1Q811

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81100
1YJNZ 1K9M1 1Q7Y1 1Q7Y2 1VQ71 3CD61 1YJWZ 1Q862 1VQ8Z 1YHQ1 1VQO1 3I551 1QVFY 1K731 1YJW1 1VQLZ 1VQ81 1VQNZ 1VQPZ 2OTLZ 1K732 1KQSY 2QA41 1KD11 1VQM1 3CMAZ 3CCMZ 1VQL1 1KD12 1VQN1 1Q811 1VQP1 3CD6Z 1W2BZ 3I56Z 1YHQZ 3CCJZ 3CCS1 1Q812 1VQOZ 1VQ41 1Q861 3CCM1 3CMA1 3OW2Z 3I55Z 3CCRZ 1VQ9Z 1JJ2Z 3I561 3CXCZ 3G711 1YI2Z 3CCJ1 1YJ91 2QEX1 3CPWY 2QA4Z 3CCR1 1VQMZ 1VQ91 1YI21 1QVGZ 1VQK1 3CCSZ 1Q821 1NJI1 1VQ4Z 1YIT1 3CC7Z 1VQ6Z 1YIJ1 1Q822 1KC81 1NJI2 1VQ5Z 1QVFZ 1K8A1 3CCL1 3G71Z 1KC82 3G4S1 3CCQ1 1YJ9Z 1K8A2 2QEXZ 1KQSZ 3CC71 1S721 1VQ61 3CCVZ 1VQ51 1M1K2 3CCUZ 1M901 1VQKZ 3CCV1 1M902 1YITZ 1YIJZ 3CCU1 3CXCY 2OTJ1 3CCLZ 3CCQZ 3G4SZ 3CPWZ 3CC41 3G6E1 1S72Z 1N8R1 1K9M2 3CCEZ 1QVGY 1N8R2 1YJN1 3CMEZ 1M1K1 3CCE1 3CC2Z 3CME1 1W2BY 2OTJZ 3OW2Y 3CC4Z 3CC21 3G6EZ 1JJ2Y 1VQ7Z 2OTL1
chains in the Genus database with same CATH superfamily
1SIWA 3VB9A 1Q7Y1 1AA6A 2K3RA 1Q7Y2 3J7A4 2JMOA 4E32A 1TWCI 4MXUA 1YJW1 2RHBA 2VPZA 1VQPZ 2OTLZ 3FKII 4NBGA 4QTTA 2QA41 3VMIA 3S2DI 3HOZI 4RVDA 3LUSA 1VQN1 1Q811 5T6BA 3I56Z 3NH5A 1Q812 3M3YI 2QRCB 3CMA1 2WB1A 1TWAI 3GTPI 4A3BI 2JNYA 4HGZA 1YJ91 3CPWY 2PMZA 4BY1I 1VQ91 2DE7A 4TNUA 1ML8A 4RS4A 3M4OI 2Y0SA 3PO3I 1VQ4Z 2OOXB 4NB8A 1YIT1 2K5RA 4E2YA 3GTGI 3CCL1 3U50C 3CCQ1 4A3KI 1Z02A 1VQ61 4CL1A 1VQ51 4NB9A 4E2ZA 2H85A 3GTOI 3CCUZ 1M901 2NVTI 1VQKZ 2JIQA 4A3LI 3I07A 3Q87A 2HU9A 1M902 3CQZI 3J80b 3J81b 3CXCY 4S1TA 2NVXI 1ZB9A 2JIOA 3G4SZ 3CPWZ 4A3II 1N8R1 3JAMf 1K9M2 5D1PA 3CCEZ 4X6AI 1QVGY 1N8R2 1YJN1 3NFZA 1RO2A 1M1K1 1Y1VI 2YU9I 1WZNA 3CC2Z 3VMGA 2VPWA 2W04A 1RO0A 4RVHA 3CME1 2JA7I 2OTJZ 3FQQA 3D2LA 1RNIA 2E2JI 3HOWI 3S14I 3BG0B 3G6EZ 3D6WA 3GKQA 3EERA 4NBAA 4XX2A 4E30A 3GTKI 3GTMI 3FQMA 1YJWZ 5C4JI 1YHQ1 4BXXI 4AYBA 3I551 4HGYA 1VQ81 1VQNZ 1K83I 1VQM1 4A3CI 2P28A 3H3VJ 3CMAZ 1RO4A 2E2II 2B63I 3CD6Z 2AKLA 2JS4A 1WIIA 5D1OB 3CCS1 1VQOZ 3MONA 3CCM1 1FDIA 3IFUA 4MRIA 3HOYI 5IT9b 1TFIA 1YUKA 1VQ9Z 2AYDA 3CCJ1 1TWFI 1Y8CA 2GU2A 3CCR1 3KIFA 1L1OC 3S2HI 2WAQA 3K7AI 4DQYB 2V3VA 4Y52I 2F4OA 1ZB8A 1NJI1 