1Q811

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81100
3G4SZ 1KC82 3CCL1 3CCSZ 1VQ61 3CMEZ 1YI2Z 1VQK1 3CC2Z 1VQ7Z 1KC81 3CCUZ 3OW2Y 3CCM1 3G6EZ 1NJI1 1VQ5Z 3CXCZ 1Q862 1W2BZ 3CCQZ 1JJ2Y 1YJ9Z 1YITZ 2QEX1 1K9M2 2OTJ1 1M1K2 1VQ4Z 3CCJ1 1Q861 1Q812 1QVGY 3CCLZ 1VQ6Z 3CCV1 1YHQ1 1VQKZ 3CPWZ 1S721 1K732 1QVFZ 3CD61 3I561 1N8R2 3CCMZ 1Q822 3CCR1 1KQSY 3I551 2QEXZ 1Q821 2OTJZ 3CCJZ 1YJWZ 2QA41 1VQL1 1YJN1 1JJ2Z 3CCVZ 1VQO1 2OTL1 1YHQZ 3CC41 1Q7Y2 1K9M1 1M1K1 3CD6Z 3G711 3I56Z 3CC71 1Q811 1M902 1YI21 1W2BY 3CCRZ 1K8A2 1M901 3I55Z 1K731 1VQN1 1VQM1 2QA4Z 1VQP1 1N8R1 1VQ91 1VQLZ 1YJNZ 1K8A1 3CCE1 3OW2Z 1KQSZ 1VQOZ 1YIJ1 2OTLZ 3CMA1 3CC4Z 1KD12 1VQ81 3G71Z 3CC7Z 3G4S1 1S72Z 3CCS1 1NJI2 1KD11 3CME1 1QVGZ 3CXCY 3CC21 1VQ71 1Q7Y1 1VQNZ 1VQMZ 3CCU1 1VQPZ 1VQ9Z 3G6E1 3CCEZ 1VQ51 1YIJZ 3CCQ1 1YJ91 3CMAZ 1YJW1 1YIT1 1VQ8Z 1VQ41 3CPWY 1QVFY
chains in the Genus database with same CATH superfamily
1X3WA 1SIWA 2Q51A 5T6BA 3HOWI 2QRCB 3CCSZ 1RNIA 4A3EI 1VQ61 2EGTA 4BXXI 1KRLA 2PMZA 5LL6f 2HF1A 3JAMb 2VUGA 3KIHA 3GTQI 2W03A 2RBLA 3JAMf 3CXCZ 1W2BZ 3HKZA 4RV9A 4DGLA 1YITZ 3GCFA 2OTJ1 1VQ4Z 4NBGA 1Q812 3VMIA 3HOZI 1DL6A 4E33A 2O53A 2NVQI 5C4JI 3CPWZ 4MXUA 1RO0A 4Y52I 3QWUA 4RS4A 2P3YA 3EEDA 3CCR1 1KQSY 1RO4A 2V8JA 2VUMI 1QYPA 2NVTI 4S1TA 4NBCA 1VLAA 3CCVZ 2OTL1 1Q7Y2 1M1K1 4HGYA 1LQLA 3F3PC 4A3MI 1K8A2 3GTJI 1K731 2E2II 1WZNA 2NVXI 3P5JB 4BY1I 2QREB 3VMGA 1VQLZ 2E2JI 2J6AA 3CC4Z 2NAPA 3GTMS 1ML8A 2V8IA 4X6AI 3KIFA 4A3FI 2DE7A 3CXCY 2NVYI 1ZB8A 1VQNZ 2DE5A 3FKII 2GTIA 1VQ51 2RHBA 4E32A 3S17I 2M48A 3CCQ1 1YJW1 1RQFA 1TWCI 3CPWY 3LUSA 3J80b 2LFUA 3MZLB 4NBFA 1VQK1 3J80f 3CC2Z 1FDIA 1VQ7Z 2M6NA 1Y1VS 1KC81 2JA8I 2JUBA 3M4OI 1YUAA 3G6EZ 1Q862 1QXFA 1TWFI 2KI7B 3FQQA 2JIRA 1AA6A 1YJ9Z 2QEX1 1M1K2 5IP7I 5CM2M 1VQ6Z 1YHQ1 3K7AI 2R7ZI 1NP6A 2RIQA 1S721 1K732 1QVFZ 3S1MI 3IR7A 2JS4A 5AN9F 3GKQA 4NH1C 3I551 3D2LA 1Q821 2OTJZ 3IX0A 1FDOA 3FQMA 3BG1B 1YJN1 3TE5B 1JJ2Z 2V8KA 2JA5I 4NB9A 2DE6A 2E9HA 