3CCU1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccu100
3CCVZ 3OW2Y 1VQOZ 2OTL1 3CCJZ 2QEXZ 3CCR1 1K9M2 1YIT1 1W2BY 3I56Z 1YIJ1 1VQ81 3CCEZ 1VQM1 1Q861 3CCRZ 3CCMZ 1K731 3CCV1 1VQO1 3CME1 1Q821 1Q812 1YIJZ 1VQ8Z 2QEX1 1NJI1 3I561 1Q7Y1 3G4S1 1M1K2 1VQP1 3CD6Z 1KD12 1JJ2Z 3CMEZ 3CCE1 1K9M1 3CXCZ 1N8R2 3CMAZ 3CCM1 1M902 1VQ5Z 3G4SZ 1VQPZ 1QVFZ 1YJ9Z 3CD61 1Q811 3CC71 3CMA1 1YJNZ 3CPWZ 1VQ51 1M1K1 1KC82 3G6E1 1K8A2 1KD11 1VQ7Z 1VQ4Z 1KQSZ 3CC7Z 1N8R1 1YJ91 1VQN1 1M901 2QA41 1JJ2Y 3CCU1 3G6EZ 3CXCY 1QVGZ 1YJN1 3CCS1 3I55Z 1VQNZ 3OW2Z 2QA4Z 1QVFY 1VQ71 3CC4Z 1VQ41 3CCUZ 1VQ91 1W2BZ 3CCQ1 3CCSZ 1VQK1 1KC81 3CCL1 1VQL1 1K8A1 3G71Z 1VQ61 3CC2Z 1VQ9Z 1YITZ 3CPWY 3I551 1YI21 2OTJ1 3CCQZ 2OTLZ 1VQKZ 3CC41 1YJW1 3CCLZ 1YHQ1 1VQLZ 1S721 1KQSY 1Q862 1VQ6Z 1K732 3CCJ1 1YI2Z 2OTJZ 1Q822 3G711 1QVGY 1NJI2 1YJWZ 1YHQZ 1VQMZ 1S72Z 3CC21 1Q7Y2
chains in the Genus database with same CATH superfamily
5C4XI 4X6AI 3OW2Y 2NAPA 3I4MI 3CCJZ 4HGZA 3VMIA 1K9M2 2AYDA 3TDHB 2JUBA 2VPYA 5FLXb 4Y7NI 1VQ81 2PK7A 4E2WA 3NDJA 2W04A 2F4MA 3CCV1 3CME1 1I6HI 1TWHI 5IT9b 1VQ8Z 2QEX1 4MD9A 1NJI1 3TE5B 1VQP1 2K5RA 3QWUA 3S15I 3MZKB 3CMEZ 3CCE1 3CXCZ 3RZDI 3I4NI 4EWCA 3VB9A 1SIWA 2KPIA 1VQPZ 4NBGA 1Z01A 1QVFZ 2IV2X 1TFIA 1VLAA 3GTQI 4A3LI 4A3BI 3CD61 4BY1I 2NVTI 3CC71 3H3VJ 3CMA1 4DK1A 3KIFA 2RT9A 5A2Qf 3S16I 1S7MA 1QF8A 2WB1A 4RVFA 3HOYI 5T64A 3CC7Z 1ZB9A 2JA5I 2JA7I 1USPA 1VQN1 1M901 4NBDA 3IR7A 2QA41 2IZ3A 1YUKA 3VMHA 2O53A 1QVGZ 3EERA 1RQFA 2OOYB 3CCS1 1RLYA 3IF8A 1VQNZ 3OW2Z 2QA4Z 3J81b 1R9TI 2VUMI 2GTIA 3CCQ1 3CCSZ 1VQK1 3PO2I 3CCL1 1VQL1 5IP9I 4E33A 2PM9A 4A3II 3GTMS 2NVYI 3FKII 3CPWY 1YI21 2J6AA 2LIYA 4E30A 3CCQZ 2OTLZ 2IZ4A 1VQKZ 3CC41 1YJW1 3CCLZ 1VQLZ 4NBEA 1S721 1KQSY 5C4JI 1YI2Z 2DE7A 2R92I 4E2YA 1NJI2 1YJWZ 3IX0A 1S72Z 3CC21 4BBRI 4NB8A 3GKQA 4MD8A 2KI7B 1DL6A 1W2BY 3NH8A 3I56Z 3S17I 4BXXI 3JAMb 5IP7I 3HOZI 1FDIA 1VQM1 2V45A 2E2HI 4A3CI 1KRLA 3VMGA 1TWCI 3NH4A 4NBAA 1ZB8A 1Q7Y1 2QKDA 4A3FI 4MH4A 3BG0B 2DE5A 2VPZA 1WIIA 2R93I 1TWAI 4NBFA 1M902 1VQ5Z 3HOVI 4CL1A 2JS4A 3LUSA 4A93I 2R7ZI 5A2Qb 1YJ9Z 2E2II 