3CCU1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccu100
2OTJZ 3I561 3CPWZ 1N8R1 1JJ2Z 1KQSZ 3G711 1M1K1 1YHQZ 1VQ91 1YJW1 2OTJ1 1YIJZ 1YHQ1 1K731 3G4SZ 3CCLZ 3CD6Z 1VQPZ 1Q861 1K9M2 1YIJ1 3G4S1 3CCL1 3CD61 1VQP1 1QVFY 3CCMZ 1KD12 3CCUZ 1VQMZ 1N8R2 3CCM1 1M1K2 3CCU1 1VQM1 3CCVZ 1S72Z 3I55Z 1YI2Z 1K732 1NJI1 3CCEZ 1Q862 3G6EZ 3CCV1 1S721 3I551 1YI21 3CCSZ 1VQ7Z 2OTLZ 3CCE1 1M901 3G6E1 3CXCY 1W2BY 3CCS1 1Q811 1VQ71 2OTL1 3CC7Z 1K8A1 1VQKZ 3OW2Y 3CCQZ 1VQ5Z 3CC71 1VQK1 1QVGY 3CCQ1 1VQO1 1VQ51 3CCRZ 3CC41 1Q7Y1 1NJI2 3CCR1 3CXCZ 1QVFZ 1KC81 1W2BZ 1M902 1Q821 3OW2Z 2QA4Z 1K8A2 1VQ8Z 1YJ9Z 3CMEZ 1VQOZ 3CPWY 1QVGZ 2QA41 1JJ2Y 1VQ81 3CMAZ 1YJ91 1KQSY 3CC4Z 3CME1 3CC2Z 1YJNZ 1YITZ 1VQNZ 1Q7Y2 3CMA1 1VQ4Z 3CCJZ 1K9M1 1VQLZ 3CC21 1YJN1 1YIT1 1VQN1 1VQ41 2QEXZ 1KC82 1VQ6Z 3CCJ1 1VQL1 3I56Z 1Q812 2QEX1 3G71Z 1VQ61 1KD11 1Q822 1VQ9Z 1YJWZ
chains in the Genus database with same CATH superfamily
3S16I 2OTJZ 3CQZI 1JJ2Z 1KQSZ 1M1K1 2R6MA 1YHQZ 5CM2M 2IV2X 3J81b 3I07A 2OTJ1 3S1QI 1YIJZ 1YHQ1 1TWAI 3CCLZ 3CD6Z 1Q861 1YIJ1 2QREB 3CCL1 4E33A 4DGLA 1NP6A 4A3JI 3CD61 1RLYA 2Y0SA 1I50I 2JA8I 1X3WA 2QR1B 1N8R2 2B63I 4NFRA 1I3QI 3PO3S 4NB8A 1S72Z 2VPWA 3I55Z 1YI2Z 1K732 2OZKA 2Q51A 1RO4A 4NBBA 2JA5I 3G6EZ 1S721 3S2DI 3I551 1YI21 2V8KA 2QLVB 3NDIA 2IZ3A 3G6E1 4E30A 2R7ZI 2M6NA 2JS4A 1TWFI 3CC7Z 1Y8CA 5C4XI 3U50C 2P28A 3CC71 3VB9A 2K5RA 2RPRA 3GTJI 1QVGY 1USPA 3CCRZ 1TWHI 1FDOA 4NBDA 2K3RA 3M4OI 2VF1A 3CCR1 4NB9A 2VUGA 4QTUA 2O53A 2H85A 5AN9F 2JIRA 4MH4A 4E31A 4A3EI 1Y1VI 1FDIA 3F3PC 2NVXI 3T4NB 2JIOA 2HF1A 2NVYI 2VPZA 3CPWY 3GTGI 1QVGZ 4HGYA 3H0GI 2JMOA 1YJNZ 1Q7Y2 1VQ4Z 3D6WA 1VQLZ 1YJN1 3H3VJ 3VMHA 5C3EI 1VQ41 2DE7A 3GTPI 1VQL1 2QRCB 2WB1A 1Q812 4A3GI 1KD11 3GTKI 1YJWZ 3CPWZ 2V8IA 4A3CI 2J6AA 1YJW1 4RS4A 3G4SZ 4NBCA 1RQFA 2E2JI 4A3MI 1K9M2 4NBEA 5IP9I 3G4S1 1Z01A 3FQMA 1L1OC 1QVFY 1S7MA 3HOZI 1WW9A 5D1OA 5FLXf 2VPYA 4BBRI 1VQMZ 3HOXI 3TDHB 2JR6A 2V3VA 1VQM1 2W03A 1NJI1 1QYPA 4BBSI 3HOVI 2HU9A 1VQ7Z 2ZAEB 1M901 3CXCY 1Q811 1VQ71 1VQKZ 3S1NI 5LL6f 3NDJA 1VQK1 4CL1A 2GU2A 2QKDA 5C44I 2PK7A 1TWCI 