1K9M1 4DQYB 3GTLI 4BBRI 1I50I 3G711 2E2HI 1M902 1TWHI 3PO3I 3HOXI 1QF8A 3CCRZ 3I4NI 3S1RI 5IP9I 3HOUI 2R6MA 1X0TA 1VQP1 1N8R1 1VQ91 3CCE1 3J81b 2OTLZ 1YIJ1 1TWGI 4A3GI 3GTMI 1KD12 3CQZI 3I07A 1VQ81 3J81f 4A3JI 1JWHC 3RZDI 3G4S1 3VTNA 1PFTA 3CME1 3S15I 1ZB9A 4NFRA 3CCU1 1Y1WI 4BBSI 5FLMI 1Z01A 4NBBA 2GU2A 3S1QI 2I3CA 1L1OC 3S1NI 4HH4A 2JA6I 2Y0SA 1RO2A 5D1OA 4QTTA 3NDIA 3S16I 4AYBA 1WIIA 1QVFY 1Y8CA 4XX2A 3CCL1 1USPA 5A2Qb 2OZKA 1YI2Z 2LEXA 2Q4ZA 2YADA 2F4OA 1S7MA 5A2Qf 4NB8A 2LIYA 3OW2Y 3CCM1 3F3FC 1NJI1 1VQ5Z 3H0GI 3CCQZ 1JJ2Y 4MRIA 2QRDB 2V45A 4RVHA 2RT9A 3Q87A 3U50C 1K9M2 2JMOA 3CCJ1 2W04A 4NBAA 2R93I 3S2HI 1VQKZ 2JR6A 3CD61 3I561 4MD7A 4E30A 1N8R2 2F4MA 4Y7NI 1Z03A 1RLYA 3D6WA 2HU9A 3NH5A 5C4XI 3ESWA 1X3ZA 3NH4A 2QEXZ 4HGZA 4MH4A 2O4HA 4RVDA 2QA41 2YU9I 2QKDA 1WW9A 1VQO1 1YHQZ 2IV2X 1R9TI 4E2YA 2VF1A 2VPZA 4MONA 3CC71 4A3BI 1P9NA 2PM9A 3I55Z 1VQM1 2IZ4A 1WCMI 2QR1B 1YJNZ 1K8A1 3OW2Z 3TDHB 3VMHA 3CMA1 5C44I 1NUIA 4EWCA 4CL1A 2VPWA 3G71Z 2KPIA 3EERA 2E7ZA 2GTHA 3CCS1 4RVGA 1NJI2 4BY7I 3GTPI 1WJ2A 5C3EI 3J7A4 4NOZA 4E2WA 1VQPZ 1VQ9Z 2VPYA 5D1PA 3CCEZ 1Z02A 1YIJZ 3IF8A 4TNUA 1YIT1 4A3CI 2RPRA 1VQ8Z 1VQ41 1TWAI 2QLVB 3G4SZ 1K83I 4E31A 4A3LI 4A3KI 1KC82 3H3VJ 5FLXb 3CMEZ 4NBEA 2PK7A 4A3DI 3VB9A 5FLXf 3CCUZ 4NBDA 3NH8A 4E2XA 5T64A 4QTUA 4RVFA 1TFIA 2AKLA 5IT9b 3D9XA 3BG0B 2JA7I 2WB1A 2JIQA 3GTOI 2WAQA 5IT9f 3S14I 1Q861 2B63I 1QVGY 3CCLZ 4NBHA 3CCV1 2VPXA 1ZH1A 3NDJA 4MD8A 3PO3S 1Y1VI 2IZ3A 3CCMZ 1Q822 2OOXB 3HOYI 3MONA 5D1OB 1Q16A 3CCJZ 1YJWZ 3NFZA 1USPB 1VQL1 2AYDA 1YUKA 3CC41 4E2ZA 3CD6Z 3I56Z 1Q811 1YI21 1W2BY 1I6HI 3IFUA 4MD9A 4DK1A 1M901 3T4NB 1VQN1 3M3YI 3I4MI 2H85A 2JIPA 2QA4Z 3PO2I 4A93I 5T67A 1KQSZ 1VQOZ 2JNYA 2ZAEB 2K5RA 3HOVI 2G2KA 2V3VA 1SFOI 3CC7Z 1S72Z 2OOYB 1KD11 4A3II 2JIMA 1QVGZ 3CC21 2BJOA 1VQ71 1Q7Y1 1VQMZ 3RZOI 1I3QI 3MZKB 2JIOA 2K3RA 3G6E1 2R92I 3S2DI 3GTGI 1YJ91 3CMAZ 1N2FA 2P28A 3GTKI
chains in the Genus database with same CATH topology