2EGTA 1I50I 3NDIA 3JAMf 1Q811 4S1TA 1YJNZ 3CPWZ 4XX2A 1M1K1 3GTPI 4NBBA 2NVQI 1VQ4Z 1KQSZ 4NBCA 1N8R1 2VPXA 3H0GI 2QLVB 3M4OI 4Y52I 2VUGA 3GTJI 2Q4ZA 1QXFA 3NFZA 3I55Z 4AYBA 3IFUA 4E32A 2E2JI 5AN9F 1W2BZ 2JIQA 2P3YA 1K8A1 4NFRA 4BY7I 2I3CA 1YITZ 3MONA 4RVGA 2M48A 3D9XA 4DQYB 1Q7Y2 4RS4A 4BBSI 1VQOZ 2OTL1 1RO4A 4RVHA 3GTOI 2PMZA 3CCR1 3EEDA 5LL6f 3I07A 4A3JI 1I3QI 2RBLA 2JA6I 2H85A 3HKZA 1Q861 1QYPA 3CCRZ 3CCMZ 1PFTA 3S2DI 2OZKA 1Q812 1N2FA 3VTNA 3I561 4A3GI 1M1K2 2F4OA 3NH5A 1Z03A 2G2KA 1LQLA 1RNIA 2R6MA 4RV9A 1N8R2 1Y1VI 2JNYA 4A3DI 3K7AI 2LEXA 5T6BA 5D1PA 2LFUA 4E2ZA 1TWFI 3GTLI 2JA8I 2JR6A 3S1NI 2YADA 3T4NB 1SFOI 3FQMA 1VQ51 3G6E1 1K8A2 3J7A4 1KD11 1VQ7Z 4HGYA 1K83I 5D1OB 1YJ91 3P5JB 3PO3I 1JJ2Y 3CCU1 3HOUI 4A3MI 3G6EZ 1YJN1 1WZNA 1Y1WI 4NBHA 3S1MI 1VQ41 3CCUZ 1VQ91 2RIQA 4MONA 2RHBA 3HOXI 3S14I 1KC81 3G71Z 1ML8A 3D2LA 1VQ61 1VQ9Z 3I551 2V8JA 1AA6A 3HOWI 2OTJ1 2V8IA 2JIRA 2RPRA 1Q862 4DGLA 5CM2M 1VQ6Z 2OTJZ 2Y0SA 3J80b 1YIT1 4NB9A 3GCFA 3CCVZ 1WJ2A 2ZAEB 1JWHC 2GU2A 2QEXZ 2HF1A 5T67A 2WAQA 2V3VA 3KIHA 1YIJ1 3GTKI 2QRDB 3CCEZ 1WCMI 3S2HI 2B63I 4QTTA 1K731 2JIMA 1VQO1 1Q821 5FLXf 4A3EI 1YIJZ 3D6WA 3F3FC 3CQZI 3G4S1 2W03A 4NOZA 2AKLA 3CD6Z 4MD7A 1KD12 1JJ2Z 1Y8CA 5IT9f 4E31A 1K9M1 4NH1C 1USPB 3CMAZ 2QR1B 3CCM1 3G4SZ 1Z02A 3J80f 3F3PC 2QREB 5C44I 2JMOA 2M6NA 3S1RI 4MXUA 3FQQA 3S1QI 2O4HA 1NUIA 1RO0A 2QRCB 1L1OC 1X3ZA 5C3EI 2DE6A 2E9HA 4E2XA 1TWGI 4RVDA 1YUAA 1WW9A 1Y1VS 3U50C 1KC82 2E7ZA 3M3YI 4A3KI 1P9NA 3GTGI 1ZH1A 2BJOA 2VF1A 3GTMI 3CXCY 2Q51A 4TNUA 3BG1B 3ESWA 4MRIA 1QVFY 1VQ71 3CC4Z 2NVXI 2JIOA 3PO3S 2OOXB 2VPWA 5D1OA 2JIPA 1Q16A 3J81f 1NP6A 5FLMI 3CC2Z 2V8KA 2HU9A 1X0TA 1YHQ1 1FDOA 4HH4A 1K732 1RO2A 3RZOI 3CCJ1 1Q822 1X3WA 3G711 3MZLB 1QVGY 2YU9I 2GTHA 3Q87A 4QTUA 1YHQZ 1VQMZ 2K3RA 2P28A
chains in the Genus database with same CATH topology