4QTUA 2E9HA 2R93I 1USPB 2QRDB 1VQ6Z 1NJI2 1VQ5Z 3G71Z 3PO2I 2QEXZ 3CC71 1S721 3I4MI 3S1MI 4MH4A 3TE5B 3CCV1 2VPXA 4A3EI 5FLXb 1YIJZ 4A3GI 2V8KA 4E2WA 1I3QI 2NVQI 2EGTA 2IZ3A 2JIMA 4A3DI 3CMEZ 3TDHB 1LQLA 3IF8A 5C4XI 3OW2Y 1RQFA 3CC4Z 1JJ2Y 1Y1WI 1X0TA 3RZOI 3D9XA 4MD8A 5CM2M 2OTL1 2JA8I 5C44I 3NH8A 1K9M1 3IR7A 2O4HA 2QKDA 3BG1B 4RV9A 2W03A 4HH4A 2G2KA 2VUGA 4BY7I 1S7MA 1Z01A 1Q862 1KRLA 4NBHA 1VQ8Z 2Q4ZA 1QF8A 1QVFY 1K731 3IX0A 1K732 1KD11 2O53A 2QR1B 5IP9I 3CCMZ 1VQL1 2R92I 1KD12 2RBLA 4NBFA 3F3FC 5A2Qb 5T64A 1P9NA 4Y7NI 1WJ2A 3CCJZ 1VQ41 2QLVB 3KIHA 1Q16A 2DE6A 3OW2Z 3CCRZ 1JJ2Z 3J80f 3NDIA 3J81f 3CXCZ 3EEDA 2QA4Z 3ESWA 4BBRI 2F4MA 1YI21 1QVGZ 1VQK1 3QWUA 4NBDA 3CC7Z 1KC81 1QVFZ 4MD7A 1X3ZA 4E31A 1KC82 3G4S1 1YJ9Z 3CCVZ 2LEXA 5T67A 3S16I 2RIQA 3GTLI 2I3CA 4NBEA 1YITZ 2RT9A 3GTQI 2OTJ1 3CCLZ 2QREB 4EWCA 3CCQZ 3G6E1 3T4NB 2YADA 1VLAA 3S1RI 4A3JI 2KI7B 2P3YA 2VUMI 1R9TI 2V8IA 3S1QI 1QXFA 3HOUI 2E2HI 3VMHA 2JIRA 1WW9A 1W2BY 1NUIA 2ZAEB 4RVFA 5IT9f 4BBSI 3MZLB 4NBCA 5C3EI 1YJNZ 2KPIA 3H0GI 2OOYB 3RZDI 1VQ71 3CD61 1RLYA 3S17I 2LFUA 1VQO1 4NH1C 2M6NA 1N2FA 3JAMb 1VQLZ 1JWHC 3HKZA 5LL6f 3MZKB 4E33A 2DE5A 3HOXI 2GTHA 1KQSY 3P5JB 3GCFA 3S15I 4A3FI 2IV2X 4MD9A 5D1OA 2VF1A 2E7ZA 1VQP1 2J6AA 2V8JA 1W2BZ 1YHQZ 1Q861 3I55Z 2PM9A 2Q51A 2HF1A 5FLXf 2JUBA 3I561 3G711 1YI2Z 3S1NI 1FDOA 1I50I 2JA6I 3PO3S 2QEX1 1WCMI 2NVYI 4NFRA 1VQMZ 1SFOI 1USPA 3CCSZ 1Q821 2V45A 1YIJ1 1Q822 4E2XA 1DL6A 1K8A1 1X3WA 3NDJA 5IP7I 3F3PC 1K8A2 1KQSZ 1PFTA 4DGLA 2PK7A 1YUAA 2GTIA 2LIYA 1Z03A 1M1K2 5FLMI 3CCU1 2VPYA 2JR6A 3I4NI 2IZ4A 1NP6A 2JIPA 1Y1VS 3GTJI 3CC41 1S72Z 4A93I 2RPRA 2R6MA 1TWGI 2NAPA 1QYPA 4RVGA 3CCE1 4NBBA 3VTNA 5A2Qf 3HOVI 2BJOA 4MONA 3GTMS 2R7ZI 4DK1A 4NOZA 2JA5I 1ZH1A 3CC21 2OZKA 5AN9F 1I6HI 1TWHI 4A3MI 1VQ7Z 3NH4A 2M48A
chains in the Genus database with same CATH topology