1X3WA 2Q51A 5T6BA 3HOWI 2QRCB 3CCSZ 1RNIA 4A3EI 1VQ61 2EGTA 4BXXI 1KRLA 2PMZA 5LL6f 2HF1A 3JAMb 2VUGA 3KIHA 3GTQI 2W03A 2RBLA 3JAMf 3CXCZ 1W2BZ 3HKZA 4RV9A 4DGLA 1YITZ 3GCFA 2OTJ1 1VQ4Z 4NBGA 1Q812 3VMIA 3HOZI 1DL6A 4E33A 2O53A 2NVQI 5C4JI 3CPWZ 4MXUA 1RO0A 4Y52I 3QWUA 4RS4A 2P3YA 3EEDA 3CCR1 1KQSY 1RO4A 2V8JA 2VUMI 1QYPA 2NVTI 4S1TA 4NBCA 1VLAA 3CCVZ 2OTL1 1Q7Y2 1M1K1 4HGYA 1LQLA 3F3PC 4A3MI 1K8A2 3GTJI 1K731 2E2II 2NVXI 3P5JB 4BY1I 2QREB 3VMGA 1VQLZ 2E2JI 2J6AA 3CC4Z 3GTMS 1ML8A 2V8IA 4X6AI 3KIFA 4A3FI 2DE7A 3CXCY 2NVYI 1ZB8A 1VQNZ 2DE5A 3FKII 2GTIA 1VQ51 2RHBA 4E32A 3S17I 2M48A 3CCQ1 1YJW1 1RQFA 1TWCI 3CPWY 3LUSA 3J80b 2LFUA 3MZLB 4NBFA 1VQK1 3J80f 3CC2Z 1VQ7Z 2M6NA 1Y1VS 1KC81 2JA8I 2JUBA 3M4OI 1YUAA 3G6EZ 1Q862 2KI7B 1TWFI 3FQQA 1YJ9Z 2QEX1 1M1K2 5IP7I 5CM2M 1VQ6Z 1YHQ1 3K7AI 2R7ZI 1NP6A 2RIQA 1S721 1K732 1QVFZ 3S1MI 2JS4A 5AN9F 3GKQA 4NH1C 3I551 1Q821 2OTJZ 3IX0A 3FQMA 3BG1B 1YJN1 3TE5B 1JJ2Z 2V8KA 2JA5I 4NB9A 2DE6A 2E9HA 1K9M1 4DQYB 3GTLI 4BBRI 1I50I 3G711 2E2HI 1M902 1TWHI 3PO3I 3HOXI 1QF8A 3CCRZ 3I4NI 3S1RI 5IP9I 3HOUI 2R6MA 1X0TA 1VQP1 1N8R1 1VQ91 3CCE1 3J81b 2OTLZ 1YIJ1 1TWGI 4A3GI 3GTMI 1KD12 3CQZI 3I07A 1VQ81 3J81f 4A3JI 1JWHC 3RZDI 3G4S1 3VTNA 1PFTA 3CME1 3S15I 1ZB9A 4NFRA 3CCU1 1Y1WI 4BBSI 5FLMI 1Z01A 4NBBA 2GU2A 3S1QI 2I3CA 1L1OC 3S1NI 4HH4A 2JA6I 2Y0SA 1RO2A 5D1OA 4QTTA 3NDIA 3S16I 4AYBA 1WIIA 1QVFY 4XX2A 3CCL1 1USPA 5A2Qb 2OZKA 1YI2Z 2Q4ZA 2YADA 2F4OA 1S7MA 5A2Qf 4NB8A 2LIYA 3OW2Y 3CCM1 3F3FC 1NJI1 1VQ5Z 3H0GI 3CCQZ 1JJ2Y 4MRIA 2QRDB 4RVHA 2RT9A 3Q87A 3U50C 1K9M2 2JMOA 3CCJ1 2W04A 4NBAA 2R93I 3S2HI 1VQKZ 2JR6A 3CD61 3I561 4MD7A 4E30A 1N8R2 2F4MA 4Y7NI 1Z03A 1RLYA 3D6WA 2HU9A 3NH5A 5C4XI 3ESWA 1X3ZA 3NH4A 2QEXZ 4HGZA 4MH4A 2O4HA 4RVDA 2QA41 2YU9I 2QKDA 1WW9A 1VQO1 1YHQZ 1R9TI 4E2YA 2VF1A 4MONA 3CC71 4A3BI 1P9NA 2PM9A 3I55Z 1VQM1 2IZ4A 1WCMI 2QR1B 1YJNZ 1K8A1 3OW2Z 3TDHB 3VMHA 3CMA1 5C44I 1NUIA 4EWCA 4CL1A 3G71Z 2KPIA 3EERA 2GTHA 3CCS1 4RVGA 1NJI2 4BY7I 3GTPI 5C3EI 3J7A4 