5C4XI 4X6AI 3OW2Y 3I4MI 3CCJZ 4HGZA 3VMIA 1K9M2 3TDHB 2JUBA 5FLXb 4Y7NI 1VQ81 2PK7A 4E2WA 3NDJA 2W04A 2F4MA 3CCV1 3CME1 1I6HI 1TWHI 5IT9b 1VQ8Z 2QEX1 4MD9A 1NJI1 3TE5B 1VQP1 2K5RA 3QWUA 3S15I 3MZKB 3CMEZ 3CCE1 3CXCZ 3RZDI 3I4NI 4EWCA 3VB9A 2KPIA 1VQPZ 4NBGA 1Z01A 1QVFZ 1TFIA 1VLAA 3GTQI 4A3LI 4A3BI 3CD61 4BY1I 2NVTI 3CC71 3H3VJ 3CMA1 4DK1A 3KIFA 2RT9A 5A2Qf 3S16I 1S7MA 1QF8A 2WB1A 4RVFA 3HOYI 5T64A 3CC7Z 1ZB9A 2JA5I 2JA7I 1USPA 1VQN1 1M901 4NBDA 2QA41 2IZ3A 1YUKA 3VMHA 2O53A 1QVGZ 3EERA 1RQFA 2OOYB 3CCS1 1RLYA 3IF8A 1VQNZ 3OW2Z 2QA4Z 3J81b 1R9TI 2VUMI 2GTIA 3CCQ1 3CCSZ 1VQK1 3PO2I 3CCL1 1VQL1 5IP9I 4E33A 2PM9A 4A3II 3GTMS 2NVYI 3FKII 3CPWY 1YI21 2J6AA 2LIYA 4E30A 3CCQZ 2OTLZ 2IZ4A 1VQKZ 3CC41 1YJW1 3CCLZ 1VQLZ 4NBEA 1S721 1KQSY 5C4JI 1YI2Z 2DE7A 2R92I 4E2YA 1NJI2 1YJWZ 3IX0A 1S72Z 3CC21 4BBRI 4NB8A 3GKQA 4MD8A 2KI7B 1DL6A 1W2BY 3NH8A 3I56Z 3S17I 4BXXI 3JAMb 5IP7I 3HOZI 1VQM1 2E2HI 4A3CI 1KRLA 3VMGA 1TWCI 3NH4A 4NBAA 1ZB8A 1Q7Y1 2QKDA 4A3FI 4MH4A 3BG0B 2DE5A 1WIIA 2R93I 1TWAI 4NBFA 1M902 1VQ5Z 3HOVI 4CL1A 2JS4A 3LUSA 4A93I 2R7ZI 5A2Qb 1YJ9Z 2E2II 2EGTA 1I50I 3NDIA 3JAMf 1Q811 4S1TA 1YJNZ 3CPWZ 4XX2A 1M1K1 3GTPI 4NBBA 2NVQI 1VQ4Z 1KQSZ 4NBCA 1N8R1 3H0GI 2QLVB 3M4OI 4Y52I 2VUGA 3GTJI 2Q4ZA 3NFZA 3I55Z 4AYBA 3IFUA 4E32A 2E2JI 5AN9F 1W2BZ 2P3YA 1K8A1 4NFRA 4BY7I 2I3CA 1YITZ 3MONA 4RVGA 2M48A 3D9XA 4DQYB 1Q7Y2 4RS4A 4BBSI 1VQOZ 2OTL1 1RO4A 4RVHA 3GTOI 2PMZA 3CCR1 3EEDA 5LL6f 3I07A 4A3JI 1I3QI 2RBLA 2JA6I 2H85A 3HKZA 1Q861 1QYPA 3CCRZ 3CCMZ 1PFTA 3S2DI 2OZKA 1Q812 1N2FA 3VTNA 3I561 4A3GI 1M1K2 2F4OA 3NH5A 1Z03A 2G2KA 1LQLA 1RNIA 2R6MA 4RV9A 1N8R2 1Y1VI 2JNYA 4A3DI 3K7AI 5T6BA 5D1PA 2LFUA 4E2ZA 1TWFI 3GTLI 2JA8I 2JR6A 3S1NI 2YADA 3T4NB 1SFOI 3FQMA 1VQ51 3G6E1 1K8A2 3J7A4 1KD11 1VQ7Z 4HGYA 1K83I 5D1OB 1YJ91 3P5JB 3PO3I 1JJ2Y 3CCU1 3HOUI 4A3MI 3G6EZ 1YJN1 1Y1WI 4NBHA 3S1MI 1VQ41 3CCUZ 1VQ91 2RIQA 4MONA 2RHBA 3HOXI 3S14I 1KC81 3G71Z 1ML8A 1VQ61 1VQ9Z 3I551 2V8JA 3HOWI 2OTJ1 2V8IA 2RPRA 1Q862 4DGLA 5CM2M 1VQ6Z 2OTJZ 2Y0SA 3J80b 1YIT1 4NB9A 3GCFA 3CCVZ 2ZAEB 1JWHC 2GU2A 2QEXZ 2HF1A 5T67A 2WAQA 3KIHA 1YIJ1 3GTKI 2QRDB 3CCEZ 1WCMI 3S2HI 2B63I 4QTTA 1K731 1VQO1 1Q821 5FLXf 4A3EI 1YIJZ 3D6WA 3F3FC 3CQZI 3G4S1 2W03A 4NOZA 2AKLA 3CD6Z 4MD7A 1KD12 1JJ2Z 5IT9f 4E31A 1K9M1 4NH1C 1USPB 3CMAZ 2QR1B 3CCM1 3G4SZ 1Z02A 3J80f 3F3PC 3S1RI 