1Q811

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81100
1VQ7Z 3CCM1 3CCV1 3I561 3CC2Z 2OTJZ 1VQN1 1K9M1 1YJWZ 1Q861 1S721 1VQ5Z 3I55Z 3G4SZ 1NJI1 3CC71 3CCRZ 3CCJZ 1YIJZ 3CMAZ 3CC41 1YI2Z 1KC81 1VQ6Z 2QEX1 1N8R2 1VQ71 1YJW1 1VQ51 3CCL1 1VQ8Z 3CCS1 1Q822 1K732 1YJ9Z 1KD12 1VQ61 3CCEZ 1YJN1 2QA41 1W2BZ 3G4S1 3CCLZ 3CCU1 3CCMZ 2QEXZ 3I56Z 1Q821 3CC21 1Q7Y2 1VQM1 1YIT1 1VQK1 1S72Z 3I551 1VQOZ 3OW2Y 1Q812 3CCE1 1VQL1 3G711 1YI21 1K8A1 1VQ91 1Q862 1M1K2 1Q7Y1 1VQO1 1NJI2 1QVFZ 3CCSZ 2OTLZ 3CCQ1 1KQSZ 1YITZ 1N8R1 2QA4Z 1VQ4Z 3CCR1 1KQSY 1K731 3CD6Z 1KD11 1VQ9Z 3CC7Z 3G6EZ 1VQ81 3CCQZ 1M901 3CD61 1VQP1 1VQLZ 3CPWY 1K9M2 3CME1 3CPWZ 1QVGY 1VQPZ 1KC82 1Q811 2OTJ1 1JJ2Z 1VQNZ 1M902 1K8A2 1VQMZ 1W2BY 1QVGZ 3CMEZ 3G6E1 1VQKZ 3CCJ1 1YIJ1 1M1K1 1VQ41 1JJ2Y 3G71Z 1YHQ1 3CXCY 1YJ91 1QVFY 3CCVZ 3OW2Z 1YJNZ 3CC4Z 3CMA1 2OTL1 3CXCZ 1YHQZ 3CCUZ
chains in the Genus database with same CATH superfamily
1VQ7Z 2O53A 2HF1A 3CCM1 2R93I 3CC2Z 2O4HA 2OTJZ 1VQN1 1K9M1 1NJI1 3CC71 2K5RA 2VPZA 1RLYA 3CMAZ 4A3MI 2Q51A 4XX2A 4DGLA 2V8IA 4NH1C 2E7ZA 3CCL1 1Q822 4E2YA 2E2JI 2OOYB 2P3YA 5C3EI 3S1MI 2WB1A 3G4S1 2QLVB 4BXXI 1Z02A 3CCU1 3JAMf 2NVXI 3CCMZ 3HOXI 1TWCI 2VUMI 2QEXZ 3I56Z 2Y0SA 2W03A 1JWHC 4E30A 1Q7Y2 3VMGA 2F4OA 1S72Z 2VPXA 3GTJI 2DE7A 2JIQA 2EGTA 3BG0B 1QVFZ 4NBHA 1VLAA 1YITZ 2V8JA 1ML8A 3J81b 4RS4A 2PMZA 3D2LA 3CD6Z 5D1OB 2AYDA 4NOZA 3GCFA 3VMHA 4TNUA 1VQLZ 4EWCA 4A3JI 1Y1WI 4DQYB 3CME1 5C44I 2M6NA 3EEDA 1VQPZ 1KC82 2OTJ1 5A2Qb 3IR7A 1M902 2JNYA 1QVGZ 1RQFA 3G6E1 3CMEZ 3J80f 1M1K1 3GTQI 1NUIA 3S15I 1WIIA 2P28A 2LIYA 1WW9A 2VF1A 1WCMI 1YJ91 2NVQI 1K83I 3P5JB 4NBGA 3CXCZ 2R92I 3PO3S 2QRDB 1Y8CA 3HOVI 3GTMI 3FKII 3I561 3GTKI 4A3DI 3J81f 1Q861 4HH4A 1S721 1VQ5Z 4MD8A 3G4SZ 3HOYI 3CCRZ 3CC41 1SFOI 2BJOA 5IT9b 1ZB8A 1KC81 2QKDA 2QEX1 2H85A 4MD9A 2JIOA 4RVGA 1VQ51 1Z03A 2HU9A 1VQ8Z 3CCS1 1YJ9Z 1I3QI 3M4OI 1KD12 1WJ2A 2OOXB 1YJN1 2NVYI 2JA7I 3TE5B 3CCLZ 2AKLA 2J6AA 3ESWA 2ZAEB 4NB8A 5T64A 4Y7NI 1Q16A 4NBFA 2YU9I 3OW2Y 1VQL1 3CCE1 5LL6f 2RHBA 1X3WA 1K8A1 1I6HI 1P9NA 3QWUA 2VUGA 1USPA 1Q7Y1 1NJI2 3CCSZ 