4NOZA 4E2WA 1VQPZ 1VQ9Z 5D1PA 3CCEZ 1Z02A 1YIJZ 3IF8A 4TNUA 1YIT1 4A3CI 2RPRA 1VQ8Z 1VQ41 1TWAI 2QLVB 3G4SZ 1K83I 4E31A 4A3LI 4A3KI 1KC82 3H3VJ 5FLXb 3CMEZ 4NBEA 2PK7A 4A3DI 3VB9A 5FLXf 3CCUZ 4NBDA 3NH8A 4E2XA 5T64A 4QTUA 4RVFA 1TFIA 2AKLA 5IT9b 3D9XA 3BG0B 2JA7I 2WB1A 3GTOI 2WAQA 5IT9f 3S14I 1Q861 2B63I 1QVGY 3CCLZ 4NBHA 3CCV1 1ZH1A 3NDJA 4MD8A 3PO3S 1Y1VI 2IZ3A 3CCMZ 1Q822 2OOXB 3HOYI 3MONA 5D1OB 3CCJZ 1YJWZ 3NFZA 1USPB 1VQL1 1YUKA 3CC41 4E2ZA 3CD6Z 3I56Z 1Q811 1YI21 1W2BY 1I6HI 3IFUA 4MD9A 4DK1A 1M901 3T4NB 1VQN1 3M3YI 3I4MI 2H85A 2QA4Z 3PO2I 4A93I 5T67A 1KQSZ 1VQOZ 2JNYA 2ZAEB 2K5RA 3HOVI 2G2KA 1SFOI 3CC7Z 1S72Z 2OOYB 1KD11 4A3II 1QVGZ 3CC21 2BJOA 1VQ71 1Q7Y1 1VQMZ 3RZOI 1I3QI 3MZKB 2K3RA 3G6E1 2R92I 3S2DI 3GTGI 1YJ91 3CMAZ 1N2FA 2P28A 3GTKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S Z;  1KC8 2;  3CCL 1;  3CCS Z;  1VQ6 1;  3CME Z;  1YI2 Z;  1VQK 1;  3CC2 Z;  1VQ7 Z;  1KC8 1;  3CCU Z;  3OW2 Y;  3CCM 1;  3G6E Z;  1NJI 1;  1VQ5 Z;  3CXC Z;  1Q86 2;  1W2B Z;  3CCQ Z;  1JJ2 Y;  1YJ9 Z;  1YIT Z;  2QEX 1;  1K9M 2;  2OTJ 1;  1M1K 2;  1VQ4 Z;  3CCJ 1;  1Q86 1;  1Q81 2;  1QVG Y;  3CCL Z;  1VQ6 Z;  3CCV 1;  1YHQ 1;  1VQK Z;  3CPW Z;  1S72 1;  1K73 2;  1QVF Z;  3CD6 1;  3I56 1;  1N8R 2;  3CCM Z;  1Q82 2;  3CCR 1;  1KQS Y;  3I55 1;  2QEX Z;  1Q82 1;  2OTJ Z;  3CCJ Z;  1YJW Z;  2QA4 1;  1VQL 1;  1YJN 1;  1JJ2 Z;  3CCV Z;  1VQO 1;  2OTL 1;  1YHQ Z;  3CC4 1;  1Q7Y 2;  1K9M 1;  1M1K 1;  3CD6 Z;  3G71 1;  3I56 Z;  3CC7 1;  1Q81 1;  1M90 2;  1YI2 1;  1W2B Y;  3CCR Z;  1K8A 2;  1M90 1;  3I55 Z;  1K73 1;  1VQN 1;  1VQM 1;  2QA4 Z;  1VQP 1;  1N8R 1;  1VQ9 1;  1VQL Z;  1YJN Z;  1K8A 1;  3CCE 1;  3OW2 Z;  1KQS Z;  1VQO Z;  1YIJ 1;  2OTL Z;  3CMA 1;  3CC4 Z;  1KD1 2;  1VQ8 1;  3G71 Z;  3CC7 Z;  3G4S 1;  1S72 Z;  3CCS 1;  1NJI 2;  1KD1 1;  3CME 1;  1QVG Z;  3CXC Y;  3CC2 1;  1VQ7 1;  1Q7Y 1;  1VQN Z;  1VQM Z;  3CCU 1;  1VQP Z;  1VQ9 Z;  3G6E 1;  3CCE Z;  1VQ5 1;  1YIJ Z;  3CCQ 1;  1YJ9 1;  3CMA Z;  1YJW 1;  1YIT 1;  1VQ8 Z;  1VQ4 1;  3CPW Y;  1QVF Y; 