2QREB 2JMOA 2M6NA 5C44I 4MXUA 3FQQA 3S1QI 2O4HA 1NUIA 1RO0A 2QRCB 1L1OC 1X3ZA 5C3EI 2DE6A 2E9HA 4E2XA 1TWGI 4RVDA 1YUAA 1WW9A 1Y1VS 3U50C 1KC82 3M3YI 4A3KI 1P9NA 3GTGI 1ZH1A 2BJOA 2VF1A 3GTMI 3CXCY 2Q51A 4TNUA 3BG1B 3ESWA 4MRIA 1QVFY 1VQ71 3CC4Z 2NVXI 3PO3S 2OOXB 5D1OA 3J81f 1NP6A 5FLMI 3CC2Z 2V8KA 2HU9A 1X0TA 1YHQ1 4HH4A 1K732 1RO2A 3RZOI 3CCJ1 1Q822 1X3WA 3G711 3MZLB 1QVGY 2YU9I 2GTHA 3Q87A 4QTUA 1YHQZ 1VQMZ 2K3RA 2P28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Z;  3OW2 Y;  1VQO Z;  2OTL 1;  3CCJ Z;  2QEX Z;  3CCR 1;  1K9M 2;  1YIT 1;  1W2B Y;  3I56 Z;  1YIJ 1;  1VQ8 1;  3CCE Z;  1VQM 1;  1Q86 1;  3CCR Z;  3CCM Z;  1K73 1;  3CCV 1;  1VQO 1;  3CME 1;  1Q82 1;  1Q81 2;  1YIJ Z;  1VQ8 Z;  2QEX 1;  1NJI 1;  3I56 1;  1Q7Y 1;  3G4S 1;  1M1K 2;  1VQP 1;  3CD6 Z;  1KD1 2;  1JJ2 Z;  3CME Z;  3CCE 1;  1K9M 1;  3CXC Z;  1N8R 2;  3CMA Z;  3CCM 1;  1M90 2;  1VQ5 Z;  3G4S Z;  1VQP Z;  1QVF Z;  1YJ9 Z;  3CD6 1;  1Q81 1;  3CC7 1;  3CMA 1;  1YJN Z;  3CPW Z;  1VQ5 1;  1M1K 1;  1KC8 2;  3G6E 1;  1K8A 2;  1KD1 1;  1VQ7 Z;  1VQ4 Z;  1KQS Z;  3CC7 Z;  1N8R 1;  1YJ9 1;  1VQN 1;  1M90 1;  2QA4 1;  1JJ2 Y;  3CCU 1;  3G6E Z;  3CXC Y;  1QVG Z;  1YJN 1;  3CCS 1;  3I55 Z;  1VQN Z;  3OW2 Z;  2QA4 Z;  1QVF Y;  1VQ7 1;  3CC4 Z;  1VQ4 1;  3CCU Z;  1VQ9 1;  1W2B Z;  3CCQ 1;  3CCS Z;  1VQK 1;  1KC8 1;  3CCL 1;  1VQL 1;  1K8A 1;  3G71 Z;  1VQ6 1;  3CC2 Z;  1VQ9 Z;  1YIT Z;  3CPW Y;  3I55 1;  1YI2 1;  2OTJ 1;  3CCQ Z;  2OTL Z;  1VQK Z;  3CC4 1;  1YJW 1;  3CCL Z;  1YHQ 1;  1VQL Z;  1S72 1;  1KQS Y;  1Q86 2;  1VQ6 Z;  1K73 2;  3CCJ 1;  1YI2 Z;  2OTJ Z;  1Q82 2;  3G71 1;  1QVG Y;  1NJI 2;  1YJW Z;  1YHQ Z;  1VQM Z;  1S72 Z;  3CC2 1;  1Q7Y 2; 
#chains in the Genus database with same CATH topology
 5C4X I;  4X6A I;  3OW2 Y;  2NAP A;  3I4M I;  3CCJ Z;  4HGZ A;  3VMI A;  1K9M 2;  2AYD A;  3TDH B;  2JUB A;  2VPY A;  5FLX b;  4Y7N I;  1VQ8 1;  2PK7 A;  4E2W A;  3NDJ A;  2W04 A;  2F4M A;  3CCV 1;  3CME 1;  1I6H I;  1TWH I;  5IT9 b;  1VQ8 Z;  2QEX 1;  4MD9 A;  1NJI 1;  3TE5 B;  1VQP 1;  2K5R A;  3QWU A;  3S15 I;  3MZK