2I3CA 1YUKA 3S1QI 1VQ4Z 2QREB 2JIRA 5IP7I 1L1OC 2PK7A 4BBSI 3NH4A 2E2II 3CCQZ 3D9XA 3CD61 3H3VJ 3CPWY 3KIHA 2GTIA 5AN9F 3IX0A 3HOUI 3J7A4 3IFUA 2JA6I 4AYBA 4X6AI 2V45A 3I07A 2QRCB 3CCJ1 1YIJ1 1VQ41 3TDHB 3S1RI 2DE5A 4MH4A 3S14I 3IF8A 1RO4A 1YUAA 3FQMA 3LUSA 1YHQ1 2E2HI 1KRLA 3M3YI 2YADA 2K3RA 1QVFY 3CCVZ 4BY1I 3GTOI 2WAQA 2R7ZI 3OW2Z 1YJNZ 3CMA1 5C4JI 3CCV1 3KIFA 4HGZA 5T67A 4A3FI 1YJWZ 3J80b 4CL1A 3PO3I 3CCJZ 1YIJZ 3JAMb 4RVFA 1YI2Z 1VQ6Z 1VQ71 2DE6A 3GTGI 2IZ3A 4E2ZA 2RBLA 1K732 3GTLI 5FLXf 3HOZI 2GU2A 1RO2A 1W2BZ 3HOWI 2QR1B 2KI7B 4NB9A 3CQZI 1Q821 1VQM1 2G2KA 1QXFA 1YIT1 4RV9A 2VPWA 2JR6A 3VTNA 1S7MA 3I4MI 1X3ZA 2JA8I 3VMIA 1VQOZ 2RPRA 3G711 4MD7A 1YI21 1N2FA 2LFUA 4NBBA 1Q862 1VQO1 1ZB9A 1TWFI 5IT9f 2RT9A 2OTLZ 2JMOA 1Y1VS 5IP9I 1TWHI 4E31A 2QA4Z 2R6MA 4MONA 3CCR1 4A3CI 2IZ4A 1KD11 2IV2X 1VQ9Z 1ZH1A 3CC7Z 3G6EZ 2Q4ZA 1VQ81 4Y52I 4A93I 4HGYA 1PFTA 1DL6A 3K7AI 3RZOI 2W04A 3S1NI 3VB9A 2PM9A 1QVGY 4A3II 2LEXA 2NVTI 1FDOA 3S2DI 1K8A2 1W2BY 1TWAI 1NP6A 3NH8A 4NBAA 3PO2I 5D1PA 4BBRI 3NFZA 3CXCY 3D6WA 1RNIA 4NBDA 3NDJA 3CC4Z 2OTL1 3U50C 2KPIA 1YHQZ 1Z01A 4A3BI 3F3FC 3BG1B 2JS4A 3GKQA 3NDIA 1QF8A 1AA6A 4BY7I 4MRIA 1WZNA 2E9HA 3I55Z 5D1OA 3GTMS 4E33A 4QTTA 4A3LI 1QYPA 1N8R2 3HKZA 1YJW1 3S2HI 2F4MA 1TWGI 1RO0A 1LQLA 4A3KI 4NBCA 1VQ61 3CCEZ 2QA41 3MONA 2V8KA 5FLMI 2JIPA 5C4XI 4RVHA 4MXUA 3MZKB 3CC21 3NH5A 3GTPI 1VQK1 1FDIA 3F3PC 3I551 3FQQA 3S16I 1Q812 2B63I 1VQ91 1M1K2 2JA5I 5CM2M 5T6BA 2VPYA 2GTHA 3CCQ1 3Q87A 1KQSZ 1N8R1 3EERA 4E2WA 2JUBA 3S17I 4RVDA 1KQSY 1K731 1SIWA 3MZLB 4NBEA 4DK1A 5FLXb 4E2XA 1Y1VI 4NFRA 3I4NI 4A3EI 4E32A 2OZKA 1M901 1VQP1 3RZDI 4S1TA 1K9M2 3CPWZ 1Q811 2M48A 1R9TI 1JJ2Z 1VQNZ 3H0GI 1VQMZ 1VQKZ 1JJ2Y 2RIQA 2NAPA 3G71Z 4A3GI 3T4NB 2V3VA 4QTUA 1I50I 1X0TA 5A2Qf 1USPB 1TFIA 2JIMA 3CCUZ
chains in the Genus database with same CATH topology
