3CCU1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccu100
1KD12 3CCJZ 3CC2Z 1VQK1 1VQPZ 3CCMZ 1Q822 1VQL1 2OTL1 1QVFZ 3CXCZ 3CC41 1QVGZ 1VQ51 1K9M2 3G71Z 1YHQ1 1VQOZ 3G6E1 3CD6Z 3CC7Z 1VQM1 3OW2Z 1KD11 1KQSZ 1YIT1 3CPWZ 3CCV1 1Q821 1VQ41 1K8A1 1QVGY 3CMA1 1Q812 1K731 1NJI2 3CCJ1 3CC21 2OTJZ 1VQP1 3CCM1 1M901 1M1K2 1VQNZ 3CCEZ 3CCSZ 3G711 1Q861 1KC82 1VQO1 1N8R2 3CCQZ 3I56Z 3I55Z 3CD61 3CC71 1VQ7Z 1VQ9Z 3CMEZ 1Q7Y2 1YJNZ 3CCUZ 2QEXZ 1QVFY 3CXCY 1S72Z 2OTJ1 1K9M1 1VQ6Z 1VQN1 1KC81 1W2BZ 3CCE1 2QA4Z 3OW2Y 3CCS1 1YI2Z 1KQSY 3CCLZ 1YIJZ 1VQ8Z 3CCQ1 3G4SZ 3I561 3CCRZ 3CPWY 3I551 1VQ71 1YJ9Z 1VQ91 3CME1 1Q811 1YJN1 1NJI1 3CCU1 1YJWZ 1JJ2Z 1M1K1 2QEX1 1VQKZ 1W2BY 1S721 1VQLZ 2OTLZ 1K8A2 3CC4Z 1VQ5Z 1K732 1VQ61 1N8R1 1YHQZ 1M902 2QA41 3G6EZ 1YI21 1Q7Y1 1VQMZ 3CCL1 1YIJ1 1JJ2Y 1VQ81 1Q862 3G4S1 3CCR1 1YJ91 1YITZ 3CCVZ 1VQ4Z 3CMAZ 1YJW1
chains in the Genus database with same CATH superfamily
3HOUI 5IT9b 5D1OA 1VQL1 3U50C 3J80b 3NFZA 3CC41 1RLYA 1YUKA 2V8IA 2JIOA 1VQOZ 2QLVB 3GCFA 3NH5A 2E2II 4NBFA 4BBRI 3GTPI 3MZLB 2JA6I 4AYBA 1WZNA 3PO2I 1NP6A 1QVGY 3CMA1 1TWAI 1K731 4A3DI 1NJI2 1DL6A 4A3FI 3I4NI 3T4NB 1I3QI 1M1K2 3GTMS 2M6NA 1ZB8A 1SIWA 1WCMI 1S7MA 1WJ2A 2PM9A 2K5RA 2R93I 3GTKI 1VQO1 2B63I 2R7ZI 3I56Z 3I55Z 4A3MI 1VQ9Z 5CM2M 5C44I 5T67A 4MRIA 2QEXZ 2QREB 1USPB 1KRLA 2H85A 2I3CA 1Y1WI 2KPIA 1K9M1 3FKII 3NH4A 1WW9A 2VPXA 1KC81 4A3LI 4E33A 2JUBA 5A2Qf 3D6WA 2QRCB 3I561 2JA5I 3HOVI 3I551 2VPWA 3BG1B 1YJ9Z 1VQ91 4DK1A 1YUAA 2VPYA 4DGLA 1ZB9A 1YJWZ 2QEX1 4E2ZA 2W03A 5IP9I 2YADA 4NFRA 3VMHA 1K732 1VQ5Z 1RO4A 1I50I 4E2XA 1AA6A 3CQZI 5T64A 3G6EZ 3IF8A 3BG0B 1VQMZ 2P28A 3S14I 1YJ91 1YITZ 2JIMA 1VQ4Z 4NBGA 1YJW1 4NB8A 1KD12 3CCJZ 4E2YA 1Q822 2VF1A 2NVQI 4BXXI 1QVGZ 3TE5B 1VQ51 3KIFA 1QF8A 1K9M2 4A3BI 1QYPA 5FLMI 3G6E1 4Y52I 3CC7Z 1VQM1 3H0GI 3OW2Z 3PO3I 2IZ4A 1YIT1 3D2LA 1VQ41 3P5JB 4RVGA 4NBDA 3GTOI 3CCJ1 3VB9A 2OTJZ 1WIIA 2G2KA 3CCEZ 4NBAA 5FLXf 5IT9f 3JAMb 1Q861 3J80f 1Z02A 1N2FA 3CC71 2JMOA 4NBEA 3CMEZ 3PO3S 2AYDA 2NVXI 4HH4A 2RT9A 4A3KI 1S72Z 4EWCA 2OTJ1 3MZKB 2RPRA 3S1NI 2DE5A 2DE7A 3CCE1 