B;  3CME Z;  3CCE 1;  3CXC Z;  3RZD I;  3I4N I;  4EWC A;  3VB9 A;  1SIW A;  2KPI A;  1VQP Z;  4NBG A;  1Z01 A;  1QVF Z;  2IV2 X;  1TFI A;  1VLA A;  3GTQ I;  4A3L I;  4A3B I;  3CD6 1;  4BY1 I;  2NVT I;  3CC7 1;  3H3V J;  3CMA 1;  4DK1 A;  3KIF A;  2RT9 A;  5A2Q f;  3S16 I;  1S7M A;  1QF8 A;  2WB1 A;  4RVF A;  3HOY I;  5T64 A;  3CC7 Z;  1ZB9 A;  2JA5 I;  2JA7 I;  1USP A;  1VQN 1;  1M90 1;  4NBD A;  3IR7 A;  2QA4 1;  2IZ3 A;  1YUK A;  3VMH A;  2O53 A;  1QVG Z;  3EER A;  1RQF A;  2OOY B;  3CCS 1;  1RLY A;  3IF8 A;  1VQN Z;  3OW2 Z;  2QA4 Z;  3J81 b;  1R9T I;  2VUM I;  2GTI A;  3CCQ 1;  3CCS Z;  1VQK 1;  3PO2 I;  3CCL 1;  1VQL 1;  5IP9 I;  4E33 A;  2PM9 A;  4A3I I;  3GTM S;  2NVY I;  3FKI I;  3CPW Y;  1YI2 1;  2J6A A;  2LIY A;  4E30 A;  3CCQ Z;  2OTL Z;  2IZ4 A;  1VQK Z;  3CC4 1;  1YJW 1;  3CCL Z;  1VQL Z;  4NBE A;  1S72 1;  1KQS Y;  5C4J I;  1YI2 Z;  2DE7 A;  2R92 I;  4E2Y A;  1NJI 2;  1YJW Z;  3IX0 A;  1S72 Z;  3CC2 1;  4BBR I;  4NB8 A;  3GKQ A;  4MD8 A;  2KI7 B;  1DL6 A;  1W2B Y;  3NH8 A;  3I56 Z;  3S17 I;  4BXX I;  3JAM b;  5IP7 I;  3HOZ I;  1FDI A;  1VQM 1;  2V45 A;  2E2H I;  4A3C I;  1KRL A;  3VMG A;  1TWC I;  3NH4 A;  4NBA A;  1ZB8 A;  1Q7Y 1;  2QKD A;  4A3F I;  4MH4 A;  3BG0 B;  2DE5 A;  2VPZ A;  1WII A;  2R93 I;  1TWA I;  4NBF A;  1M90 2;  1VQ5 Z;  3HOV I;  4CL1 A;  2JS4 A;  3LUS A;  4A93 I;  2R7Z I;  5A2Q b;  1YJ9 Z;  2E2I I;  2EGT A;  1I50 I;  3NDI A;  3JAM f;  1Q81 1;  4S1T A;  1YJN Z;  3CPW Z;  4XX2 A;  1M1K 1;  3GTP I;  4NBB A;  2NVQ I;  1VQ4 Z;  1KQS Z;  4NBC A;  1N8R 1;  2VPX A;  3H0G I;  2QLV B;  3M4O I;  4Y52 I;  2VUG A;  3GTJ I;  2Q4Z A;  1QXF A;  3NFZ A;  3I55 Z;  4AYB A;  3IFU A;  4E32 A;  2E2J I;  5AN9 F;  1W2B Z;  2JIQ A;  2P3Y A;  1K8A 1;  4NFR A;  4BY7 I;  2I3C A;  1YIT Z;  3MON A;  4RVG A;  2M48 A;  3D9X A;  4DQY B;  1Q7Y 2;  4RS4 A;  4BBS I;  1VQO Z;  2OTL 1;  1RO4 A;  4RVH A;  3GTO I;  2PMZ A;  3CCR 1;  3EED A;  5LL6 f;  3I07 A;  4A3J I;  1I3Q I;  2RBL A;  2JA6 I;  2H85 A;  3HKZ A;  1Q86 1;  1QYP A;  3CCR Z;  3CCM Z;  1PFT A;  3S2D I;  2OZK A;  1Q81 2;  