1VQ7Z 2O53A 2HF1A 3CCM1 2R93I 3CC2Z 2O4HA 2OTJZ 1VQN1 1K9M1 1NJI1 3CC71 2K5RA 1RLYA 3CMAZ 4A3MI 2Q51A 4XX2A 4DGLA 2V8IA 4NH1C 3CCL1 1Q822 4E2YA 2E2JI 2OOYB 2P3YA 5C3EI 3S1MI 2WB1A 3G4S1 2QLVB 4BXXI 1Z02A 3CCU1 3JAMf 2NVXI 3CCMZ 3HOXI 1TWCI 2VUMI 2QEXZ 3I56Z 2Y0SA 2W03A 1JWHC 4E30A 1Q7Y2 3VMGA 2F4OA 1S72Z 3GTJI 2DE7A 2EGTA 3BG0B 1QVFZ 4NBHA 1VLAA 1YITZ 2V8JA 1ML8A 3J81b 4RS4A 2PMZA 3CD6Z 5D1OB 4NOZA 3GCFA 3VMHA 4TNUA 1VQLZ 4EWCA 4A3JI 1Y1WI 4DQYB 3CME1 5C44I 2M6NA 3EEDA 1VQPZ 1KC82 2OTJ1 5A2Qb 1M902 2JNYA 1QVGZ 1RQFA 3G6E1 3CMEZ 3J80f 1M1K1 3GTQI 1NUIA 3S15I 1WIIA 2P28A 2LIYA 1WW9A 2VF1A 1WCMI 1YJ91 2NVQI 1K83I 3P5JB 4NBGA 3CXCZ 2R92I 3PO3S 2QRDB 3HOVI 3GTMI 3FKII 3I561 3GTKI 4A3DI 3J81f 1Q861 4HH4A 1S721 1VQ5Z 4MD8A 3G4SZ 3HOYI 3CCRZ 3CC41 1SFOI 2BJOA 5IT9b 1ZB8A 1KC81 2QKDA 2QEX1 2H85A 4MD9A 4RVGA 1VQ51 1Z03A 2HU9A 1VQ8Z 3CCS1 1YJ9Z 1I3QI 3M4OI 1KD12 2OOXB 1YJN1 2NVYI 2JA7I 3TE5B 3CCLZ 2AKLA 2J6AA 3ESWA 2ZAEB 4NB8A 5T64A 4Y7NI 4NBFA 2YU9I 3OW2Y 1VQL1 3CCE1 5LL6f 2RHBA 1X3WA 1K8A1 1I6HI 1P9NA 3QWUA 2VUGA 1USPA 1Q7Y1 1NJI2 3CCSZ 2I3CA 1YUKA 3S1QI 1VQ4Z 2QREB 5IP7I 1L1OC 2PK7A 4BBSI 3NH4A 2E2II 3CCQZ 3D9XA 3CD61 3H3VJ 3CPWY 3KIHA 2GTIA 5AN9F 3IX0A 3HOUI 3J7A4 3IFUA 2JA6I 4AYBA 4X6AI 3I07A 2QRCB 3CCJ1 1YIJ1 1VQ41 3TDHB 3S1RI 2DE5A 4MH4A 3S14I 3IF8A 1RO4A 1YUAA 3FQMA 3LUSA 1YHQ1 2E2HI 1KRLA 3M3YI 2YADA 2K3RA 1QVFY 3CCVZ 4BY1I 3GTOI 2WAQA 2R7ZI 3OW2Z 1YJNZ 3CMA1 5C4JI 3CCV1 3KIFA 4HGZA 5T67A 4A3FI 1YJWZ 3J80b 4CL1A 3PO3I 3CCJZ 1YIJZ 3JAMb 4RVFA 1YI2Z 1VQ6Z 1VQ71 2DE6A 3GTGI 2IZ3A 4E2ZA 2RBLA 1K732 3GTLI 5FLXf 3HOZI 2GU2A 1RO2A 1W2BZ 3HOWI 2QR1B 2KI7B 4NB9A 3CQZI 1Q821 1VQM1 2G2KA 1YIT1 4RV9A 2JR6A 3VTNA 1S7MA 3I4MI 1X3ZA 2JA8I 3VMIA 1VQOZ 2RPRA 3G711 4MD7A 1YI21 1N2FA 2LFUA 4NBBA 1Q862 1VQO1 1ZB9A 1TWFI 5IT9f 2RT9A 2OTLZ 2JMOA 1Y1VS 5IP9I 1TWHI 4E31A 2QA4Z 2R6MA 4MONA 3CCR1 4A3CI 2IZ4A 1KD11 1VQ9Z 1ZH1A 3CC7Z 3G6EZ 2Q4ZA 1VQ81 4Y52I 4A93I 4HGYA 1PFTA 1DL6A 3K7AI 3RZOI 2W04A 3S1NI 3VB9A 2PM9A 1QVGY 4A3II 2NVTI 3S2DI 1K8A2 1W2BY 1TWAI 1NP6A 3NH8A 4NBAA 3PO2I 5D1PA 4BBRI 3NFZA 3CXCY 3D6WA 1RNIA 4NBDA 3NDJA 3CC4Z 2OTL1 3U50C 2KPIA 1YHQZ 1Z01A 4A3BI 3F3FC 3BG1B 2JS4A 3GKQA 3NDIA 1QF8A 4BY7I 4MRIA 3I55Z 2E9HA 5D1OA 3GTMS 4E33A 4QTTA 4A3LI 1QYPA 1N8R2 3HKZA 1YJW1 3S2HI 2F4MA 1TWGI 1RO0A 1LQLA 4A3KI 4NBCA 1VQ61 3CCEZ 2QA41 