3Q87A 4Y52I 2OOXB 3CXCZ 1WIIA 1WZNA 1WJ2A 3GTOI 2E9HA 4MD9A 3I4MI 2JUBA 1K8A2 3GTMI 1TWGI 3NH4A 1RO0A 4RVFA 3HOYI 3FQQA 1Q16A 3CC2Z 2E2II 3CC21 3GCFA 2NAPA 3ESWA 3S14I 1JWHC 2QEXZ 1KC82 5FLXb 3HOWI 4MONA 1N2FA 2QEX1 1Q822 2LEXA 5T67A 1N8R1 2RT9A 1VLAA 2AKLA 4DQYB 3GKQA 2KI7B 1K731 2NVQI 4TNUA 1X3ZA 4NH1C 3JAMf 3MONA 2LIYA 3MZKB 4MRIA 2YU9I 1YUKA 3NH5A 3S2HI 3D2LA 5IT9f 3CCUZ 3KIFA 3KIHA 2Q4ZA 1M1K2 4E2WA 4NBHA 3CCU1 1I6HI 4E2ZA 3RZDI 1USPB 3CCVZ 3BG1B 3VTNA 2QRDB 1TFIA 2G2KA 3CCEZ 1Q862 3CCV1 1YUAA 2OTLZ 2LFUA 4BY7I 1KRLA 3CCE1 2M48A 1W2BY 2OTL1 3TE5B 1PFTA 4A3FI 1Y1VS 4RV9A 2VPXA 2JNYA 4QTTA 3OW2Y 3CCQZ 1RNIA 2F4OA 3CCQ1 1VQO1 4BXXI 2DE5A 3CC41 3PO3I 2R93I 5A2Qf 1Q7Y1 2F4MA 1DL6A 1ZB8A 4NBAA 1R9TI 3HKZA 3J7A4 3IX0A 1QVFZ 5D1PA 1W2BZ 3S17I 3OW2Z 1VQ8Z 2RBLA 2IZ4A 3CMEZ 4S1TA 1NUIA 3JAMb 1VQ81 5IP7I 3QWUA 3GTLI 3IFUA 5T64A 3CME1 2JIQA 1P9NA 1VQNZ 2E7ZA 1K9M1 3VMIA 4A93I 5IT9b 1VQN1 2NVTI 1Z02A 2R92I 3PO2I 5D1OB 3K7AI 3I56Z 3G71Z 2RIQA 4NBGA 1VQ9Z 2EGTA 4DK1A 3I561 1ML8A 3G711 4X6AI 3MZLB 1VQ91 2P3YA 1Z03A 4A3KI 2V45A 3NFZA 4MXUA 4E2XA 4A3DI 4A3LI 1VQPZ 2DE6A 4MD8A 1Y1WI 3J80f 1QXFA 2VUMI 1VQP1 4RVHA 1SFOI 4HH4A 4AYBA 4NBFA 4HGZA 3CCMZ 1KD12 2PM9A 1QF8A 3CCM1 3IR7A 5A2Qb 3RZOI 1AA6A 3J81f 2YADA 2E2HI 2BJOA 3CCSZ 1LQLA 3S1RI 2GTIA 2JA6I 2JA7I 4NOZA 3CCS1 3IF8A 3GTMS 4BY1I 2W04A 1SIWA 4Y7NI 1K8A1 3M3YI 4RVDA 3EERA 4EWCA 3GTQI 1VQ5Z 2JIPA 1WCMI 1RO2A 2OOYB 3LUSA 2JIMA 4MD7A 3D9XA 1VQ51 3VMGA 1X0TA 1NJI2 3S15I 2RHBA 1KC81 1M902 4A3II 2V8JA 3HOUI 5C4JI 1Q821 2QA4Z 2I3CA 1ZH1A 1YJ9Z 1ZB9A 5T6BA 4XX2A 4E2YA 5FLMI 1VQOZ 2QA41 2PMZA 1JJ2Y 3CMAZ 1YJ91 1K83I 1KQSY 3CC4Z 2GTHA 2KPIA 3BG0B 4E32A 2O4HA 3J80b 1YITZ 3CMA1 3CCJZ 1YIT1 3F3FC 2AYDA 3I4NI 1VQ6Z 3CCJ1 3FKII 2WAQA 3NH8A 4RVGA 3P5JB 1VQ61 3S1MI 4A3BI 3EEDA
chains in the Genus database with same CATH topology