#chains in the Genus database with same CATH topology
 1X3W A;  1SIW A;  2Q51 A;  5T6B A;  3HOW I;  2QRC B;  3CCS Z;  1RNI A;  4A3E I;  1VQ6 1;  2EGT A;  4BXX I;  1KRL A;  2PMZ A;  5LL6 f;  2HF1 A;  3JAM b;  2VUG A;  3KIH A;  3GTQ I;  2W03 A;  2RBL A;  3JAM f;  3CXC Z;  1W2B Z;  3HKZ A;  4RV9 A;  4DGL A;  1YIT Z;  3GCF A;  2OTJ 1;  1VQ4 Z;  4NBG A;  1Q81 2;  3VMI A;  3HOZ I;  1DL6 A;  4E33 A;  2O53 A;  2NVQ I;  5C4J I;  3CPW Z;  4MXU A;  1RO0 A;  4Y52 I;  3QWU A;  4RS4 A;  2P3Y A;  3EED A;  3CCR 1;  1KQS Y;  1RO4 A;  2V8J A;  2VUM I;  1QYP A;  2NVT I;  4S1T A;  4NBC A;  1VLA A;  3CCV Z;  2OTL 1;  1Q7Y 2;  1M1K 1;  4HGY A;  1LQL A;  3F3P C;  4A3M I;  1K8A 2;  3GTJ I;  1K73 1;  2E2I I;  1WZN A;  2NVX I;  3P5J B;  4BY1 I;  2QRE B;  3VMG A;  1VQL Z;  2E2J I;  2J6A A;  3CC4 Z;  2NAP A;  3GTM S;  1ML8 A;  2V8I A;  4X6A I;  3KIF A;  4A3F I;  2DE7 A;  3CXC Y;  2NVY I;  1ZB8 A;  1VQN Z;  2DE5 A;  3FKI I;  2GTI A;  1VQ5 1;  2RHB A;  4E32 A;  3S17 I;  2M48 A;  3CCQ 1;  1YJW 1;  1RQF A;  1TWC I;  3CPW Y;  3LUS A;  3J80 b;  2LFU A;  3MZL B;  4NBF A;  1VQK 1;  3J80 f;  3CC2 Z;  1FDI A;  1VQ7 Z;  2M6N A;  1Y1V S;  1KC8 1;  2JA8 I;  2JUB A;  3M4O I;  1YUA A;  3G6E Z;  1Q86 2;  1QXF A;  1TWF I;  2KI7 B;  3FQQ A;  2JIR A;  1AA6 A;  1YJ9 Z;  2QEX 1;  1M1K 2;  5IP7 I;  5CM2 M;  1VQ6 Z;  1YHQ 1;  3K7A I;  2R7Z I;  1NP6 A;  2RIQ A;  1S72 1;  1K73 2;  1QVF Z;  3S1M I;  3IR7 A;  2JS4 A;  5AN9 F;  3GKQ A;  4NH1 C;  3I55 1;  3D2L A;  1Q82 1;  2OTJ Z;  3IX0 A;  1FDO A;  3FQM A;  3BG1 B;  1YJN 1;  3TE5 B;  1JJ2 Z;  2V8K A;  2JA5 I;  4NB9 A;  2DE6 A;  2E9H A;  1K9M 1;  4DQY B;  3GTL I;  4BBR I;  1I50 I;  3G71 1;  2E2H I;  1M90 2;  1TWH I;  3PO3 I;  3HOX I;  1QF8 A;  3CCR Z;  3I4N I;  3S1R I;  5IP9 I;  3HOU I;  2R6M A;  1X0T A;  1VQP 1;  1N8R 1;  1VQ9 1;  3CCE 1;  3J81 b;  2OTL Z;  1YIJ 1;  1TWG I;  4A3G I;  3GTM I;  1KD1 2;  