3MONA 2V8KA 5FLMI 5C4XI 4RVHA 4MXUA 3MZKB 3CC21 3NH5A 3GTPI 1VQK1 3F3PC 3I551 3FQQA 3S16I 1Q812 2B63I 1VQ91 1M1K2 2JA5I 5CM2M 5T6BA 2GTHA 3CCQ1 3Q87A 1KQSZ 1N8R1 3EERA 4E2WA 2JUBA 3S17I 4RVDA 1KQSY 1K731 3MZLB 4NBEA 4DK1A 5FLXb 4E2XA 1Y1VI 4NFRA 3I4NI 4A3EI 4E32A 2OZKA 1M901 1VQP1 3RZDI 4S1TA 1K9M2 3CPWZ 1Q811 2M48A 1R9TI 1JJ2Z 1VQNZ 3H0GI 1VQMZ 1VQKZ 1JJ2Y 2RIQA 3G71Z 4A3GI 3T4NB 4QTUA 1I50I 1X0TA 5A2Qf 1USPB 1TFIA 3CCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Z;  3CCM 1;  3CCV 1;  3I56 1;  3CC2 Z;  2OTJ Z;  1VQN 1;  1K9M 1;  1YJW Z;  1Q86 1;  1S72 1;  1VQ5 Z;  3I55 Z;  3G4S Z;  1NJI 1;  3CC7 1;  3CCR Z;  3CCJ Z;  1YIJ Z;  3CMA Z;  3CC4 1;  1YI2 Z;  1KC8 1;  1VQ6 Z;  2QEX 1;  1N8R 2;  1VQ7 1;  1YJW 1;  1VQ5 1;  3CCL 1;  1VQ8 Z;  3CCS 1;  1Q82 2;  1K73 2;  1YJ9 Z;  1KD1 2;  1VQ6 1;  3CCE Z;  1YJN 1;  2QA4 1;  1W2B Z;  3G4S 1;  3CCL Z;  3CCU 1;  3CCM Z;  2QEX Z;  3I56 Z;  1Q82 1;  3CC2 1;  1Q7Y 2;  1VQM 1;  1YIT 1;  1VQK 1;  1S72 Z;  3I55 1;  1VQO Z;  3OW2 Y;  1Q81 2;  3CCE 1;  1VQL 1;  3G71 1;  1YI2 1;  1K8A 1;  1VQ9 1;  1Q86 2;  1M1K 2;  1Q7Y 1;  1VQO 1;  1NJI 2;  1QVF Z;  3CCS Z;  2OTL Z;  3CCQ 1;  1KQS Z;  1YIT Z;  1N8R 1;  2QA4 Z;  1VQ4 Z;  3CCR 1;  1KQS Y;  1K73 1;  3CD6 Z;  1KD1 1;  1VQ9 Z;  3CC7 Z;  3G6E Z;  1VQ8 1;  3CCQ Z;  1M90 1;  3CD6 1;  1VQP 1;  1VQL Z;  3CPW Y;  1K9M 2;  3CME 1;  3CPW Z;  1QVG Y;  1VQP Z;  1KC8 2;  1Q81 1;  2OTJ 1;  1JJ2 Z;  1VQN Z;  1M90 2;  1K8A 2;  1VQM Z;  1W2B Y;  1QVG Z;  3CME Z;  3G6E 1;  1VQK Z;  3CCJ 1;  1YIJ 1;  1M1K 1;  1VQ4 1;  1JJ2 Y;  3G71 Z;  1YHQ 1;  3CXC Y;  1YJ9 1;  1QVF Y;  3CCV Z;  3OW2 Z;  1YJN Z;  3CC4 Z;  3CMA 1;  2OTL 1;  3CXC Z;  1YHQ Z;  3CCU Z; 
#chains in the Genus database with same CATH topology
 1VQ7 Z;  2O53 A;  2HF1 A;  3CCM 1;  2R93 I;  3CC2 Z;  2O4H A;  2OTJ Z;  1VQN 1;  1K9M 1;  1NJI 1;  3CC7 1;  2K5R A;  2VPZ A;  1RLY A;  3CMA Z;  4A3M I;  2Q51 A;  4XX2 A;  4DGL A;  2V8I A;  4NH1 C;  2E7Z A;  3CCL 1;  1Q82 2;  4E2Y A;  2E2J I;  2OOY B;  2P3Y A;  5C3E I;  3S1M I;  2WB1 A;  3G4S 1;  2QLV B;  4BXX I;  1Z02 