3S16I 2OTJZ 3CQZI 1JJ2Z 1KQSZ 1M1K1 2R6MA 1YHQZ 5CM2M 3J81b 3I07A 2OTJ1 3S1QI 1YIJZ 1YHQ1 1TWAI 3CCLZ 3CD6Z 1Q861 1YIJ1 2QREB 3CCL1 4E33A 4DGLA 1NP6A 4A3JI 3CD61 1RLYA 2Y0SA 1I50I 2JA8I 1X3WA 2QR1B 1N8R2 2B63I 4NFRA 1I3QI 3PO3S 4NB8A 1S72Z 3I55Z 1YI2Z 1K732 2OZKA 2Q51A 1RO4A 4NBBA 2JA5I 3G6EZ 1S721 3S2DI 3I551 1YI21 2V8KA 2QLVB 3NDIA 2IZ3A 3G6E1 4E30A 2R7ZI 2M6NA 2JS4A 1TWFI 3CC7Z 5C4XI 3U50C 2P28A 3CC71 3VB9A 2K5RA 2RPRA 3GTJI 1QVGY 1USPA 3CCRZ 1TWHI 4NBDA 2K3RA 3M4OI 2VF1A 3CCR1 4NB9A 2VUGA 4QTUA 2O53A 2H85A 5AN9F 4MH4A 4E31A 4A3EI 1Y1VI 3F3PC 2NVXI 3T4NB 2HF1A 2NVYI 3CPWY 3GTGI 1QVGZ 4HGYA 3H0GI 2JMOA 1YJNZ 1Q7Y2 1VQ4Z 3D6WA 1VQLZ 1YJN1 3H3VJ 3VMHA 5C3EI 1VQ41 2DE7A 3GTPI 1VQL1 2QRCB 2WB1A 1Q812 4A3GI 1KD11 3GTKI 1YJWZ 3CPWZ 2V8IA 4A3CI 2J6AA 1YJW1 4RS4A 3G4SZ 4NBCA 1RQFA 2E2JI 4A3MI 1K9M2 4NBEA 5IP9I 3G4S1 1Z01A 3FQMA 1L1OC 1QVFY 1S7MA 3HOZI 1WW9A 5D1OA 5FLXf 4BBRI 1VQMZ 3HOXI 3TDHB 2JR6A 1VQM1 2W03A 1NJI1 1QYPA 4BBSI 3HOVI 2HU9A 1VQ7Z 2ZAEB 1M901 3CXCY 1Q811 1VQ71 1VQKZ 3S1NI 5LL6f 3NDJA 1VQK1 4CL1A 2GU2A 2QKDA 5C44I 2PK7A 1TWCI 3Q87A 4Y52I 2OOXB 3CXCZ 1WIIA 3GTOI 2E9HA 4MD9A 3I4MI 2JUBA 1K8A2 3GTMI 1TWGI 3NH4A 1RO0A 4RVFA 3HOYI 3FQQA 3CC2Z 2E2II 3CC21 3GCFA 3ESWA 3S14I 1JWHC 2QEXZ 1KC82 5FLXb 3HOWI 4MONA 1N2FA 2QEX1 1Q822 5T67A 1N8R1 2RT9A 1VLAA 2AKLA 4DQYB 3GKQA 2KI7B 1K731 2NVQI 4TNUA 1X3ZA 4NH1C 3JAMf 3MONA 2LIYA 3MZKB 4MRIA 2YU9I 1YUKA 3NH5A 3S2HI 5IT9f 3CCUZ 3KIFA 3KIHA 2Q4ZA 1M1K2 4E2WA 4NBHA 3CCU1 1I6HI 4E2ZA 3RZDI 1USPB 3CCVZ 3BG1B 3VTNA 2QRDB 1TFIA 2G2KA 3CCEZ 1Q862 3CCV1 1YUAA 2OTLZ 2LFUA 4BY7I 1KRLA 3CCE1 2M48A 1W2BY 2OTL1 3TE5B 1PFTA 4A3FI 1Y1VS 4RV9A 2JNYA 4QTTA 3OW2Y 3CCQZ 1RNIA 2F4OA 3CCQ1 1VQO1 4BXXI 2DE5A 3CC41 3PO3I 2R93I 5A2Qf 1Q7Y1 2F4MA 1DL6A 1ZB8A 4NBAA 1R9TI 3HKZA 3J7A4 3IX0A 1QVFZ 5D1PA 1W2BZ 3S17I 3OW2Z 1VQ8Z 2RBLA 2IZ4A 3CMEZ 4S1TA 1NUIA 3JAMb 1VQ81 5IP7I 3QWUA 3GTLI 3IFUA 5T64A 3CME1 1P9NA 1VQNZ 1K9M1 3VMIA 4A93I 5IT9b 1VQN1 2NVTI 1Z02A 2R92I 3PO2I 5D1OB 3K7AI 3I56Z 3G71Z 2RIQA 4NBGA 1VQ9Z 2EGTA 4DK1A 3I561 1ML8A 3G711 4X6AI 3MZLB 1VQ91 2P3YA 1Z03A 4A3KI 3NFZA 4MXUA 4E2XA 4A3DI 4A3LI 1VQPZ 2DE6A 4MD8A 1Y1WI 3J80f 2VUMI 1VQP1 4RVHA 1SFOI 4HH4A 4AYBA 4NBFA 4HGZA 3CCMZ 1KD12 2PM9A 1QF8A 3CCM1 5A2Qb 3RZOI 3J81f 2YADA 2E2HI 2BJOA 3CCSZ 1LQLA 3S1RI 2GTIA 2JA6I 2JA7I 4NOZA 3CCS1 3IF8A 