2QA4Z 3OW2Y 2WAQA 1R9TI 3H3VJ 1YIJZ 3D9XA 1ML8A 3G4SZ 4A93I 3S2HI 3CME1 4E32A 2E2HI 2GTHA 3HOZI 4HGZA 3EERA 3VMIA 1VQKZ 1W2BY 5C4JI 3GTGI 1S721 4TNUA 3GTJI 3FQQA 5C4XI 2V8KA 3FQMA 2OOXB 1YHQZ 2QA41 2OOYB 1Q7Y1 1YIJ1 1JJ2Y 1Q862 3G4S1 1P9NA 5C3EI 3NDIA 1TFIA 3CCVZ 2NAPA 5LL6f 3GKQA 1VQK1 3S1MI 1VQPZ 3CCMZ 4BY7I 4MD7A 4A3EI 2R6MA 3CXCZ 2PK7A 2E2JI 2V45A 1YHQ1 1I6HI 1JWHC 2JIQA 3S1RI 3CD6Z 1X0TA 3F3FC 4RS4A 1Y1VI 1KQSZ 2LEXA 1RNIA 3IFUA 1RQFA 3CCV1 2E9HA 3IR7A 4MD9A 3M3YI 2IZ3A 2J6AA 1VQP1 3CCM1 2RHBA 1M901 2Y0SA 3J81b 4RVFA 3TDHB 3GTLI 1KC82 4QTTA 2KI7B 3S16I 1X3ZA 3CD61 4NOZA 1Q7Y2 1YJNZ 4HGYA 3CCUZ 1Y1VS 3HOXI 4BBSI 1FDOA 5AN9F 3I4MI 4NB9A 3CXCY 2E7ZA 3RZDI 2QRDB 3S17I 3VTNA 3M4OI 2GTIA 2JIRA 1W2BZ 4NH1C 1YI2Z 1RO0A 4X6AI 1KQSY 3CCLZ 1VQ8Z 4E30A 2VUMI 3CCRZ 1RO2A 1Q811 1YJN1 3EEDA 1Q16A 3CCU1 1JJ2Z 5FLXb 2RIQA 3GTMI 1LQLA 2OTLZ 2Q51A 5D1PA 1N8R1 1M902 1PFTA 4MD8A 4MXUA 2F4OA 4E31A 1YI21 2ZAEB 3CCL1 1SFOI 1VQ81 3HOYI 3CCR1 2JIPA 2QR1B 3CC2Z 1TWCI 3NH8A 4Y7NI 2M48A 3QWUA 2OTL1 2JNYA 1QVFZ 1TWHI 2IV2X 2NVYI 2JR6A 3G71Z 2VUGA 5IP7I 4NBHA 1TWGI 2NVTI 1K83I 4A3GI 4E2WA 1TWFI 2QKDA 1ZH1A 1X3WA 1KD11 3VMGA 3HOWI 2LFUA 3K7AI 3CPWZ 1Q821 1K8A1 1Q812 1Y8CA 2HF1A 2PMZA 2Q4ZA 3CC21 2F4MA 1VQNZ 3HKZA 2K3RA 3F3PC 5A2Qb 3IX0A 3CCSZ 2YU9I 3G711 1N8R2 2HU9A 3GTQI 4MH4A 3CCQZ 2EGTA 2V8JA 2GU2A 4BY1I 1VQ7Z 2V3VA 3KIHA 2O53A 1Z03A 2DE6A 3I07A 1QVFY 4RV9A 4A3CI 2O4HA 3Q87A 4S1TA 2BJOA 1VQ6Z 4A3II 1VQN1 5D1OB 3MONA 1NUIA 3CCS1 3S15I 4QTUA 3RZOI 3J81f 2RBLA 3S1QI 2WB1A 4RVHA 3CCQ1 1L1OC 3CPWY 1VLAA 1QXFA 1VQ71 3J7A4 1USPA 2W04A 2LIYA 2AKLA 5T6BA 1NJI1 2OZKA 4MONA 4CL1A 1M1K1 2JA8I 3ESWA 4DQYB 1VQLZ 1FDIA 1K8A2 3CC4Z 3S2DI 1VQ61 2P3YA 4XX2A 2JA7I 4NBBA 2VPZA 3NDJA 4RVDA 1Z01A 4A3JI 4NBCA 2R92I 3JAMf 3LUSA 2JS4A 3CMAZ
chains in the Genus database with same CATH topology