A;  3CCU 1;  3JAM f;  2NVX I;  3CCM Z;  3HOX I;  1TWC I;  2VUM I;  2QEX Z;  3I56 Z;  2Y0S A;  2W03 A;  1JWH C;  4E30 A;  1Q7Y 2;  3VMG A;  2F4O A;  1S72 Z;  2VPX A;  3GTJ I;  2DE7 A;  2JIQ A;  2EGT A;  3BG0 B;  1QVF Z;  4NBH A;  1VLA A;  1YIT Z;  2V8J A;  1ML8 A;  3J81 b;  4RS4 A;  2PMZ A;  3D2L A;  3CD6 Z;  5D1O B;  2AYD A;  4NOZ A;  3GCF A;  3VMH A;  4TNU A;  1VQL Z;  4EWC A;  4A3J I;  1Y1W I;  4DQY B;  3CME 1;  5C44 I;  2M6N A;  3EED A;  1VQP Z;  1KC8 2;  2OTJ 1;  5A2Q b;  3IR7 A;  1M90 2;  2JNY A;  1QVG Z;  1RQF A;  3G6E 1;  3CME Z;  3J80 f;  1M1K 1;  3GTQ I;  1NUI A;  3S15 I;  1WII A;  2P28 A;  2LIY A;  1WW9 A;  2VF1 A;  1WCM I;  1YJ9 1;  2NVQ I;  1K83 I;  3P5J B;  4NBG A;  3CXC Z;  2R92 I;  3PO3 S;  2QRD B;  1Y8C A;  3HOV I;  3GTM I;  3FKI I;  3I56 1;  3GTK I;  4A3D I;  3J81 f;  1Q86 1;  4HH4 A;  1S72 1;  1VQ5 Z;  4MD8 A;  3G4S Z;  3HOY I;  3CCR Z;  3CC4 1;  1SFO I;  2BJO A;  5IT9 b;  1ZB8 A;  1KC8 1;  2QKD A;  2QEX 1;  2H85 A;  4MD9 A;  2JIO A;  4RVG A;  1VQ5 1;  1Z03 A;  2HU9 A;  1VQ8 Z;  3CCS 1;  1YJ9 Z;  1I3Q I;  3M4O I;  1KD1 2;  1WJ2 A;  2OOX B;  1YJN 1;  2NVY I;  2JA7 I;  3TE5 B;  3CCL Z;  2AKL A;  2J6A A;  3ESW A;  2ZAE B;  4NB8 A;  5T64 A;  4Y7N I;  1Q16 A;  4NBF A;  2YU9 I;  3OW2 Y;  1VQL 1;  3CCE 1;  5LL6 f;  2RHB A;  1X3W A;  1K8A 1;  1I6H I;  1P9N A;  3QWU A;  2VUG A;  1USP A;  1Q7Y 1;  1NJI 2;  3CCS Z;  2I3C A;  1YUK A;  3S1Q I;  1VQ4 Z;  2QRE B;  2JIR A;  5IP7 I;  1L1O C;  2PK7 A;  4BBS I;  3NH4 A;  2E2I I;  3CCQ Z;  3D9X A;  3CD6 1;  3H3V J;  3CPW Y;  3KIH A;  2GTI A;  5AN9 F;  3IX0 A;  3HOU I;  3J7A 4;  3IFU A;  2JA6 I;  4AYB A;  4X6A I;  2V45 A;  3I07 A;  2QRC B;  3CCJ 1;  1YIJ 1;  1VQ4 1;  3TDH B;  3S1R I;  2DE5 A;  4MH4 A;  3S14 I;  3IF8 A;  1RO4 A;  1YUA A;  3FQM A;  3LUS A;  1YHQ 1;  2E2H I;  1KRL A;  3M3Y I;  2YAD A;  2K3R A;  1QVF Y;  3CCV Z;  4BY1 I;  3GTO I;  2WAQ A;  2R7Z I;  3OW2 Z;  1YJN Z;  3CMA 1;  5C4J I;  3CCV 1;  3KIF A;  4HGZ A;  5T67 A;  4A3F I;  1YJW Z;  3J80 b;  4CL1 A;  3PO3 I;  3CCJ Z;  1YIJ Z;  3JAM b;  4RVF A;  1YI2 Z;  1VQ6 Z;  