3GTMS 4BY1I 2W04A 4Y7NI 1K8A1 3M3YI 4RVDA 3EERA 4EWCA 3GTQI 1VQ5Z 1WCMI 1RO2A 2OOYB 3LUSA 4MD7A 3D9XA 1VQ51 3VMGA 1X0TA 1NJI2 3S15I 2RHBA 1KC81 1M902 4A3II 2V8JA 3HOUI 5C4JI 1Q821 2QA4Z 2I3CA 1ZH1A 1YJ9Z 1ZB9A 5T6BA 4XX2A 4E2YA 5FLMI 1VQOZ 2QA41 2PMZA 1JJ2Y 3CMAZ 1YJ91 1K83I 1KQSY 3CC4Z 2GTHA 2KPIA 3BG0B 4E32A 2O4HA 3J80b 1YITZ 3CMA1 3CCJZ 1YIT1 3F3FC 3I4NI 1VQ6Z 3CCJ1 3FKII 2WAQA 3NH8A 4RVGA 3P5JB 1VQ61 3S1MI 4A3BI 3EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Z;  3I56 1;  3CPW Z;  1N8R 1;  1JJ2 Z;  1KQS Z;  3G71 1;  1M1K 1;  1YHQ Z;  1VQ9 1;  1YJW 1;  2OTJ 1;  1YIJ Z;  1YHQ 1;  1K73 1;  3G4S Z;  3CCL Z;  3CD6 Z;  1VQP Z;  1Q86 1;  1K9M 2;  1YIJ 1;  3G4S 1;  3CCL 1;  3CD6 1;  1VQP 1;  1QVF Y;  3CCM Z;  1KD1 2;  3CCU Z;  1VQM Z;  1N8R 2;  3CCM 1;  1M1K 2;  3CCU 1;  1VQM 1;  3CCV Z;  1S72 Z;  3I55 Z;  1YI2 Z;  1K73 2;  1NJI 1;  3CCE Z;  1Q86 2;  3G6E Z;  3CCV 1;  1S72 1;  3I55 1;  1YI2 1;  3CCS Z;  1VQ7 Z;  2OTL Z;  3CCE 1;  1M90 1;  3G6E 1;  3CXC Y;  1W2B Y;  3CCS 1;  1Q81 1;  1VQ7 1;  2OTL 1;  3CC7 Z;  1K8A 1;  1VQK Z;  3OW2 Y;  3CCQ Z;  1VQ5 Z;  3CC7 1;  1VQK 1;  1QVG Y;  3CCQ 1;  1VQO 1;  1VQ5 1;  3CCR Z;  3CC4 1;  1Q7Y 1;  1NJI 2;  3CCR 1;  3CXC Z;  1QVF Z;  1KC8 1;  1W2B Z;  1M90 2;  1Q82 1;  3OW2 Z;  2QA4 Z;  1K8A 2;  1VQ8 Z;  1YJ9 Z;  3CME Z;  1VQO Z;  3CPW Y;  1QVG Z;  2QA4 1;  1JJ2 Y;  1VQ8 1;  3CMA Z;  1YJ9 1;  1KQS Y;  3CC4 Z;  3CME 1;  3CC2 Z;  1YJN Z;  1YIT Z;  1VQN Z;  1Q7Y 2;  3CMA 1;  1VQ4 Z;  3CCJ Z;  1K9M 1;  1VQL Z;  3CC2 1;  1YJN 1;  1YIT 1;  1VQN 1;  1VQ4 1;  2QEX Z;  1KC8 2;  1VQ6 Z;  3CCJ 1;  1VQL 1;  3I56 Z;  1Q81 2;  2QEX 1;  3G71 Z;  1VQ6 1;  1KD1 1;  1Q82 2;  1VQ9 Z;  1YJW Z; 
#chains in the Genus database with same CATH topology
 3S16 I;  2OTJ Z;  3CQZ I;  1JJ2 Z;  1KQS Z;  1M1K 1;  2R6M A;  1YHQ Z;  5CM2 M;  2IV2 X;  3J81 b;  3I07 A;  2OTJ 1;  3S1Q I;  1YIJ Z;  1YHQ 1;  1TWA I;  3CCL Z;  3CD6 Z;  1Q86 1;  1YIJ 1;  2QRE B;  3CCL 1;  4E33 A;  4DGL A;  1NP6 A;  4A3J I;  3CD6 1;  1RLY A;  2Y0S A;  1I50 I;  2JA8 I;  1X3W A;  2QR1 B;  1N8R 2;  2B63 