1N2F A;  3VTN A;  3I56 1;  4A3G I;  1M1K 2;  2F4O A;  3NH5 A;  1Z03 A;  2G2K A;  1LQL A;  1RNI A;  2R6M A;  4RV9 A;  1N8R 2;  1Y1V I;  2JNY A;  4A3D I;  3K7A I;  2LEX A;  5T6B A;  5D1P A;  2LFU A;  4E2Z A;  1TWF I;  3GTL I;  2JA8 I;  2JR6 A;  3S1N I;  2YAD A;  3T4N B;  1SFO I;  3FQM A;  1VQ5 1;  3G6E 1;  1K8A 2;  3J7A 4;  1KD1 1;  1VQ7 Z;  4HGY A;  1K83 I;  5D1O B;  1YJ9 1;  3P5J B;  3PO3 I;  1JJ2 Y;  3CCU 1;  3HOU I;  4A3M I;  3G6E Z;  1YJN 1;  1WZN A;  1Y1W I;  4NBH A;  3S1M I;  1VQ4 1;  3CCU Z;  1VQ9 1;  2RIQ A;  4MON A;  2RHB A;  3HOX I;  3S14 I;  1KC8 1;  3G71 Z;  1ML8 A;  3D2L A;  1VQ6 1;  1VQ9 Z;  3I55 1;  2V8J A;  1AA6 A;  3HOW I;  2OTJ 1;  2V8I A;  2JIR A;  2RPR A;  1Q86 2;  4DGL A;  5CM2 M;  1VQ6 Z;  2OTJ Z;  2Y0S A;  3J80 b;  1YIT 1;  4NB9 A;  3GCF A;  3CCV Z;  1WJ2 A;  2ZAE B;  1JWH C;  2GU2 A;  2QEX Z;  2HF1 A;  5T67 A;  2WAQ A;  2V3V A;  3KIH A;  1YIJ 1;  3GTK I;  2QRD B;  3CCE Z;  1WCM I;  3S2H I;  2B63 I;  4QTT A;  1K73 1;  2JIM A;  1VQO 1;  1Q82 1;  5FLX f;  4A3E I;  1YIJ Z;  3D6W A;  3F3F C;  3CQZ I;  3G4S 1;  2W03 A;  4NOZ A;  2AKL A;  3CD6 Z;  4MD7 A;  1KD1 2;  1JJ2 Z;  1Y8C A;  5IT9 f;  4E31 A;  1K9M 1;  4NH1 C;  1USP B;  3CMA Z;  2QR1 B;  3CCM 1;  3G4S Z;  1Z02 A;  3J80 f;  3F3P C;  2QRE B;  5C44 I;  2JMO A;  2M6N A;  3S1R I;  4MXU A;  3FQQ A;  3S1Q I;  2O4H A;  1NUI A;  1RO0 A;  2QRC B;  1L1O C;  1X3Z A;  5C3E I;  2DE6 A;  2E9H A;  4E2X A;  1TWG I;  4RVD A;  1YUA A;  1WW9 A;  1Y1V S;  3U50 C;  1KC8 2;  2E7Z A;  3M3Y I;  4A3K I;  1P9N A;  3GTG I;  1ZH1 A;  2BJO A;  2VF1 A;  3GTM I;  3CXC Y;  2Q51 A;  4TNU A;  3BG1 B;  3ESW A;  4MRI A;  1QVF Y;  1VQ7 1;  3CC4 Z;  2NVX I;  2JIO A;  3PO3 S;  2OOX B;  2VPW A;  5D1O A;  2JIP A;  1Q16 A;  3J81 f;  1NP6 A;  5FLM I;  3CC2 Z;  2V8K A;  2HU9 A;  1X0T A;  1YHQ 1;  1FDO A;  4HH4 A;  1K73 2;  1RO2 A;  3RZO I;  3CCJ 1;  1Q82 2;  1X3W A;  3G71 1;  3MZL B;  1QVG Y;  2YU9 I;  2GTH A;  3Q87 A;  4QTU A;  1YHQ Z;  1VQM Z;  2K3R A;  2P28 A; 
#chains in the Genus database with same CATH homology