3VB9A 1Q7Y1 2K3RA 1Q7Y2 3J7A4 2JMOA 4E32A 1TWCI 4MXUA 1YJW1 2RHBA 1VQPZ 2OTLZ 3FKII 4NBGA 4QTTA 2QA41 3VMIA 3S2DI 3HOZI 4RVDA 3LUSA 1VQN1 1Q811 5T6BA 3I56Z 3NH5A 1Q812 3M3YI 2QRCB 3CMA1 2WB1A 1TWAI 3GTPI 4A3BI 2JNYA 4HGZA 1YJ91 3CPWY 2PMZA 4BY1I 1VQ91 2DE7A 4TNUA 1ML8A 4RS4A 3M4OI 2Y0SA 3PO3I 1VQ4Z 2OOXB 4NB8A 1YIT1 2K5RA 4E2YA 3GTGI 3CCL1 3U50C 3CCQ1 4A3KI 1Z02A 1VQ61 4CL1A 1VQ51 4NB9A 4E2ZA 2H85A 3GTOI 3CCUZ 1M901 2NVTI 1VQKZ 4A3LI 3I07A 3Q87A 2HU9A 1M902 3CQZI 3J80b 3J81b 3CXCY 4S1TA 2NVXI 1ZB9A 3G4SZ 3CPWZ 4A3II 1N8R1 3JAMf 1K9M2 5D1PA 3CCEZ 4X6AI 1QVGY 1N8R2 1YJN1 3NFZA 1RO2A 1M1K1 1Y1VI 2YU9I 3CC2Z 3VMGA 2W04A 1RO0A 4RVHA 3CME1 2JA7I 2OTJZ 3FQQA 1RNIA 2E2JI 3HOWI 3S14I 3BG0B 3G6EZ 3D6WA 3GKQA 3EERA 4NBAA 4XX2A 4E30A 3GTKI 3GTMI 3FQMA 1YJWZ 5C4JI 1YHQ1 4BXXI 4AYBA 3I551 4HGYA 1VQ81 1VQNZ 1K83I 1VQM1 4A3CI 2P28A 3H3VJ 3CMAZ 1RO4A 2E2II 2B63I 3CD6Z 2AKLA 2JS4A 1WIIA 5D1OB 3CCS1 1VQOZ 3MONA 3CCM1 3IFUA 4MRIA 3HOYI 5IT9b 1TFIA 1YUKA 1VQ9Z 3CCJ1 1TWFI 2GU2A 3CCR1 3KIFA 1L1OC 3S2HI 2WAQA 3K7AI 4DQYB 4Y52I 2F4OA 1ZB8A 1NJI1 4QTUA 2E9HA 2R93I 1USPB 2QRDB 1VQ6Z 1NJI2 1VQ5Z 3G71Z 3PO2I 2QEXZ 3CC71 1S721 3I4MI 3S1MI 4MH4A 3TE5B 3CCV1 4A3EI 5FLXb 1YIJZ 4A3GI 2V8KA 4E2WA 1I3QI 2NVQI 2EGTA 2IZ3A 4A3DI 3CMEZ 3TDHB 1LQLA 3IF8A 5C4XI 3OW2Y 1RQFA 3CC4Z 1JJ2Y 1Y1WI 1X0TA 3RZOI 3D9XA 4MD8A 5CM2M 2OTL1 2JA8I 5C44I 3NH8A 1K9M1 2O4HA 2QKDA 3BG1B 4RV9A 2W03A 4HH4A 2G2KA 2VUGA 4BY7I 1S7MA 1Z01A 1Q862 1KRLA 4NBHA 1VQ8Z 2Q4ZA 1QF8A 1QVFY 1K731 3IX0A 1K732 1KD11 2O53A 2QR1B 5IP9I 3CCMZ 1VQL1 2R92I 1KD12 2RBLA 4NBFA 3F3FC 5A2Qb 5T64A 1P9NA 4Y7NI 3CCJZ 1VQ41 2QLVB 3KIHA 3OW2Z 2DE6A 3CCRZ 1JJ2Z 3J80f 3NDIA 3J81f 3CXCZ 3EEDA 2QA4Z 3ESWA 4BBRI 2F4MA 1YI21 1QVGZ 1VQK1 3QWUA 4NBDA 3CC7Z 1KC81 1QVFZ 4MD7A 1X3ZA 4E31A 1KC82 3G4S1 1YJ9Z 3CCVZ 5T67A 3S16I 2RIQA 3GTLI 2I3CA 4NBEA 1YITZ 2RT9A 3GTQI 2OTJ1 3CCLZ 2QREB 4EWCA 3CCQZ 3G6E1 3T4NB 2YADA 1VLAA 3S1RI 4A3JI 2KI7B 2P3YA 2VUMI 1R9TI 2V8IA 3S1QI 3HOUI 2E2HI 3VMHA 1WW9A 1W2BY 1NUIA 2ZAEB 4RVFA 5IT9f 4BBSI 3MZLB 4NBCA 5C3EI 1YJNZ 2KPIA 3H0GI 2OOYB 3RZDI 1VQ71 3CD61 1RLYA 3S17I 2LFUA 1VQO1 4NH1C 2M6NA 1N2FA 3JAMb 1VQLZ 1JWHC 3HKZA 5LL6f 3MZKB 4E33A 2DE5A 3HOXI 2GTHA 1KQSY 3P5JB 3GCFA 3S15I 4A3FI 4MD9A 5D1OA 2VF1A 1VQP1 2J6AA 2V8JA 1W2BZ 1YHQZ 1Q861 3I55Z 2PM9A 2Q51A 2HF1A 5FLXf 2JUBA 3I561 3G711 