3CQZ I;  3I07 A;  1VQ8 1;  3J81 f;  4A3J I;  1JWH C;  3RZD I;  3G4S 1;  3VTN A;  1PFT A;  3CME 1;  3S15 I;  1ZB9 A;  4NFR A;  3CCU 1;  1Y1W I;  4BBS I;  5FLM I;  1Z01 A;  4NBB A;  2GU2 A;  3S1Q I;  2I3C A;  1L1O C;  3S1N I;  4HH4 A;  2JA6 I;  2Y0S A;  1RO2 A;  5D1O A;  4QTT A;  3NDI A;  3S16 I;  4AYB A;  1WII A;  1QVF Y;  1Y8C A;  4XX2 A;  3CCL 1;  1USP A;  5A2Q b;  2OZK A;  1YI2 Z;  2LEX A;  2Q4Z A;  2YAD A;  2F4O A;  1S7M A;  5A2Q f;  4NB8 A;  2LIY A;  3OW2 Y;  3CCM 1;  3F3F C;  1NJI 1;  1VQ5 Z;  3H0G I;  3CCQ Z;  1JJ2 Y;  4MRI A;  2QRD B;  2V45 A;  4RVH A;  2RT9 A;  3Q87 A;  3U50 C;  1K9M 2;  2JMO A;  3CCJ 1;  2W04 A;  4NBA A;  2R93 I;  3S2H I;  1VQK Z;  2JR6 A;  3CD6 1;  3I56 1;  4MD7 A;  4E30 A;  1N8R 2;  2F4M A;  4Y7N I;  1Z03 A;  1RLY A;  3D6W A;  2HU9 A;  3NH5 A;  5C4X I;  3ESW A;  1X3Z A;  3NH4 A;  2QEX Z;  4HGZ A;  4MH4 A;  2O4H A;  4RVD A;  2QA4 1;  2YU9 I;  2QKD A;  1WW9 A;  1VQO 1;  1YHQ Z;  2IV2 X;  1R9T I;  4E2Y A;  2VF1 A;  2VPZ A;  4MON A;  3CC7 1;  4A3B I;  1P9N A;  2PM9 A;  3I55 Z;  1VQM 1;  2IZ4 A;  1WCM I;  2QR1 B;  1YJN Z;  1K8A 1;  3OW2 Z;  3TDH B;  3VMH A;  3CMA 1;  5C44 I;  1NUI A;  4EWC A;  4CL1 A;  2VPW A;  3G71 Z;  2KPI A;  3EER A;  2E7Z A;  2GTH A;  3CCS 1;  4RVG A;  1NJI 2;  4BY7 I;  3GTP I;  1WJ2 A;  5C3E I;  3J7A 4;  4NOZ A;  4E2W A;  1VQP Z;  1VQ9 Z;  2VPY A;  5D1P A;  3CCE Z;  1Z02 A;  1YIJ Z;  3IF8 A;  4TNU A;  1YIT 1;  4A3C I;  2RPR A;  1VQ8 Z;  1VQ4 1;  1TWA I;  2QLV B;  3G4S Z;  1K83 I;  4E31 A;  4A3L I;  4A3K I;  1KC8 2;  3H3V J;  5FLX b;  3CME Z;  4NBE A;  2PK7 A;  4A3D I;  3VB9 A;  5FLX f;  3CCU Z;  4NBD A;  3NH8 A;  4E2X A;  5T64 A;  4QTU A;  4RVF A;  1TFI A;  2AKL A;  5IT9 b;  3D9X A;  3BG0 B;  2JA7 I;  2WB1 A;  2JIQ A;  3GTO I;  2WAQ A;  5IT9 f;  3S14 I;  1Q86 1;  2B63 I;  1QVG Y;  3CCL Z;  4NBH A;  3CCV 1;  2VPX A;  1ZH1 A;  3NDJ A;  4MD8 A;  3PO3 S;  1Y1V I;  2IZ3 A;  3CCM Z;  1Q82 2;  2OOX B;  3HOY I;  3MON A;  5D1O B;  1Q16 