 5C4X I;  4X6A I;  3OW2 Y;  3I4M I;  3CCJ Z;  4HGZ A;  3VMI A;  1K9M 2;  3TDH B;  2JUB A;  5FLX b;  4Y7N I;  1VQ8 1;  2PK7 A;  4E2W A;  3NDJ A;  2W04 A;  2F4M A;  3CCV 1;  3CME 1;  1I6H I;  1TWH I;  5IT9 b;  1VQ8 Z;  2QEX 1;  4MD9 A;  1NJI 1;  3TE5 B;  1VQP 1;  2K5R A;  3QWU A;  3S15 I;  3MZK B;  3CME Z;  3CCE 1;  3CXC Z;  3RZD I;  3I4N I;  4EWC A;  3VB9 A;  2KPI A;  1VQP Z;  4NBG A;  1Z01 A;  1QVF Z;  1TFI A;  1VLA A;  3GTQ I;  4A3L I;  4A3B I;  3CD6 1;  4BY1 I;  2NVT I;  3CC7 1;  3H3V J;  3CMA 1;  4DK1 A;  3KIF A;  2RT9 A;  5A2Q f;  3S16 I;  1S7M A;  1QF8 A;  2WB1 A;  4RVF A;  3HOY I;  5T64 A;  3CC7 Z;  1ZB9 A;  2JA5 I;  2JA7 I;  1USP A;  1VQN 1;  1M90 1;  4NBD A;  2QA4 1;  2IZ3 A;  1YUK A;  3VMH A;  2O53 A;  1QVG Z;  3EER A;  1RQF A;  2OOY B;  3CCS 1;  1RLY A;  3IF8 A;  1VQN Z;  3OW2 Z;  2QA4 Z;  3J81 b;  1R9T I;  2VUM I;  2GTI A;  3CCQ 1;  3CCS Z;  1VQK 1;  3PO2 I;  3CCL 1;  1VQL 1;  5IP9 I;  4E33 A;  2PM9 A;  4A3I I;  3GTM S;  2NVY I;  3FKI I;  3CPW Y;  1YI2 1;  2J6A A;  2LIY A;  4E30 A;  3CCQ Z;  2OTL Z;  2IZ4 A;  1VQK Z;  3CC4 1;  1YJW 1;  3CCL Z;  1VQL Z;  4NBE A;  1S72 1;  1KQS Y;  5C4J I;  1YI2 Z;  2DE7 A;  2R92 I;  4E2Y A;  1NJI 2;  1YJW Z;  3IX0 A;  1S72 Z;  3CC2 1;  4BBR I;  4NB8 A;  3GKQ A;  4MD8 A;  2KI7 B;  1DL6 A;  1W2B Y;  3NH8 A;  3I56 Z;  3S17 I;  4BXX I;  3JAM b;  5IP7 I;  3HOZ I;  1VQM 1;  2E2H I;  4A3C I;  1KRL A;  3VMG A;  1TWC I;  3NH4 A;  4NBA A;  1ZB8 A;  1Q7Y 1;  2QKD A;  4A3F I;  4MH4 A;  3BG0 B;  2DE5 A;  1WII A;  2R93 I;  1TWA I;  4NBF A;  1M90 2;  1VQ5 Z;  3HOV I;  4CL1 A;  2JS4 A;  3LUS A;  4A93 I;  2R7Z I;  5A2Q b;  1YJ9 Z;  2E2I I;  2EGT A;  1I50 I;  3NDI A;  3JAM f;  1Q81 1;  4S1T A;  1YJN Z;  3CPW Z;  4XX2 A;  1M1K 1;  3GTP I;  4NBB A;  2NVQ I;  1VQ4 Z;  1KQS Z;  4NBC A;  1N8R 1;  3H0G I;  2QLV B;  3M4O I;  4Y52 I;  2VUG A;  3GTJ I;  2Q4Z A;  3NFZ A;  3I55 Z;  4AYB A;  3IFU A;  4E32 A;  2E2J I;  5AN9 F;  1W2B Z;  2P3Y A;  1K8A 1;  4NFR A;  4BY7 I;  2I3C A;  1YIT Z;  3MON A;  4RVG A;  2M48 A;  3D9X A;  4DQY B;  1Q7Y 2;  4RS4 A;  4BBS I;  1VQO Z;  2OTL 1;  1RO4 A;  4RVH A;  3GTO I;  