1YI2Z 3S1NI 1I50I 2JA6I 3PO3S 2QEX1 1WCMI 2NVYI 4NFRA 1VQMZ 1SFOI 1USPA 3CCSZ 1Q821 1YIJ1 1Q822 4E2XA 1DL6A 1K8A1 1X3WA 3NDJA 5IP7I 3F3PC 1K8A2 1KQSZ 1PFTA 4DGLA 2PK7A 1YUAA 2GTIA 2LIYA 1Z03A 1M1K2 5FLMI 3CCU1 2JR6A 3I4NI 2IZ4A 1NP6A 1Y1VS 3GTJI 3CC41 1S72Z 4A93I 2RPRA 2R6MA 1TWGI 1QYPA 4RVGA 3CCE1 4NBBA 3VTNA 5A2Qf 3HOVI 2BJOA 4MONA 3GTMS 2R7ZI 4DK1A 4NOZA 2JA5I 1ZH1A 3CC21 2OZKA 5AN9F 1I6HI 1TWHI 4A3MI 1VQ7Z 3NH4A 2M48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  1K9M 1;  1Q7Y 1;  1Q7Y 2;  1VQ7 1;  3CD6 1;  1YJW Z;  1Q86 2;  1VQ8 Z;  1YHQ 1;  1VQO 1;  3I55 1;  1QVF Y;  1K73 1;  1YJW 1;  1VQL Z;  1VQ8 1;  1VQN Z;  1VQP Z;  2OTL Z;  1K73 2;  1KQS Y;  2QA4 1;  1KD1 1;  1VQM 1;  3CMA Z;  3CCM Z;  1VQL 1;  1KD1 2;  1VQN 1;  1Q81 1;  1VQP 1;  3CD6 Z;  1W2B Z;  3I56 Z;  1YHQ Z;  3CCJ Z;  3CCS 1;  1Q81 2;  1VQO Z;  1VQ4 1;  1Q86 1;  3CCM 1;  3CMA 1;  3OW2 Z;  3I55 Z;  3CCR Z;  1VQ9 Z;  1JJ2 Z;  3I56 1;  3CXC Z;  3G71 1;  1YI2 Z;  3CCJ 1;  1YJ9 1;  2QEX 1;  3CPW Y;  2QA4 Z;  3CCR 1;  1VQM Z;  1VQ9 1;  1YI2 1;  1QVG Z;  1VQK 1;  3CCS Z;  1Q82 1;  1NJI 1;  1VQ4 Z;  1YIT 1;  3CC7 Z;  1VQ6 Z;  1YIJ 1;  1Q82 2;  1KC8 1;  1NJI 2;  1VQ5 Z;  1QVF Z;  1K8A 1;  3CCL 1;  3G71 Z;  1KC8 2;  3G4S 1;  3CCQ 1;  1YJ9 Z;  1K8A 2;  2QEX Z;  1KQS Z;  3CC7 1;  1S72 1;  1VQ6 1;  3CCV Z;  1VQ5 1;  1M1K 2;  3CCU Z;  1M90 1;  1VQK Z;  3CCV 1;  1M90 2;  1YIT Z;  1YIJ Z;  3CCU 1;  3CXC Y;  2OTJ 1;  3CCL Z;  3CCQ Z;  3G4S Z;  3CPW Z;  3CC4 1;  3G6E 1;  1S72 Z;  1N8R 1;  1K9M 2;  3CCE Z;  1QVG Y;  1N8R 2;  1YJN 1;  3CME Z;  1M1K 1;  3CCE 1;  3CC2 Z;  3CME 1;  1W2B Y;  2OTJ Z;  3OW2 Y;  3CC4 Z;  3CC2 1;  3G6E Z;  1JJ2 Y;  1VQ7 Z;  2OTL 1; 
#chains in the Genus database with same CATH topology
 1SIW A;  3VB9 A;  1Q7Y 1;  1AA6 A;  2K3R A;  1Q7Y 2;  3J7A 4;  2JMO A;  4E32 A;  1TWC I;  4MXU A;  1YJW 1;  2RHB A;  2VPZ A;  1VQP Z;  2OTL Z;  3FKI I;  4NBG A;  4QTT A;  2QA4 1;  3VMI A;  3S2D I;  3HOZ I;  4RVD A;  3LUS A;  1VQN 1;  1Q81 1;  5T6B A;  3I56 Z;  3NH5 A;  1Q81 2;  3M3Y I;  2QRC B;  3CMA 1;  2WB1 A;  1TWA