I;  4NFR A;  1I3Q I;  3PO3 S;  4NB8 A;  1S72 Z;  2VPW A;  3I55 Z;  1YI2 Z;  1K73 2;  2OZK A;  2Q51 A;  1RO4 A;  4NBB A;  2JA5 I;  3G6E Z;  1S72 1;  3S2D I;  3I55 1;  1YI2 1;  2V8K A;  2QLV B;  3NDI A;  2IZ3 A;  3G6E 1;  4E30 A;  2R7Z I;  2M6N A;  2JS4 A;  1TWF I;  3CC7 Z;  1Y8C A;  5C4X I;  3U50 C;  2P28 A;  3CC7 1;  3VB9 A;  2K5R A;  2RPR A;  3GTJ I;  1QVG Y;  1USP A;  3CCR Z;  1TWH I;  1FDO A;  4NBD A;  2K3R A;  3M4O I;  2VF1 A;  3CCR 1;  4NB9 A;  2VUG A;  4QTU A;  2O53 A;  2H85 A;  5AN9 F;  2JIR A;  4MH4 A;  4E31 A;  4A3E I;  1Y1V I;  1FDI A;  3F3P C;  2NVX I;  3T4N B;  2JIO A;  2HF1 A;  2NVY I;  2VPZ A;  3CPW Y;  3GTG I;  1QVG Z;  4HGY A;  3H0G I;  2JMO A;  1YJN Z;  1Q7Y 2;  1VQ4 Z;  3D6W A;  1VQL Z;  1YJN 1;  3H3V J;  3VMH A;  5C3E I;  1VQ4 1;  2DE7 A;  3GTP I;  1VQL 1;  2QRC B;  2WB1 A;  1Q81 2;  4A3G I;  1KD1 1;  3GTK I;  1YJW Z;  3CPW Z;  2V8I A;  4A3C I;  2J6A A;  1YJW 1;  4RS4 A;  3G4S Z;  4NBC A;  1RQF A;  2E2J I;  4A3M I;  1K9M 2;  4NBE A;  5IP9 I;  3G4S 1;  1Z01 A;  3FQM A;  1L1O C;  1QVF Y;  1S7M A;  3HOZ I;  1WW9 A;  5D1O A;  5FLX f;  2VPY A;  4BBR I;  1VQM Z;  3HOX I;  3TDH B;  2JR6 A;  2V3V A;  1VQM 1;  2W03 A;  1NJI 1;  1QYP A;  4BBS I;  3HOV I;  2HU9 A;  1VQ7 Z;  2ZAE B;  1M90 1;  3CXC Y;  1Q81 1;  1VQ7 1;  1VQK Z;  3S1N I;  5LL6 f;  3NDJ A;  1VQK 1;  4CL1 A;  2GU2 A;  2QKD A;  5C44 I;  2PK7 A;  1TWC I;  3Q87 A;  4Y52 I;  2OOX B;  3CXC Z;  1WII A;  1WZN A;  1WJ2 A;  3GTO I;  2E9H A;  4MD9 A;  3I4M I;  2JUB A;  1K8A 2;  3GTM I;  1TWG I;  3NH4 A;  1RO0 A;  4RVF A;  3HOY I;  3FQQ A;  1Q16 A;  3CC2 Z;  2E2I I;  3CC2 1;  3GCF A;  2NAP A;  3ESW A;  3S14 I;  1JWH C;  2QEX Z;  1KC8 2;  5FLX b;  3HOW I;  4MON A;  1N2F A;  2QEX 1;  1Q82 2;  2LEX A;  5T67 A;  1N8R 1;  2RT9 A;  1VLA A;  2AKL A;  4DQY B;  3GKQ A;  2KI7 B;  1K73 1;  2NVQ I;  4TNU A;  1X3Z A;  4NH1 C;  3JAM f;  3MON A;  2LIY A;  3MZK B;  4MRI A;  2YU9 I;  1YUK A;  3NH5 A;  3S2H I;  3D2L A;  5IT9 f;  3CCU Z;  3KIF A;  3KIH A;  2Q4Z A;  1M1K 2;  4E2W A;  4NBH A;  3CCU 1;  1I6H I;  4E2Z A;  3RZD I;  1USP B;  