2PMZ A;  3CCR 1;  3EED A;  5LL6 f;  3I07 A;  4A3J I;  1I3Q I;  2RBL A;  2JA6 I;  2H85 A;  3HKZ A;  1Q86 1;  1QYP A;  3CCR Z;  3CCM Z;  1PFT A;  3S2D I;  2OZK A;  1Q81 2;  1N2F A;  3VTN A;  3I56 1;  4A3G I;  1M1K 2;  2F4O A;  3NH5 A;  1Z03 A;  2G2K A;  1LQL A;  1RNI A;  2R6M A;  4RV9 A;  1N8R 2;  1Y1V I;  2JNY A;  4A3D I;  3K7A I;  5T6B A;  5D1P A;  2LFU A;  4E2Z A;  1TWF I;  3GTL I;  2JA8 I;  2JR6 A;  3S1N I;  2YAD A;  3T4N B;  1SFO I;  3FQM A;  1VQ5 1;  3G6E 1;  1K8A 2;  3J7A 4;  1KD1 1;  1VQ7 Z;  4HGY A;  1K83 I;  5D1O B;  1YJ9 1;  3P5J B;  3PO3 I;  1JJ2 Y;  3CCU 1;  3HOU I;  4A3M I;  3G6E Z;  1YJN 1;  1Y1W I;  4NBH A;  3S1M I;  1VQ4 1;  3CCU Z;  1VQ9 1;  2RIQ A;  4MON A;  2RHB A;  3HOX I;  3S14 I;  1KC8 1;  3G71 Z;  1ML8 A;  1VQ6 1;  1VQ9 Z;  3I55 1;  2V8J A;  3HOW I;  2OTJ 1;  2V8I A;  2RPR A;  1Q86 2;  4DGL A;  5CM2 M;  1VQ6 Z;  2OTJ Z;  2Y0S A;  3J80 b;  1YIT 1;  4NB9 A;  3GCF A;  3CCV Z;  2ZAE B;  1JWH C;  2GU2 A;  2QEX Z;  2HF1 A;  5T67 A;  2WAQ A;  3KIH A;  1YIJ 1;  3GTK I;  2QRD B;  3CCE Z;  1WCM I;  3S2H I;  2B63 I;  4QTT A;  1K73 1;  1VQO 1;  1Q82 1;  5FLX f;  4A3E I;  1YIJ Z;  3D6W A;  3F3F C;  3CQZ I;  3G4S 1;  2W03 A;  4NOZ A;  2AKL A;  3CD6 Z;  4MD7 A;  1KD1 2;  1JJ2 Z;  5IT9 f;  4E31 A;  1K9M 1;  4NH1 C;  1USP B;  3CMA Z;  2QR1 B;  3CCM 1;  3G4S Z;  1Z02 A;  3J80 f;  3F3P C;  3S1R I;  2QRE B;  2JMO A;  2M6N A;  5C44 I;  4MXU A;  3FQQ A;  3S1Q I;  2O4H A;  1NUI A;  1RO0 A;  2QRC B;  1L1O C;  1X3Z A;  5C3E I;  2DE6 A;  2E9H A;  4E2X A;  1TWG I;  4RVD A;  1YUA A;  1WW9 A;  1Y1V S;  3U50 C;  1KC8 2;  3M3Y I;  4A3K I;  1P9N A;  3GTG I;  1ZH1 A;  2BJO A;  2VF1 A;  3GTM I;  3CXC Y;  2Q51 A;  4TNU A;  3BG1 B;  3ESW A;  4MRI A;  1QVF Y;  1VQ7 1;  3CC4 Z;  2NVX I;  3PO3 S;  2OOX B;  5D1O A;  3J81 f;  1NP6 A;  5FLM I;  3CC2 Z;  2V8K A;  2HU9 A;  1X0T A;  1YHQ 1;  4HH4 A;  1K73 2;  1RO2 A;  3RZO I;  3CCJ 1;  1Q82 2;  1X3W A;  3G71 1;  3MZL B;  1QVG Y;  2YU9 I;  2GTH A;  3Q87 A;  4QTU A;  1YHQ Z;  1VQM Z;  2K3R A;  2P28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...