I;  3GTP I;  4A3B I;  2JNY A;  4HGZ A;  1YJ9 1;  3CPW Y;  2PMZ A;  4BY1 I;  1VQ9 1;  2DE7 A;  4TNU A;  1ML8 A;  4RS4 A;  3M4O I;  2Y0S A;  3PO3 I;  1VQ4 Z;  2OOX B;  4NB8 A;  1YIT 1;  2K5R A;  4E2Y A;  3GTG I;  3CCL 1;  3U50 C;  3CCQ 1;  4A3K I;  1Z02 A;  1VQ6 1;  4CL1 A;  1VQ5 1;  4NB9 A;  4E2Z A;  2H85 A;  3GTO I;  3CCU Z;  1M90 1;  2NVT I;  1VQK Z;  2JIQ A;  4A3L I;  3I07 A;  3Q87 A;  2HU9 A;  1M90 2;  3CQZ I;  3J80 b;  3J81 b;  3CXC Y;  4S1T A;  2NVX I;  1ZB9 A;  2JIO A;  3G4S Z;  3CPW Z;  4A3I I;  1N8R 1;  3JAM f;  1K9M 2;  5D1P A;  3CCE Z;  4X6A I;  1QVG Y;  1N8R 2;  1YJN 1;  3NFZ A;  1RO2 A;  1M1K 1;  1Y1V I;  2YU9 I;  1WZN A;  3CC2 Z;  3VMG A;  2VPW A;  2W04 A;  1RO0 A;  4RVH A;  3CME 1;  2JA7 I;  2OTJ Z;  3FQQ A;  3D2L A;  1RNI A;  2E2J I;  3HOW I;  3S14 I;  3BG0 B;  3G6E Z;  3D6W A;  3GKQ A;  3EER A;  4NBA A;  4XX2 A;  4E30 A;  3GTK I;  3GTM I;  3FQM A;  1YJW Z;  5C4J I;  1YHQ 1;  4BXX I;  4AYB A;  3I55 1;  4HGY A;  1VQ8 1;  1VQN Z;  1K83 I;  1VQM 1;  4A3C I;  2P28 A;  3H3V J;  3CMA Z;  1RO4 A;  2E2I I;  2B63 I;  3CD6 Z;  2AKL A;  2JS4 A;  1WII A;  5D1O B;  3CCS 1;  1VQO Z;  3MON A;  3CCM 1;  1FDI A;  3IFU A;  4MRI A;  3HOY I;  5IT9 b;  1TFI A;  1YUK A;  1VQ9 Z;  2AYD A;  3CCJ 1;  1TWF I;  1Y8C A;  2GU2 A;  3CCR 1;  3KIF A;  1L1O C;  3S2H I;  2WAQ A;  3K7A I;  4DQY B;  2V3V A;  4Y52 I;  2F4O A;  1ZB8 A;  1NJI 1;  4QTU A;  2E9H A;  2R93 I;  1USP B;  2QRD B;  1VQ6 Z;  1NJI 2;  1VQ5 Z;  3G71 Z;  3PO2 I;  2QEX Z;  3CC7 1;  1S72 1;  3I4M I;  3S1M I;  4MH4 A;  3TE5 B;  3CCV 1;  2VPX A;  4A3E I;  5FLX b;  1YIJ Z;  4A3G I;  2V8K A;  4E2W A;  1I3Q I;  2NVQ I;  2EGT A;  2IZ3 A;  2JIM A;  4A3D I;  3CME Z;  3TDH B;  1LQL A;  3IF8 A;  5C4X I;  3OW2 Y;  1RQF A;  3CC4 Z;  1JJ2 Y;  1Y1W I;  1X0T A;  3RZO I;  3D9X A;  4MD8 A;  5CM2 M;  2OTL 1;  2JA8 I;  5C44 I;  3NH8 A;  1K9M 1;  3IR7 A;  2O4H A;  2QKD A;  3BG1 B;  4RV9 A;  2W03 A;  4HH4 A;  2G2K A;  2VUG A;  4BY7 I;  1S7M A;  1Z01 A;  1Q86 2;  1KRL A;  4NBH A;  1VQ8 Z;  2Q4Z A;  1QF8 A;  1QVF Y;  1K73 1;  3IX0 A;  1K73 2;  1KD1 1;  2O53 