3HOUI 5IT9b 5D1OA 1VQL1 3U50C 3J80b 3NFZA 3CC41 1RLYA 1YUKA 2V8IA 1VQOZ 2QLVB 3GCFA 3NH5A 2E2II 4NBFA 4BBRI 3GTPI 3MZLB 2JA6I 4AYBA 3PO2I 1NP6A 1QVGY 3CMA1 1TWAI 1K731 4A3DI 1NJI2 1DL6A 4A3FI 3I4NI 3T4NB 1I3QI 1M1K2 3GTMS 2M6NA 1ZB8A 1WCMI 1S7MA 2PM9A 2K5RA 2R93I 3GTKI 1VQO1 2B63I 2R7ZI 3I56Z 3I55Z 4A3MI 1VQ9Z 5CM2M 5C44I 5T67A 4MRIA 2QEXZ 2QREB 1USPB 1KRLA 2H85A 2I3CA 1Y1WI 2KPIA 1K9M1 3FKII 3NH4A 1WW9A 1KC81 4A3LI 4E33A 2JUBA 5A2Qf 3D6WA 2QRCB 3I561 2JA5I 3HOVI 3I551 3BG1B 1YJ9Z 1VQ91 4DK1A 1YUAA 4DGLA 1ZB9A 1YJWZ 2QEX1 4E2ZA 2W03A 5IP9I 2YADA 4NFRA 3VMHA 1K732 1VQ5Z 1RO4A 1I50I 4E2XA 3CQZI 5T64A 3G6EZ 3IF8A 3BG0B 1VQMZ 2P28A 3S14I 1YJ91 1YITZ 1VQ4Z 4NBGA 1YJW1 4NB8A 1KD12 3CCJZ 4E2YA 1Q822 2VF1A 2NVQI 4BXXI 1QVGZ 3TE5B 1VQ51 3KIFA 1QF8A 1K9M2 4A3BI 1QYPA 5FLMI 3G6E1 4Y52I 3CC7Z 1VQM1 3H0GI 3OW2Z 3PO3I 2IZ4A 1YIT1 1VQ41 3P5JB 4RVGA 4NBDA 3GTOI 3CCJ1 3VB9A 2OTJZ 1WIIA 2G2KA 3CCEZ 4NBAA 5FLXf 5IT9f 3JAMb 1Q861 3J80f 1Z02A 1N2FA 3CC71 2JMOA 4NBEA 3CMEZ 3PO3S 2NVXI 4HH4A 2RT9A 4A3KI 1S72Z 4EWCA 2OTJ1 3MZKB 2RPRA 3S1NI 2DE5A 2DE7A 3CCE1 2QA4Z 3OW2Y 2WAQA 1R9TI 3H3VJ 1YIJZ 3D9XA 1ML8A 3G4SZ 4A93I 3S2HI 3CME1 4E32A 2E2HI 2GTHA 3HOZI 4HGZA 3EERA 3VMIA 1VQKZ 1W2BY 5C4JI 3GTGI 1S721 4TNUA 3GTJI 3FQQA 5C4XI 2V8KA 3FQMA 2OOXB 1YHQZ 2QA41 2OOYB 1Q7Y1 1YIJ1 1JJ2Y 1Q862 3G4S1 1P9NA 5C3EI 3NDIA 1TFIA 3CCVZ 5LL6f 3GKQA 1VQK1 3S1MI 1VQPZ 3CCMZ 4BY7I 4MD7A 4A3EI 2R6MA 3CXCZ 2PK7A 2E2JI 1YHQ1 1I6HI 1JWHC 3S1RI 3CD6Z 1X0TA 3F3FC 4RS4A 1Y1VI 1KQSZ 1RNIA 3IFUA 1RQFA 3CCV1 2E9HA 4MD9A 3M3YI 2IZ3A 2J6AA 1VQP1 3CCM1 2RHBA 1M901 2Y0SA 3J81b 4RVFA 3TDHB 3GTLI 1KC82 4QTTA 2KI7B 3S16I 1X3ZA 3CD61 4NOZA 1Q7Y2 1YJNZ 4HGYA 3CCUZ 1Y1VS 3HOXI 4BBSI 5AN9F 3I4MI 4NB9A 3CXCY 3RZDI 2QRDB 3S17I 3VTNA 3M4OI 2GTIA 1W2BZ 4NH1C 1YI2Z 1RO0A 4X6AI 1KQSY 3CCLZ 1VQ8Z 4E30A 2VUMI 3CCRZ 1RO2A 1Q811 1YJN1 3EEDA 3CCU1 1JJ2Z 5FLXb 2RIQA 3GTMI 1LQLA 2OTLZ 2Q51A 5D1PA 1N8R1 1M902 1PFTA 4MD8A 4MXUA 2F4OA 4E31A 1YI21 2ZAEB 3CCL1 1SFOI 1VQ81 3HOYI 3CCR1 2QR1B 3CC2Z 1TWCI 3NH8A 4Y7NI 2M48A 3QWUA 2OTL1 2JNYA 1QVFZ 1TWHI 2NVYI 2JR6A 3G71Z 2VUGA 5IP7I 4NBHA 1TWGI 2NVTI 1K83I 4A3GI 4E2WA 1TWFI 2QKDA 1ZH1A 1X3WA 1KD11 3VMGA 3HOWI 2LFUA 3K7AI 3CPWZ 1Q821 1K8A1 1Q812 2PMZA 2HF1A 2Q4ZA 3CC21 2F4MA 1VQNZ 3HKZA 2K3RA 3F3PC 5A2Qb 3IX0A 3CCSZ 2YU9I 3G711 1N8R2 2HU9A 3GTQI 4MH4A 