3CCV Z;  3BG1 B;  3VTN A;  2QRD B;  1TFI A;  2G2K A;  3CCE Z;  1Q86 2;  3CCV 1;  1YUA A;  2OTL Z;  2LFU A;  4BY7 I;  1KRL A;  3CCE 1;  2M48 A;  1W2B Y;  2OTL 1;  3TE5 B;  1PFT A;  4A3F I;  1Y1V S;  4RV9 A;  2VPX A;  2JNY A;  4QTT A;  3OW2 Y;  3CCQ Z;  1RNI A;  2F4O A;  3CCQ 1;  1VQO 1;  4BXX I;  2DE5 A;  3CC4 1;  3PO3 I;  2R93 I;  5A2Q f;  1Q7Y 1;  2F4M A;  1DL6 A;  1ZB8 A;  4NBA A;  1R9T I;  3HKZ A;  3J7A 4;  3IX0 A;  1QVF Z;  5D1P A;  1W2B Z;  3S17 I;  3OW2 Z;  1VQ8 Z;  2RBL A;  2IZ4 A;  3CME Z;  4S1T A;  1NUI A;  3JAM b;  1VQ8 1;  5IP7 I;  3QWU A;  3GTL I;  3IFU A;  5T64 A;  3CME 1;  2JIQ A;  1P9N A;  1VQN Z;  2E7Z A;  1K9M 1;  3VMI A;  4A93 I;  5IT9 b;  1VQN 1;  2NVT I;  1Z02 A;  2R92 I;  3PO2 I;  5D1O B;  3K7A I;  3I56 Z;  3G71 Z;  2RIQ A;  4NBG A;  1VQ9 Z;  2EGT A;  4DK1 A;  3I56 1;  1ML8 A;  3G71 1;  4X6A I;  3MZL B;  1VQ9 1;  2P3Y A;  1Z03 A;  4A3K I;  2V45 A;  3NFZ A;  4MXU A;  4E2X A;  4A3D I;  4A3L I;  1VQP Z;  2DE6 A;  4MD8 A;  1Y1W I;  3J80 f;  1QXF A;  2VUM I;  1VQP 1;  4RVH A;  1SFO I;  4HH4 A;  4AYB A;  4NBF A;  4HGZ A;  3CCM Z;  1KD1 2;  2PM9 A;  1QF8 A;  3CCM 1;  3IR7 A;  5A2Q b;  3RZO I;  1AA6 A;  3J81 f;  2YAD A;  2E2H I;  2BJO A;  3CCS Z;  1LQL A;  3S1R I;  2GTI A;  2JA6 I;  2JA7 I;  4NOZ A;  3CCS 1;  3IF8 A;  3GTM S;  4BY1 I;  2W04 A;  1SIW A;  4Y7N I;  1K8A 1;  3M3Y I;  4RVD A;  3EER A;  4EWC A;  3GTQ I;  1VQ5 Z;  2JIP A;  1WCM I;  1RO2 A;  2OOY B;  3LUS A;  2JIM A;  4MD7 A;  3D9X A;  1VQ5 1;  3VMG A;  1X0T A;  1NJI 2;  3S15 I;  2RHB A;  1KC8 1;  1M90 2;  4A3I I;  2V8J A;  3HOU I;  5C4J I;  1Q82 1;  2QA4 Z;  2I3C A;  1ZH1 A;  1YJ9 Z;  1ZB9 A;  5T6B A;  4XX2 A;  4E2Y A;  5FLM I;  1VQO Z;  2QA4 1;  2PMZ A;  1JJ2 Y;  3CMA Z;  1YJ9 1;  1K83 I;  1KQS Y;  3CC4 Z;  2GTH A;  2KPI A;  3BG0 B;  4E32 A;  2O4H A;  3J80 b;  1YIT Z;  3CMA 1;  3CCJ Z;  1YIT 1;  3F3F C;  2AYD A;  3I4N I;  1VQ6 Z;  3CCJ 1;  3FKI I;  2WAQ A;  3NH8 A;  4RVG A;  3P5J B;  1VQ6 1;  3S1M I;  4A3B I;  3EED A; 
#chains in the Genus database with same CATH homology