A;  2QR1 B;  5IP9 I;  3CCM Z;  1VQL 1;  2R92 I;  1KD1 2;  2RBL A;  4NBF A;  3F3F C;  5A2Q b;  5T64 A;  1P9N A;  4Y7N I;  1WJ2 A;  3CCJ Z;  1VQ4 1;  2QLV B;  3KIH A;  1Q16 A;  2DE6 A;  3OW2 Z;  3CCR Z;  1JJ2 Z;  3J80 f;  3NDI A;  3J81 f;  3CXC Z;  3EED A;  2QA4 Z;  3ESW A;  4BBR I;  2F4M A;  1YI2 1;  1QVG Z;  1VQK 1;  3QWU A;  4NBD A;  3CC7 Z;  1KC8 1;  1QVF Z;  4MD7 A;  1X3Z A;  4E31 A;  1KC8 2;  3G4S 1;  1YJ9 Z;  3CCV Z;  2LEX A;  5T67 A;  3S16 I;  2RIQ A;  3GTL I;  2I3C A;  4NBE A;  1YIT Z;  2RT9 A;  3GTQ I;  2OTJ 1;  3CCL Z;  2QRE B;  4EWC A;  3CCQ Z;  3G6E 1;  3T4N B;  2YAD A;  1VLA A;  3S1R I;  4A3J I;  2KI7 B;  2P3Y A;  2VUM I;  1R9T I;  2V8I A;  3S1Q I;  1QXF A;  3HOU I;  2E2H I;  3VMH A;  2JIR A;  1WW9 A;  1W2B Y;  1NUI A;  2ZAE B;  4RVF A;  5IT9 f;  4BBS I;  3MZL B;  4NBC A;  5C3E I;  1YJN Z;  2KPI A;  3H0G I;  2OOY B;  3RZD I;  1VQ7 1;  3CD6 1;  1RLY A;  3S17 I;  2LFU A;  1VQO 1;  4NH1 C;  2M6N A;  1N2F A;  3JAM b;  1VQL Z;  1JWH C;  3HKZ A;  5LL6 f;  3MZK B;  4E33 A;  2DE5 A;  3HOX I;  2GTH A;  1KQS Y;  3P5J B;  3GCF A;  3S15 I;  4A3F I;  2IV2 X;  4MD9 A;  5D1O A;  2VF1 A;  2E7Z A;  1VQP 1;  2J6A A;  2V8J A;  1W2B Z;  1YHQ Z;  1Q86 1;  3I55 Z;  2PM9 A;  2Q51 A;  2HF1 A;  5FLX f;  2JUB A;  3I56 1;  3G71 1;  1YI2 Z;  3S1N I;  1FDO A;  1I50 I;  2JA6 I;  3PO3 S;  2QEX 1;  1WCM I;  2NVY I;  4NFR A;  1VQM Z;  1SFO I;  1USP A;  3CCS Z;  1Q82 1;  2V45 A;  1YIJ 1;  1Q82 2;  4E2X A;  1DL6 A;  1K8A 1;  1X3W A;  3NDJ A;  5IP7 I;  3F3P C;  1K8A 2;  1KQS Z;  1PFT A;  4DGL A;  2PK7 A;  1YUA A;  2GTI A;  2LIY A;  1Z03 A;  1M1K 2;  5FLM I;  3CCU 1;  2VPY A;  2JR6 A;  3I4N I;  2IZ4 A;  1NP6 A;  2JIP A;  1Y1V S;  3GTJ I;  3CC4 1;  1S72 Z;  4A93 I;  2RPR A;  2R6M A;  1TWG I;  2NAP A;  1QYP A;  4RVG A;  3CCE 1;  4NBB A;  3VTN A;  5A2Q f;  3HOV I;  2BJO A;  4MON A;  3GTM S;  2R7Z I;  4DK1 A;  4NOZ A;  2JA5 I;  1ZH1 A;  3CC2 1;  2OZK A;  5AN9 F;  1I6H I;  1TWH I;  4A3M I;  1VQ7 Z;  3NH4 A;  2M48 A; 
#chains in the Genus database with same CATH homology