3CCQZ 2EGTA 2V8JA 2GU2A 4BY1I 1VQ7Z 3KIHA 2O53A 1Z03A 2DE6A 3I07A 1QVFY 4RV9A 4A3CI 2O4HA 3Q87A 4S1TA 2BJOA 1VQ6Z 4A3II 1VQN1 5D1OB 3MONA 1NUIA 3CCS1 3S15I 4QTUA 3RZOI 3J81f 2RBLA 3S1QI 2WB1A 4RVHA 3CCQ1 1L1OC 3CPWY 1VLAA 1VQ71 3J7A4 1USPA 2W04A 2LIYA 2AKLA 5T6BA 1NJI1 2OZKA 4MONA 4CL1A 1M1K1 2JA8I 3ESWA 4DQYB 1VQLZ 1K8A2 3CC4Z 3S2DI 1VQ61 2P3YA 4XX2A 2JA7I 4NBBA 3NDJA 4RVDA 1Z01A 4A3JI 4NBCA 2R92I 3JAMf 3LUSA 2JS4A 3CMAZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 2;  3CCJ Z;  3CC2 Z;  1VQK 1;  1VQP Z;  3CCM Z;  1Q82 2;  1VQL 1;  2OTL 1;  1QVF Z;  3CXC Z;  3CC4 1;  1QVG Z;  1VQ5 1;  1K9M 2;  3G71 Z;  1YHQ 1;  1VQO Z;  3G6E 1;  3CD6 Z;  3CC7 Z;  1VQM 1;  3OW2 Z;  1KD1 1;  1KQS Z;  1YIT 1;  3CPW Z;  3CCV 1;  1Q82 1;  1VQ4 1;  1K8A 1;  1QVG Y;  3CMA 1;  1Q81 2;  1K73 1;  1NJI 2;  3CCJ 1;  3CC2 1;  2OTJ Z;  1VQP 1;  3CCM 1;  1M90 1;  1M1K 2;  1VQN Z;  3CCE Z;  3CCS Z;  3G71 1;  1Q86 1;  1KC8 2;  1VQO 1;  1N8R 2;  3CCQ Z;  3I56 Z;  3I55 Z;  3CD6 1;  3CC7 1;  1VQ7 Z;  1VQ9 Z;  3CME Z;  1Q7Y 2;  1YJN Z;  3CCU Z;  2QEX Z;  1QVF Y;  3CXC Y;  1S72 Z;  2OTJ 1;  1K9M 1;  1VQ6 Z;  1VQN 1;  1KC8 1;  1W2B Z;  3CCE 1;  2QA4 Z;  3OW2 Y;  3CCS 1;  1YI2 Z;  1KQS Y;  3CCL Z;  1YIJ Z;  1VQ8 Z;  3CCQ 1;  3G4S Z;  3I56 1;  3CCR Z;  3CPW Y;  3I55 1;  1VQ7 1;  1YJ9 Z;  1VQ9 1;  3CME 1;  1Q81 1;  1YJN 1;  1NJI 1;  3CCU 1;  1YJW Z;  1JJ2 Z;  1M1K 1;  2QEX 1;  1VQK Z;  1W2B Y;  1S72 1;  1VQL Z;  2OTL Z;  1K8A 2;  3CC4 Z;  1VQ5 Z;  1K73 2;  1VQ6 1;  1N8R 1;  1YHQ Z;  1M90 2;  2QA4 1;  3G6E Z;  1YI2 1;  1Q7Y 1;  1VQM Z;  3CCL 1;  1YIJ 1;  1JJ2 Y;  1VQ8 1;  1Q86 2;  3G4S 1;  3CCR 1;  1YJ9 1;  1YIT Z;  3CCV Z;  1VQ4 Z;  3CMA Z;  1YJW 1; 
#chains in the Genus database with same CATH topology
 3HOU I;  5IT9 b;  5D1O A;  1VQL 1;  3U50 C;  3J80 b;  3NFZ A;  3CC4 1;  1RLY A;  1YUK A;  2V8I A;  2JIO A;  1VQO Z;  2QLV B;  3GCF A;  3NH5 A;  2E2I I;  4NBF A;  4BBR I;  3GTP I;  3MZL B;  2JA6 I;  4AYB A;  1WZN A;  3PO2 I;  1NP6 A;  1QVG Y;  3CMA 1;  1TWA I;  1K73 1;  4A3D I;  1NJI 2;  1DL6 A;  4A3F I;  3I4N I;  3T4N