1VQ7 1;  2DE6 A;  3GTG I;  2IZ3 A;  4E2Z A;  2RBL A;  1K73 2;  3GTL I;  5FLX f;  3HOZ I;  2GU2 A;  1RO2 A;  1W2B Z;  3HOW I;  2QR1 B;  2KI7 B;  4NB9 A;  3CQZ I;  1Q82 1;  1VQM 1;  2G2K A;  1QXF A;  1YIT 1;  4RV9 A;  2VPW A;  2JR6 A;  3VTN A;  1S7M A;  3I4M I;  1X3Z A;  2JA8 I;  3VMI A;  1VQO Z;  2RPR A;  3G71 1;  4MD7 A;  1YI2 1;  1N2F A;  2LFU A;  4NBB A;  1Q86 2;  1VQO 1;  1ZB9 A;  1TWF I;  5IT9 f;  2RT9 A;  2OTL Z;  2JMO A;  1Y1V S;  5IP9 I;  1TWH I;  4E31 A;  2QA4 Z;  2R6M A;  4MON A;  3CCR 1;  4A3C I;  2IZ4 A;  1KD1 1;  2IV2 X;  1VQ9 Z;  1ZH1 A;  3CC7 Z;  3G6E Z;  2Q4Z A;  1VQ8 1;  4Y52 I;  4A93 I;  4HGY A;  1PFT A;  1DL6 A;  3K7A I;  3RZO I;  2W04 A;  3S1N I;  3VB9 A;  2PM9 A;  1QVG Y;  4A3I I;  2LEX A;  2NVT I;  1FDO A;  3S2D I;  1K8A 2;  1W2B Y;  1TWA I;  1NP6 A;  3NH8 A;  4NBA A;  3PO2 I;  5D1P A;  4BBR I;  3NFZ A;  3CXC Y;  3D6W A;  1RNI A;  4NBD A;  3NDJ A;  3CC4 Z;  2OTL 1;  3U50 C;  2KPI A;  1YHQ Z;  1Z01 A;  4A3B I;  3F3F C;  3BG1 B;  2JS4 A;  3GKQ A;  3NDI A;  1QF8 A;  1AA6 A;  4BY7 I;  4MRI A;  1WZN A;  2E9H A;  3I55 Z;  5D1O A;  3GTM S;  4E33 A;  4QTT A;  4A3L I;  1QYP A;  1N8R 2;  3HKZ A;  1YJW 1;  3S2H I;  2F4M A;  1TWG I;  1RO0 A;  1LQL A;  4A3K I;  4NBC A;  1VQ6 1;  3CCE Z;  2QA4 1;  3MON A;  2V8K A;  5FLM I;  2JIP A;  5C4X I;  4RVH A;  4MXU A;  3MZK B;  3CC2 1;  3NH5 A;  3GTP I;  1VQK 1;  1FDI A;  3F3P C;  3I55 1;  3FQQ A;  3S16 I;  1Q81 2;  2B63 I;  1VQ9 1;  1M1K 2;  2JA5 I;  5CM2 M;  5T6B A;  2VPY A;  2GTH A;  3CCQ 1;  3Q87 A;  1KQS Z;  1N8R 1;  3EER A;  4E2W A;  2JUB A;  3S17 I;  4RVD A;  1KQS Y;  1K73 1;  1SIW A;  3MZL B;  4NBE A;  4DK1 A;  5FLX b;  4E2X A;  1Y1V I;  4NFR A;  3I4N I;  4A3E I;  4E32 A;  2OZK A;  1M90 1;  1VQP 1;  3RZD I;  4S1T A;  1K9M 2;  3CPW Z;  1Q81 1;  2M48 A;  1R9T I;  1JJ2 Z;  1VQN Z;  3H0G I;  1VQM Z;  1VQK Z;  1JJ2 Y;  2RIQ A;  2NAP A;  3G71 Z;  4A3G I;  3T4N B;  2V3V A;  4QTU A;  1I50 I;  1X0T A;  5A2Q f;  1USP B;  1TFI A;  2JIM A;  3CCU Z; 
#chains in the Genus database with same CATH homology