 3VB9 A;  1Q7Y 1;  2K3R A;  1Q7Y 2;  3J7A 4;  2JMO A;  4E32 A;  1TWC I;  4MXU A;  1YJW 1;  2RHB A;  1VQP Z;  2OTL Z;  3FKI I;  4NBG A;  4QTT A;  2QA4 1;  3VMI A;  3S2D I;  3HOZ I;  4RVD A;  3LUS A;  1VQN 1;  1Q81 1;  5T6B A;  3I56 Z;  3NH5 A;  1Q81 2;  3M3Y I;  2QRC B;  3CMA 1;  2WB1 A;  1TWA I;  3GTP I;  4A3B I;  2JNY A;  4HGZ A;  1YJ9 1;  3CPW Y;  2PMZ A;  4BY1 I;  1VQ9 1;  2DE7 A;  4TNU A;  1ML8 A;  4RS4 A;  3M4O I;  2Y0S A;  3PO3 I;  1VQ4 Z;  2OOX B;  4NB8 A;  1YIT 1;  2K5R A;  4E2Y A;  3GTG I;  3CCL 1;  3U50 C;  3CCQ 1;  4A3K I;  1Z02 A;  1VQ6 1;  4CL1 A;  1VQ5 1;  4NB9 A;  4E2Z A;  2H85 A;  3GTO I;  3CCU Z;  1M90 1;  2NVT I;  1VQK Z;  4A3L I;  3I07 A;  3Q87 A;  2HU9 A;  1M90 2;  3CQZ I;  3J80 b;  3J81 b;  3CXC Y;  4S1T A;  2NVX I;  1ZB9 A;  3G4S Z;  3CPW Z;  4A3I I;  1N8R 1;  3JAM f;  1K9M 2;  5D1P A;  3CCE Z;  4X6A I;  1QVG Y;  1N8R 2;  1YJN 1;  3NFZ A;  1RO2 A;  1M1K 1;  1Y1V I;  2YU9 I;  3CC2 Z;  3VMG A;  2W04 A;  1RO0 A;  4RVH A;  3CME 1;  2JA7 I;  2OTJ Z;  3FQQ A;  1RNI A;  2E2J I;  3HOW I;  3S14 I;  3BG0 B;  3G6E Z;  3D6W A;  3GKQ A;  3EER A;  4NBA A;  4XX2 A;  4E30 A;  3GTK I;  3GTM I;  3FQM A;  1YJW Z;  5C4J I;  1YHQ 1;  4BXX I;  4AYB A;  3I55 1;  4HGY A;  1VQ8 1;  1VQN Z;  1K83 I;  1VQM 1;  4A3C I;  2P28 A;  3H3V J;  3CMA Z;  1RO4 A;  2E2I I;  2B63 I;  3CD6 Z;  2AKL A;  2JS4 A;  1WII A;  5D1O B;  3CCS 1;  1VQO Z;  3MON A;  3CCM 1;  3IFU A;  4MRI A;  3HOY I;  5IT9 b;  1TFI A;  1YUK A;  1VQ9 Z;  3CCJ 1;  1TWF I;  2GU2 A;  3CCR 1;  3KIF A;  1L1O C;  3S2H I;  2WAQ A;  3K7A I;  4DQY B;  4Y52 I;  2F4O A;  1ZB8 A;  1NJI 1;  4QTU A;  2E9H A;  2R93 I;  1USP B;  2QRD B;  1VQ6 Z;  1NJI 2;  1VQ5 Z;  3G71 Z;  3PO2 I;  2QEX Z;  3CC7 1;  1S72 1;  3I4M I;  3S1M I;  4MH4 A;  3TE5 B;  3CCV 1;  4A3E I;  5FLX b;  1YIJ Z;  4A3G I;  2V8K A;  4E2W A;  1I3Q I;  2NVQ I;  2EGT A;  2IZ3 A;  4A3D I;  3CME Z;  3TDH B;  1LQL A;  3IF8 A;  5C4X I;  3OW2 Y;  1RQF A;  3CC4 Z;  1JJ2 Y;  1Y1W I;  1X0T A;  3RZO I;  3D9X A;  4MD8 A;  5CM2 M;  2OTL 1;  2JA8 I;  5C44 I;  3NH8 A;  1K9M 1;  2O4H A;  2QKD A;  3BG1 B;  4RV9 A;  2W03 A;  4HH4 A;  