B;  1I3Q I;  1M1K 2;  3GTM S;  2M6N A;  1ZB8 A;  1SIW A;  1WCM I;  1S7M A;  1WJ2 A;  2PM9 A;  2K5R A;  2R93 I;  3GTK I;  1VQO 1;  2B63 I;  2R7Z I;  3I56 Z;  3I55 Z;  4A3M I;  1VQ9 Z;  5CM2 M;  5C44 I;  5T67 A;  4MRI A;  2QEX Z;  2QRE B;  1USP B;  1KRL A;  2H85 A;  2I3C A;  1Y1W I;  2KPI A;  1K9M 1;  3FKI I;  3NH4 A;  1WW9 A;  2VPX A;  1KC8 1;  4A3L I;  4E33 A;  2JUB A;  5A2Q f;  3D6W A;  2QRC B;  3I56 1;  2JA5 I;  3HOV I;  3I55 1;  2VPW A;  3BG1 B;  1YJ9 Z;  1VQ9 1;  4DK1 A;  1YUA A;  2VPY A;  4DGL A;  1ZB9 A;  1YJW Z;  2QEX 1;  4E2Z A;  2W03 A;  5IP9 I;  2YAD A;  4NFR A;  3VMH A;  1K73 2;  1VQ5 Z;  1RO4 A;  1I50 I;  4E2X A;  1AA6 A;  3CQZ I;  5T64 A;  3G6E Z;  3IF8 A;  3BG0 B;  1VQM Z;  2P28 A;  3S14 I;  1YJ9 1;  1YIT Z;  2JIM A;  1VQ4 Z;  4NBG A;  1YJW 1;  4NB8 A;  1KD1 2;  3CCJ Z;  4E2Y A;  1Q82 2;  2VF1 A;  2NVQ I;  4BXX I;  1QVG Z;  3TE5 B;  1VQ5 1;  3KIF A;  1QF8 A;  1K9M 2;  4A3B I;  1QYP A;  5FLM I;  3G6E 1;  4Y52 I;  3CC7 Z;  1VQM 1;  3H0G I;  3OW2 Z;  3PO3 I;  2IZ4 A;  1YIT 1;  3D2L A;  1VQ4 1;  3P5J B;  4RVG A;  4NBD A;  3GTO I;  3CCJ 1;  3VB9 A;  2OTJ Z;  1WII A;  2G2K A;  3CCE Z;  4NBA A;  5FLX f;  5IT9 f;  3JAM b;  1Q86 1;  3J80 f;  1Z02 A;  1N2F A;  3CC7 1;  2JMO A;  4NBE A;  3CME Z;  3PO3 S;  2AYD A;  2NVX I;  4HH4 A;  2RT9 A;  4A3K I;  1S72 Z;  4EWC A;  2OTJ 1;  3MZK B;  2RPR A;  3S1N I;  2DE5 A;  2DE7 A;  3CCE 1;  2QA4 Z;  3OW2 Y;  2WAQ A;  1R9T I;  3H3V J;  1YIJ Z;  3D9X A;  1ML8 A;  3G4S Z;  4A93 I;  3S2H I;  3CME 1;  4E32 A;  2E2H I;  2GTH A;  3HOZ I;  4HGZ A;  3EER A;  3VMI A;  1VQK Z;  1W2B Y;  5C4J I;  3GTG I;  1S72 1;  4TNU A;  3GTJ I;  3FQQ A;  5C4X I;  2V8K A;  3FQM A;  2OOX B;  1YHQ Z;  2QA4 1;  2OOY B;  1Q7Y 1;  1YIJ 1;  1JJ2 Y;  1Q86 2;  3G4S 1;  1P9N A;  5C3E I;  3NDI A;  1TFI A;  3CCV Z;  2NAP A;  5LL6 f;  3GKQ A;  1VQK 1;  3S1M I;  1VQP Z;  3CCM Z;  4BY7 I;  4MD7 A;  4A3E I;  2R6M A;  3CXC Z;  2PK7 A;  2E2J I;  2V45 A;  1YHQ 1;  1I6H I;  1JWH C;  2JIQ A;  3S1R I;  3CD6 Z;  1X0T A;  3F3F C;  4RS4 A;  1Y1V I;  1KQS Z;  2LEX A;  1RNI A;  3IFU A;  