 1VQ7 Z;  2O53 A;  2HF1 A;  3CCM 1;  2R93 I;  3CC2 Z;  2O4H A;  2OTJ Z;  1VQN 1;  1K9M 1;  1NJI 1;  3CC7 1;  2K5R A;  1RLY A;  3CMA Z;  4A3M I;  2Q51 A;  4XX2 A;  4DGL A;  2V8I A;  4NH1 C;  3CCL 1;  1Q82 2;  4E2Y A;  2E2J I;  2OOY B;  2P3Y A;  5C3E I;  3S1M I;  2WB1 A;  3G4S 1;  2QLV B;  4BXX I;  1Z02 A;  3CCU 1;  3JAM f;  2NVX I;  3CCM Z;  3HOX I;  1TWC I;  2VUM I;  2QEX Z;  3I56 Z;  2Y0S A;  2W03 A;  1JWH C;  4E30 A;  1Q7Y 2;  3VMG A;  2F4O A;  1S72 Z;  3GTJ I;  2DE7 A;  2EGT A;  3BG0 B;  1QVF Z;  4NBH A;  1VLA A;  1YIT Z;  2V8J A;  1ML8 A;  3J81 b;  4RS4 A;  2PMZ A;  3CD6 Z;  5D1O B;  4NOZ A;  3GCF A;  3VMH A;  4TNU A;  1VQL Z;  4EWC A;  4A3J I;  1Y1W I;  4DQY B;  3CME 1;  5C44 I;  2M6N A;  3EED A;  1VQP Z;  1KC8 2;  2OTJ 1;  5A2Q b;  1M90 2;  2JNY A;  1QVG Z;  1RQF A;  3G6E 1;  3CME Z;  3J80 f;  1M1K 1;  3GTQ I;  1NUI A;  3S15 I;  1WII A;  2P28 A;  2LIY A;  1WW9 A;  2VF1 A;  1WCM I;  1YJ9 1;  2NVQ I;  1K83 I;  3P5J B;  4NBG A;  3CXC Z;  2R92 I;  3PO3 S;  2QRD B;  3HOV I;  3GTM I;  3FKI I;  3I56 1;  3GTK I;  4A3D I;  3J81 f;  1Q86 1;  4HH4 A;  1S72 1;  1VQ5 Z;  4MD8 A;  3G4S Z;  3HOY I;  3CCR Z;  3CC4 1;  1SFO I;  2BJO A;  5IT9 b;  1ZB8 A;  1KC8 1;  2QKD A;  2QEX 1;  2H85 A;  4MD9 A;  4RVG A;  1VQ5 1;  1Z03 A;  2HU9 A;  1VQ8 Z;  3CCS 1;  1YJ9 Z;  1I3Q I;  3M4O I;  1KD1 2;  2OOX B;  1YJN 1;  2NVY I;  2JA7 I;  3TE5 B;  3CCL Z;  2AKL A;  2J6A A;  3ESW A;  2ZAE B;  4NB8 A;  5T64 A;  4Y7N I;  4NBF A;  2YU9 I;  3OW2 Y;  1VQL 1;  3CCE 1;  5LL6 f;  2RHB A;  1X3W A;  1K8A 1;  1I6H I;  1P9N A;  3QWU A;  2VUG A;  1USP A;  1Q7Y 1;  1NJI 2;  3CCS Z;  2I3C A;  1YUK A;  3S1Q I;  1VQ4 Z;  2QRE B;  5IP7 I;  1L1O C;  2PK7 A;  4BBS I;  3NH4 A;  2E2I I;  3CCQ Z;  3D9X A;  3CD6 1;  3H3V J;  3CPW Y;  3KIH A;  2GTI A;  5AN9 F;  3IX0 A;  3HOU I;  3J7A 4;  3IFU A;  2JA6 I;  4AYB A;  4X6A I;  3I07 A;  2QRC B;  3CCJ 1;  1YIJ 1;  1VQ4 1;  3TDH B;  3S1R I;  2DE5 A;  4MH4 A;  3S14 I;  3IF8 A;  1RO4 A;  1YUA A;  3FQM A;  3LUS A;  1YHQ 1;  2E2H I;  1KRL A;  3M3Y I;  2YAD A;  2K3R A;  1QVF Y;  3CCV Z;  4BY1 I;  3GTO I;  2WAQ A;  2R7Z I;  3OW2 