3CC4 Z;  1Y1V I;  3G71 Z;  2JIQ A;  1VQ6 1;  1WZN A;  3TE5 B;  1I3Q I;  1NP6 A;  4E2X A;  4BY1 I;  3VMH A;  2M6N A;  4BXX I;  1M90 2;  2JMO A;  3CCS 1;  1VQ9 Z;  2YU9 I;  1QVF Y;  1SFO I;  2QRE B;  4MON A;  3CCV Z;  3QWU A;  5IP9 I;  2OOY B;  3I55 1;  1AA6 A;  1YI2 Z;  5AN9 F;  3TDH B;  5CM2 M;  2PM9 A;  2HU9 A;  2JS4 A;  3IX0 A;  4A3I I;  2JIP A;  1NJI 1;  2JR6 A;  2V8I A;  1VQ9 1;  1Y8C A;  5IP7 I;  3S2D I;  2J6A A;  4EWC A;  2Q4Z A;  1QYP A;  4NBE A;  2JNY A;  1W2B Y;  1K9M 2;  3MON A;  4XX2 A;  1I6H I;  4DQY B;  3CQZ I;  1P9N A;  5C4X I;  3H0G I;  3RZO I;  1YHQ 1;  2P3Y A;  2WAQ A;  1K9M 1;  3F3P C;  2VF1 A;  1WCM I;  2V3V A;  3FKI I;  4E32 A;  4MD9 A;  1QVF Z;  2O53 A;  1TWH I;  3VMI A;  3J80 b;  2QEX Z;  3S1Q I;  4A3M I;  4E31 A;  2JA6 I;  4DK1 A;  1X3Z A;  2RHB A;  1VQ8 Z;  1YJ9 1;  2OTL 1;  2BJO A;  4HH4 A;  1VQ7 Z;  4BY7 I;  1FDO A;  3IF8 A;  2GTH A;  1M1K 2;  1DL6 A;  3CCE Z;  1Q81 1;  4BBS I;  2IV2 X;  2QEX 1;  3CD6 Z;  2DE6 A;  2M48 A;  1VLA A;  1W2B Z;  2I3C A;  1M1K 1;  1K8A 2;  4A3L I;  3GTL I;  2VPZ A;  2OTJ Z;  4NBG A;  4X6A I;  4TNU A;  3OW2 Y;  1X0T A;  1VQ6 Z;  2OOX B;  1YJN 1;  1VQK Z;  3CME 1;  2VPY A;  3PO3 I;  3MZL B;  5FLX f;  3KIH A;  2E2I I;  3S17 I;  1Q7Y 1;  3CMA 1;  1JWH C;  5LL6 f;  1VQN 1;  5IT9 b;  3I55 Z;  2OTJ 1;  1VQM 1;  3CCJ 1;  2K5R A;  3GTG I;  3HOU I;  3ESW A;  4NBD A;  2KPI A;  1VQK 1;  3GCF A;  1JJ2 Y;  2LFU A;  1LQL A;  5A2Q b;  4HGZ A;  1Q16 A;  3S2H I;  2WB1 A;  2Q51 A;  4QTT A;  3S1N I;  3I07 A;  1VQ4 Z;  1NJI 2;  5T64 A;  2NVY I;  2GTI A;  4CL1 A;  3S1R I;  3T4N B;  3D2L A;  3OW2 Z;  4AYB A;  3CCU Z;  1RLY A;  1YHQ Z;  1USP A;  3NDI A;  4RVF A;  3IFU A;  3I4N I;  4Y7N I;  2QR1 B;  2ZAE B;  1VQ4 1;  1KRL A;  2QRD B;  2VPX A;  1R9T I;  2JIR A;  1RO4 A;  1NUI A;  1Z03 A;  3CCL 1;  3CC2 1;  3D6W A;  1YJ9 Z;  2OTL Z;  3FQM A;  1USP B;  4NFR A;  3CCU 1;  2HF1 A; 
#chains in the Genus database with same CATH homology
 1QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...