1RQF A;  3CCV 1;  2E9H A;  3IR7 A;  4MD9 A;  3M3Y I;  2IZ3 A;  2J6A A;  1VQP 1;  3CCM 1;  2RHB A;  1M90 1;  2Y0S A;  3J81 b;  4RVF A;  3TDH B;  3GTL I;  1KC8 2;  4QTT A;  2KI7 B;  3S16 I;  1X3Z A;  3CD6 1;  4NOZ A;  1Q7Y 2;  1YJN Z;  4HGY A;  3CCU Z;  1Y1V S;  3HOX I;  4BBS I;  1FDO A;  5AN9 F;  3I4M I;  4NB9 A;  3CXC Y;  2E7Z A;  3RZD I;  2QRD B;  3S17 I;  3VTN A;  3M4O I;  2GTI A;  2JIR A;  1W2B Z;  4NH1 C;  1YI2 Z;  1RO0 A;  4X6A I;  1KQS Y;  3CCL Z;  1VQ8 Z;  4E30 A;  2VUM I;  3CCR Z;  1RO2 A;  1Q81 1;  1YJN 1;  3EED A;  1Q16 A;  3CCU 1;  1JJ2 Z;  5FLX b;  2RIQ A;  3GTM I;  1LQL A;  2OTL Z;  2Q51 A;  5D1P A;  1N8R 1;  1M90 2;  1PFT A;  4MD8 A;  4MXU A;  2F4O A;  4E31 A;  1YI2 1;  2ZAE B;  3CCL 1;  1SFO I;  1VQ8 1;  3HOY I;  3CCR 1;  2JIP A;  2QR1 B;  3CC2 Z;  1TWC I;  3NH8 A;  4Y7N I;  2M48 A;  3QWU A;  2OTL 1;  2JNY A;  1QVF Z;  1TWH I;  2IV2 X;  2NVY I;  2JR6 A;  3G71 Z;  2VUG A;  5IP7 I;  4NBH A;  1TWG I;  2NVT I;  1K83 I;  4A3G I;  4E2W A;  1TWF I;  2QKD A;  1ZH1 A;  1X3W A;  1KD1 1;  3VMG A;  3HOW I;  2LFU A;  3K7A I;  3CPW Z;  1Q82 1;  1K8A 1;  1Q81 2;  1Y8C A;  2HF1 A;  2PMZ A;  2Q4Z A;  3CC2 1;  2F4M A;  1VQN Z;  3HKZ A;  2K3R A;  3F3P C;  5A2Q b;  3IX0 A;  3CCS Z;  2YU9 I;  3G71 1;  1N8R 2;  2HU9 A;  3GTQ I;  4MH4 A;  3CCQ Z;  2EGT A;  2V8J A;  2GU2 A;  4BY1 I;  1VQ7 Z;  2V3V A;  3KIH A;  2O53 A;  1Z03 A;  2DE6 A;  3I07 A;  1QVF Y;  4RV9 A;  4A3C I;  2O4H A;  3Q87 A;  4S1T A;  2BJO A;  1VQ6 Z;  4A3I I;  1VQN 1;  5D1O B;  3MON A;  1NUI A;  3CCS 1;  3S15 I;  4QTU A;  3RZO I;  3J81 f;  2RBL A;  3S1Q I;  2WB1 A;  4RVH A;  3CCQ 1;  1L1O C;  3CPW Y;  1VLA A;  1QXF A;  1VQ7 1;  3J7A 4;  1USP A;  2W04 A;  2LIY A;  2AKL A;  5T6B A;  1NJI 1;  2OZK A;  4MON A;  4CL1 A;  1M1K 1;  2JA8 I;  3ESW A;  4DQY B;  1VQL Z;  1FDI A;  1K8A 2;  3CC4 Z;  3S2D I;  1VQ6 1;  2P3Y A;  4XX2 A;  2JA7 I;  4NBB A;  2VPZ A;  3NDJ A;  4RVD A;  1Z01 A;  4A3J I;  4NBC A;  2R92 I;  3JAM f;  3LUS A;  2JS4 A;  3CMA Z; 
#chains in the Genus database with same CATH homology