 3S16 I;  2OTJ Z;  3CQZ I;  1JJ2 Z;  1KQS Z;  1M1K 1;  2R6M A;  1YHQ Z;  5CM2 M;  3J81 b;  3I07 A;  2OTJ 1;  3S1Q I;  1YIJ Z;  1YHQ 1;  1TWA I;  3CCL Z;  3CD6 Z;  1Q86 1;  1YIJ 1;  2QRE B;  3CCL 1;  4E33 A;  4DGL A;  1NP6 A;  4A3J I;  3CD6 1;  1RLY A;  2Y0S A;  1I50 I;  2JA8 I;  1X3W A;  2QR1 B;  1N8R 2;  2B63 I;  4NFR A;  1I3Q I;  3PO3 S;  4NB8 A;  1S72 Z;  3I55 Z;  1YI2 Z;  1K73 2;  2OZK A;  2Q51 A;  1RO4 A;  4NBB A;  2JA5 I;  3G6E Z;  1S72 1;  3S2D I;  3I55 1;  1YI2 1;  2V8K A;  2QLV B;  3NDI A;  2IZ3 A;  3G6E 1;  4E30 A;  2R7Z I;  2M6N A;  2JS4 A;  1TWF I;  3CC7 Z;  5C4X I;  3U50 C;  2P28 A;  3CC7 1;  3VB9 A;  2K5R A;  2RPR A;  3GTJ I;  1QVG Y;  1USP A;  3CCR Z;  1TWH I;  4NBD A;  2K3R A;  3M4O I;  2VF1 A;  3CCR 1;  4NB9 A;  2VUG A;  4QTU A;  2O53 A;  2H85 A;  5AN9 F;  4MH4 A;  4E31 A;  4A3E I;  1Y1V I;  3F3P C;  2NVX I;  3T4N B;  2HF1 A;  2NVY I;  3CPW Y;  3GTG I;  1QVG Z;  4HGY A;  3H0G I;  2JMO A;  1YJN Z;  1Q7Y 2;  1VQ4 Z;  3D6W A;  1VQL Z;  1YJN 1;  3H3V J;  3VMH A;  5C3E I;  1VQ4 1;  2DE7 A;  3GTP I;  1VQL 1;  2QRC B;  2WB1 A;  1Q81 2;  4A3G I;  1KD1 1;  3GTK I;  1YJW Z;  3CPW Z;  2V8I A;  4A3C I;  2J6A A;  1YJW 1;  4RS4 A;  3G4S Z;  4NBC A;  1RQF A;  2E2J I;  4A3M I;  1K9M 2;  4NBE A;  5IP9 I;  3G4S 1;  1Z01 A;  3FQM A;  1L1O C;  1QVF Y;  1S7M A;  3HOZ I;  1WW9 A;  5D1O A;  5FLX f;  4BBR I;  1VQM Z;  3HOX I;  3TDH B;  2JR6 A;  1VQM 1;  2W03 A;  1NJI 1;  1QYP A;  4BBS I;  3HOV I;  2HU9 A;  1VQ7 Z;  2ZAE B;  1M90 1;  3CXC Y;  1Q81 1;  1VQ7 1;  1VQK Z;  3S1N I;  5LL6 f;  3NDJ A;  1VQK 1;  4CL1 A;  2GU2 A;  2QKD A;  5C44 I;  2PK7 A;  1TWC I;  3Q87 A;  4Y52 I;  2OOX B;  3CXC Z;  1WII A;  3GTO I;  2E9H A;  4MD9 A;  3I4M I;  2JUB A;  1K8A 2;  3GTM I;  1TWG I;  3NH4 A;  1RO0 A;  4RVF A;  3HOY I;  3FQQ A;  3CC2 Z;  2E2I I;  3CC2 1;  3GCF A;  3ESW A;  3S14 I;  1JWH C;  2QEX Z;  1KC8 2;  5FLX b;  3HOW I;  4MON A;  1N2F A;  2QEX 1;  1Q82 2;  5T67 A;  1N8R 1;  2RT9 A;  1VLA A;  2AKL A;  4DQY B;  3GKQ A;  2KI7 B;  1K73 1;  2NVQ I;  4TNU A;  1X3Z A;  4NH1 C;  3JAM f;  3MON A;  2LIY A;  3MZK B;  4MRI A;  2YU9 I;  1YUK