2G2K A;  2VUG A;  4BY7 I;  1S7M A;  1Z01 A;  1Q86 2;  1KRL A;  4NBH A;  1VQ8 Z;  2Q4Z A;  1QF8 A;  1QVF Y;  1K73 1;  3IX0 A;  1K73 2;  1KD1 1;  2O53 A;  2QR1 B;  5IP9 I;  3CCM Z;  1VQL 1;  2R92 I;  1KD1 2;  2RBL A;  4NBF A;  3F3F C;  5A2Q b;  5T64 A;  1P9N A;  4Y7N I;  3CCJ Z;  1VQ4 1;  2QLV B;  3KIH A;  3OW2 Z;  2DE6 A;  3CCR Z;  1JJ2 Z;  3J80 f;  3NDI A;  3J81 f;  3CXC Z;  3EED A;  2QA4 Z;  3ESW A;  4BBR I;  2F4M A;  1YI2 1;  1QVG Z;  1VQK 1;  3QWU A;  4NBD A;  3CC7 Z;  1KC8 1;  1QVF Z;  4MD7 A;  1X3Z A;  4E31 A;  1KC8 2;  3G4S 1;  1YJ9 Z;  3CCV Z;  5T67 A;  3S16 I;  2RIQ A;  3GTL I;  2I3C A;  4NBE A;  1YIT Z;  2RT9 A;  3GTQ I;  2OTJ 1;  3CCL Z;  2QRE B;  4EWC A;  3CCQ Z;  3G6E 1;  3T4N B;  2YAD A;  1VLA A;  3S1R I;  4A3J I;  2KI7 B;  2P3Y A;  2VUM I;  1R9T I;  2V8I A;  3S1Q I;  3HOU I;  2E2H I;  3VMH A;  1WW9 A;  1W2B Y;  1NUI A;  2ZAE B;  4RVF A;  5IT9 f;  4BBS I;  3MZL B;  4NBC A;  5C3E I;  1YJN Z;  2KPI A;  3H0G I;  2OOY B;  3RZD I;  1VQ7 1;  3CD6 1;  1RLY A;  3S17 I;  2LFU A;  1VQO 1;  4NH1 C;  2M6N A;  1N2F A;  3JAM b;  1VQL Z;  1JWH C;  3HKZ A;  5LL6 f;  3MZK B;  4E33 A;  2DE5 A;  3HOX I;  2GTH A;  1KQS Y;  3P5J B;  3GCF A;  3S15 I;  4A3F I;  4MD9 A;  5D1O A;  2VF1 A;  1VQP 1;  2J6A A;  2V8J A;  1W2B Z;  1YHQ Z;  1Q86 1;  3I55 Z;  2PM9 A;  2Q51 A;  2HF1 A;  5FLX f;  2JUB A;  3I56 1;  3G71 1;  1YI2 Z;  3S1N I;  1I50 I;  2JA6 I;  3PO3 S;  2QEX 1;  1WCM I;  2NVY I;  4NFR A;  1VQM Z;  1SFO I;  1USP A;  3CCS Z;  1Q82 1;  1YIJ 1;  1Q82 2;  4E2X A;  1DL6 A;  1K8A 1;  1X3W A;  3NDJ A;  5IP7 I;  3F3P C;  1K8A 2;  1KQS Z;  1PFT A;  4DGL A;  2PK7 A;  1YUA A;  2GTI A;  2LIY A;  1Z03 A;  1M1K 2;  5FLM I;  3CCU 1;  2JR6 A;  3I4N I;  2IZ4 A;  1NP6 A;  1Y1V S;  3GTJ I;  3CC4 1;  1S72 Z;  4A93 I;  2RPR A;  2R6M A;  1TWG I;  1QYP A;  4RVG A;  3CCE 1;  4NBB A;  3VTN A;  5A2Q f;  3HOV I;  2BJO A;  4MON A;  3GTM S;  2R7Z I;  4DK1 A;  4NOZ A;  2JA5 I;  1ZH1 A;  3CC2 1;  2OZK A;  5AN9 F;  1I6H I;  1TWH I;  4A3M I;  1VQ7 Z;  3NH4 A;  2M48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...