 3HOU I;  5IT9 b;  5D1O A;  1VQL 1;  3U50 C;  3J80 b;  3NFZ A;  3CC4 1;  1RLY A;  1YUK A;  2V8I A;  1VQO Z;  2QLV B;  3GCF A;  3NH5 A;  2E2I I;  4NBF A;  4BBR I;  3GTP I;  3MZL B;  2JA6 I;  4AYB A;  3PO2 I;  1NP6 A;  1QVG Y;  3CMA 1;  1TWA I;  1K73 1;  4A3D I;  1NJI 2;  1DL6 A;  4A3F I;  3I4N I;  3T4N B;  1I3Q I;  1M1K 2;  3GTM S;  2M6N A;  1ZB8 A;  1WCM I;  1S7M A;  2PM9 A;  2K5R A;  2R93 I;  3GTK I;  1VQO 1;  2B63 I;  2R7Z I;  3I56 Z;  3I55 Z;  4A3M I;  1VQ9 Z;  5CM2 M;  5C44 I;  5T67 A;  4MRI A;  2QEX Z;  2QRE B;  1USP B;  1KRL A;  2H85 A;  2I3C A;  1Y1W I;  2KPI A;  1K9M 1;  3FKI I;  3NH4 A;  1WW9 A;  1KC8 1;  4A3L I;  4E33 A;  2JUB A;  5A2Q f;  3D6W A;  2QRC B;  3I56 1;  2JA5 I;  3HOV I;  3I55 1;  3BG1 B;  1YJ9 Z;  1VQ9 1;  4DK1 A;  1YUA A;  4DGL A;  1ZB9 A;  1YJW Z;  2QEX 1;  4E2Z A;  2W03 A;  5IP9 I;  2YAD A;  4NFR A;  3VMH A;  1K73 2;  1VQ5 Z;  1RO4 A;  1I50 I;  4E2X A;  3CQZ I;  5T64 A;  3G6E Z;  3IF8 A;  3BG0 B;  1VQM Z;  2P28 A;  3S14 I;  1YJ9 1;  1YIT Z;  1VQ4 Z;  4NBG A;  1YJW 1;  4NB8 A;  1KD1 2;  3CCJ Z;  4E2Y A;  1Q82 2;  2VF1 A;  2NVQ I;  4BXX I;  1QVG Z;  3TE5 B;  1VQ5 1;  3KIF A;  1QF8 A;  1K9M 2;  4A3B I;  1QYP A;  5FLM I;  3G6E 1;  4Y52 I;  3CC7 Z;  1VQM 1;  3H0G I;  3OW2 Z;  3PO3 I;  2IZ4 A;  1YIT 1;  1VQ4 1;  3P5J B;  4RVG A;  4NBD A;  3GTO I;  3CCJ 1;  3VB9 A;  2OTJ Z;  1WII A;  2G2K A;  3CCE Z;  4NBA A;  5FLX f;  5IT9 f;  3JAM b;  1Q86 1;  3J80 f;  1Z02 A;  1N2F A;  3CC7 1;  2JMO A;  4NBE A;  3CME Z;  3PO3 S;  2NVX I;  4HH4 A;  2RT9 A;  4A3K I;  1S72 Z;  4EWC A;  2OTJ 1;  3MZK B;  2RPR A;  3S1N I;  2DE5 A;  2DE7 A;  3CCE 1;  2QA4 Z;  3OW2 Y;  2WAQ A;  1R9T I;  3H3V J;  1YIJ Z;  3D9X A;  1ML8 A;  3G4S Z;  4A93 I;  3S2H I;  3CME 1;  4E32 A;  2E2H I;  2GTH A;  3HOZ I;  4HGZ A;  3EER A;  3VMI A;  1VQK Z;  1W2B Y;  5C4J I;  3GTG I;  1S72 1;  4TNU A;  3GTJ I;  3FQQ A;  5C4X I;  2V8K A;  3FQM A;  2OOX B;  1YHQ Z;  2QA4 1;  2OOY B;  1Q7Y 1;  1YIJ 1;  1JJ2 Y;  1Q86 2;  3G4S 1;  1P9N A;  5C3E I;  3NDI A;  1TFI A;  3CCV Z;  5LL6 f;  3GKQ A;  1VQK 1;  3S1M I;  1VQP Z;  3CCM Z;  4BY7 I;  4MD7 A;  4A3E I;  