Z;  1YJN Z;  3CMA 1;  5C4J I;  3CCV 1;  3KIF A;  4HGZ A;  5T67 A;  4A3F I;  1YJW Z;  3J80 b;  4CL1 A;  3PO3 I;  3CCJ Z;  1YIJ Z;  3JAM b;  4RVF A;  1YI2 Z;  1VQ6 Z;  1VQ7 1;  2DE6 A;  3GTG I;  2IZ3 A;  4E2Z A;  2RBL A;  1K73 2;  3GTL I;  5FLX f;  3HOZ I;  2GU2 A;  1RO2 A;  1W2B Z;  3HOW I;  2QR1 B;  2KI7 B;  4NB9 A;  3CQZ I;  1Q82 1;  1VQM 1;  2G2K A;  1YIT 1;  4RV9 A;  2JR6 A;  3VTN A;  1S7M A;  3I4M I;  1X3Z A;  2JA8 I;  3VMI A;  1VQO Z;  2RPR A;  3G71 1;  4MD7 A;  1YI2 1;  1N2F A;  2LFU A;  4NBB A;  1Q86 2;  1VQO 1;  1ZB9 A;  1TWF I;  5IT9 f;  2RT9 A;  2OTL Z;  2JMO A;  1Y1V S;  5IP9 I;  1TWH I;  4E31 A;  2QA4 Z;  2R6M A;  4MON A;  3CCR 1;  4A3C I;  2IZ4 A;  1KD1 1;  1VQ9 Z;  1ZH1 A;  3CC7 Z;  3G6E Z;  2Q4Z A;  1VQ8 1;  4Y52 I;  4A93 I;  4HGY A;  1PFT A;  1DL6 A;  3K7A I;  3RZO I;  2W04 A;  3S1N I;  3VB9 A;  2PM9 A;  1QVG Y;  4A3I I;  2NVT I;  3S2D I;  1K8A 2;  1W2B Y;  1TWA I;  1NP6 A;  3NH8 A;  4NBA A;  3PO2 I;  5D1P A;  4BBR I;  3NFZ A;  3CXC Y;  3D6W A;  1RNI A;  4NBD A;  3NDJ A;  3CC4 Z;  2OTL 1;  3U50 C;  2KPI A;  1YHQ Z;  1Z01 A;  4A3B I;  3F3F C;  3BG1 B;  2JS4 A;  3GKQ A;  3NDI A;  1QF8 A;  4BY7 I;  4MRI A;  3I55 Z;  2E9H A;  5D1O A;  3GTM S;  4E33 A;  4QTT A;  4A3L I;  1QYP A;  1N8R 2;  3HKZ A;  1YJW 1;  3S2H I;  2F4M A;  1TWG I;  1RO0 A;  1LQL A;  4A3K I;  4NBC A;  1VQ6 1;  3CCE Z;  2QA4 1;  3MON A;  2V8K A;  5FLM I;  5C4X I;  4RVH A;  4MXU A;  3MZK B;  3CC2 1;  3NH5 A;  3GTP I;  1VQK 1;  3F3P C;  3I55 1;  3FQQ A;  3S16 I;  1Q81 2;  2B63 I;  1VQ9 1;  1M1K 2;  2JA5 I;  5CM2 M;  5T6B A;  2GTH A;  3CCQ 1;  3Q87 A;  1KQS Z;  1N8R 1;  3EER A;  4E2W A;  2JUB A;  3S17 I;  4RVD A;  1KQS Y;  1K73 1;  3MZL B;  4NBE A;  4DK1 A;  5FLX b;  4E2X A;  1Y1V I;  4NFR A;  3I4N I;  4A3E I;  4E32 A;  2OZK A;  1M90 1;  1VQP 1;  3RZD I;  4S1T A;  1K9M 2;  3CPW Z;  1Q81 1;  2M48 A;  1R9T I;  1JJ2 Z;  1VQN Z;  3H0G I;  1VQM Z;  1VQK Z;  1JJ2 Y;  2RIQ A;  3G71 Z;  4A3G I;  3T4N B;  4QTU A;  1I50 I;  1X0T A;  5A2Q f;  1USP B;  1TFI A;  3CCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...