A;  3NH5 A;  3S2H I;  5IT9 f;  3CCU Z;  3KIF A;  3KIH A;  2Q4Z A;  1M1K 2;  4E2W A;  4NBH A;  3CCU 1;  1I6H I;  4E2Z A;  3RZD I;  1USP B;  3CCV Z;  3BG1 B;  3VTN A;  2QRD B;  1TFI A;  2G2K A;  3CCE Z;  1Q86 2;  3CCV 1;  1YUA A;  2OTL Z;  2LFU A;  4BY7 I;  1KRL A;  3CCE 1;  2M48 A;  1W2B Y;  2OTL 1;  3TE5 B;  1PFT A;  4A3F I;  1Y1V S;  4RV9 A;  2JNY A;  4QTT A;  3OW2 Y;  3CCQ Z;  1RNI A;  2F4O A;  3CCQ 1;  1VQO 1;  4BXX I;  2DE5 A;  3CC4 1;  3PO3 I;  2R93 I;  5A2Q f;  1Q7Y 1;  2F4M A;  1DL6 A;  1ZB8 A;  4NBA A;  1R9T I;  3HKZ A;  3J7A 4;  3IX0 A;  1QVF Z;  5D1P A;  1W2B Z;  3S17 I;  3OW2 Z;  1VQ8 Z;  2RBL A;  2IZ4 A;  3CME Z;  4S1T A;  1NUI A;  3JAM b;  1VQ8 1;  5IP7 I;  3QWU A;  3GTL I;  3IFU A;  5T64 A;  3CME 1;  1P9N A;  1VQN Z;  1K9M 1;  3VMI A;  4A93 I;  5IT9 b;  1VQN 1;  2NVT I;  1Z02 A;  2R92 I;  3PO2 I;  5D1O B;  3K7A I;  3I56 Z;  3G71 Z;  2RIQ A;  4NBG A;  1VQ9 Z;  2EGT A;  4DK1 A;  3I56 1;  1ML8 A;  3G71 1;  4X6A I;  3MZL B;  1VQ9 1;  2P3Y A;  1Z03 A;  4A3K I;  3NFZ A;  4MXU A;  4E2X A;  4A3D I;  4A3L I;  1VQP Z;  2DE6 A;  4MD8 A;  1Y1W I;  3J80 f;  2VUM I;  1VQP 1;  4RVH A;  1SFO I;  4HH4 A;  4AYB A;  4NBF A;  4HGZ A;  3CCM Z;  1KD1 2;  2PM9 A;  1QF8 A;  3CCM 1;  5A2Q b;  3RZO I;  3J81 f;  2YAD A;  2E2H I;  2BJO A;  3CCS Z;  1LQL A;  3S1R I;  2GTI A;  2JA6 I;  2JA7 I;  4NOZ A;  3CCS 1;  3IF8 A;  3GTM S;  4BY1 I;  2W04 A;  4Y7N I;  1K8A 1;  3M3Y I;  4RVD A;  3EER A;  4EWC A;  3GTQ I;  1VQ5 Z;  1WCM I;  1RO2 A;  2OOY B;  3LUS A;  4MD7 A;  3D9X A;  1VQ5 1;  3VMG A;  1X0T A;  1NJI 2;  3S15 I;  2RHB A;  1KC8 1;  1M90 2;  4A3I I;  2V8J A;  3HOU I;  5C4J I;  1Q82 1;  2QA4 Z;  2I3C A;  1ZH1 A;  1YJ9 Z;  1ZB9 A;  5T6B A;  4XX2 A;  4E2Y A;  5FLM I;  1VQO Z;  2QA4 1;  2PMZ A;  1JJ2 Y;  3CMA Z;  1YJ9 1;  1K83 I;  1KQS Y;  3CC4 Z;  2GTH A;  2KPI A;  3BG0 B;  4E32 A;  2O4H A;  3J80 b;  1YIT Z;  3CMA 1;  3CCJ Z;  1YIT 1;  3F3F C;  3I4N I;  1VQ6 Z;  3CCJ 1;  3FKI I;  2WAQ A;  3NH8 A;  4RVG A;  3P5J B;  1VQ6 1;  3S1M I;  4A3B I;  3EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...