2R6M A;  3CXC Z;  2PK7 A;  2E2J I;  1YHQ 1;  1I6H I;  1JWH C;  3S1R I;  3CD6 Z;  1X0T A;  3F3F C;  4RS4 A;  1Y1V I;  1KQS Z;  1RNI A;  3IFU A;  1RQF A;  3CCV 1;  2E9H A;  4MD9 A;  3M3Y I;  2IZ3 A;  2J6A A;  1VQP 1;  3CCM 1;  2RHB A;  1M90 1;  2Y0S A;  3J81 b;  4RVF A;  3TDH B;  3GTL I;  1KC8 2;  4QTT A;  2KI7 B;  3S16 I;  1X3Z A;  3CD6 1;  4NOZ A;  1Q7Y 2;  1YJN Z;  4HGY A;  3CCU Z;  1Y1V S;  3HOX I;  4BBS I;  5AN9 F;  3I4M I;  4NB9 A;  3CXC Y;  3RZD I;  2QRD B;  3S17 I;  3VTN A;  3M4O I;  2GTI A;  1W2B Z;  4NH1 C;  1YI2 Z;  1RO0 A;  4X6A I;  1KQS Y;  3CCL Z;  1VQ8 Z;  4E30 A;  2VUM I;  3CCR Z;  1RO2 A;  1Q81 1;  1YJN 1;  3EED A;  3CCU 1;  1JJ2 Z;  5FLX b;  2RIQ A;  3GTM I;  1LQL A;  2OTL Z;  2Q51 A;  5D1P A;  1N8R 1;  1M90 2;  1PFT A;  4MD8 A;  4MXU A;  2F4O A;  4E31 A;  1YI2 1;  2ZAE B;  3CCL 1;  1SFO I;  1VQ8 1;  3HOY I;  3CCR 1;  2QR1 B;  3CC2 Z;  1TWC I;  3NH8 A;  4Y7N I;  2M48 A;  3QWU A;  2OTL 1;  2JNY A;  1QVF Z;  1TWH I;  2NVY I;  2JR6 A;  3G71 Z;  2VUG A;  5IP7 I;  4NBH A;  1TWG I;  2NVT I;  1K83 I;  4A3G I;  4E2W A;  1TWF I;  2QKD A;  1ZH1 A;  1X3W A;  1KD1 1;  3VMG A;  3HOW I;  2LFU A;  3K7A I;  3CPW Z;  1Q82 1;  1K8A 1;  1Q81 2;  2PMZ A;  2HF1 A;  2Q4Z A;  3CC2 1;  2F4M A;  1VQN Z;  3HKZ A;  2K3R A;  3F3P C;  5A2Q b;  3IX0 A;  3CCS Z;  2YU9 I;  3G71 1;  1N8R 2;  2HU9 A;  3GTQ I;  4MH4 A;  3CCQ Z;  2EGT A;  2V8J A;  2GU2 A;  4BY1 I;  1VQ7 Z;  3KIH A;  2O53 A;  1Z03 A;  2DE6 A;  3I07 A;  1QVF Y;  4RV9 A;  4A3C I;  2O4H A;  3Q87 A;  4S1T A;  2BJO A;  1VQ6 Z;  4A3I I;  1VQN 1;  5D1O B;  3MON A;  1NUI A;  3CCS 1;  3S15 I;  4QTU A;  3RZO I;  3J81 f;  2RBL A;  3S1Q I;  2WB1 A;  4RVH A;  3CCQ 1;  1L1O C;  3CPW Y;  1VLA A;  1VQ7 1;  3J7A 4;  1USP A;  2W04 A;  2LIY A;  2AKL A;  5T6B A;  1NJI 1;  2OZK A;  4MON A;  4CL1 A;  1M1K 1;  2JA8 I;  3ESW A;  4DQY B;  1VQL Z;  1K8A 2;  3CC4 Z;  3S2D I;  1VQ6 1;  2P3Y A;  4XX2 A;  2JA7 I;  4NBB A;  3NDJ A;  4RVD A;  1Z01 A;  4A3J I;  4NBC A;  2R92 I;  3JAM f;  3LUS A;  2JS4 A;  3CMA Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...