A;  3CCJ Z;  1YJW Z;  3NFZ A;  1USP B;  1VQL 1;  2AYD A;  1YUK A;  3CC4 1;  4E2Z A;  3CD6 Z;  3I56 Z;  1Q81 1;  1YI2 1;  1W2B Y;  1I6H I;  3IFU A;  4MD9 A;  4DK1 A;  1M90 1;  3T4N B;  1VQN 1;  3M3Y I;  3I4M I;  2H85 A;  2JIP A;  2QA4 Z;  3PO2 I;  4A93 I;  5T67 A;  1KQS Z;  1VQO Z;  2JNY A;  2ZAE B;  2K5R A;  3HOV I;  2G2K A;  2V3V A;  1SFO I;  3CC7 Z;  1S72 Z;  2OOY B;  1KD1 1;  4A3I I;  2JIM A;  1QVG Z;  3CC2 1;  2BJO A;  1VQ7 1;  1Q7Y 1;  1VQM Z;  3RZO I;  1I3Q I;  3MZK B;  2JIO A;  2K3R A;  3G6E 1;  2R92 I;  3S2D I;  3GTG I;  1YJ9 1;  3CMA Z;  1N2F A;  2P28 A;  3GTK I; 
#chains in the Genus database with same CATH homology
 1X3W A;  2Q51 A;  5T6B A;  3HOW I;  2QRC B;  3CCS Z;  1RNI A;  4A3E I;  1VQ6 1;  2EGT A;  4BXX I;  1KRL A;  2PMZ A;  5LL6 f;  2HF1 A;  3JAM b;  2VUG A;  3KIH A;  3GTQ I;  2W03 A;  2RBL A;  3JAM f;  3CXC Z;  1W2B Z;  3HKZ A;  4RV9 A;  4DGL A;  1YIT Z;  3GCF A;  2OTJ 1;  1VQ4 Z;  4NBG A;  1Q81 2;  3VMI A;  3HOZ I;  1DL6 A;  4E33 A;  2O53 A;  2NVQ I;  5C4J I;  3CPW Z;  4MXU A;  1RO0 A;  4Y52 I;  3QWU A;  4RS4 A;  2P3Y A;  3EED A;  3CCR 1;  1KQS Y;  1RO4 A;  2V8J A;  2VUM I;  1QYP A;  2NVT I;  4S1T A;  4NBC A;  1VLA A;  3CCV Z;  2OTL 1;  1Q7Y 2;  1M1K 1;  4HGY A;  1LQL A;  3F3P C;  4A3M I;  1K8A 2;  3GTJ I;  1K73 1;  2E2I I;  2NVX I;  3P5J B;  4BY1 I;  2QRE B;  3VMG A;  1VQL Z;  2E2J I;  2J6A A;  3CC4 Z;  3GTM S;  1ML8 A;  2V8I A;  4X6A I;  3KIF A;  4A3F I;  2DE7 A;  3CXC Y;  2NVY I;  1ZB8 A;  1VQN Z;  2DE5 A;  3FKI I;  2GTI A;  1VQ5 1;  2RHB A;  4E32 A;  3S17 I;  2M48 A;  3CCQ 1;  1YJW 1;  1RQF A;  1TWC I;  3CPW Y;  3LUS A;  3J80 b;  2LFU A;  3MZL B;  4NBF A;  1VQK 1;  3J80 f;  3CC2 Z;  1VQ7 Z;  2M6N A;  1Y1V S;  1KC8 1;  2JA8 I;  2JUB A;  3M4O I;  1YUA A;  3G6E Z;  1Q86 2;  2KI7 B;  1TWF I;  3FQQ A;  1YJ9 Z;  2QEX 1;  1M1K 2;  5IP7 I;  5CM2 M;  1VQ6 Z;  1YHQ 1;  3K7A I;  2R7Z I;  1NP6 A;  2RIQ A;  1S72 1;  1K73 2;  1QVF Z;  3S1M I;  2JS4 A;  5AN9 F;  3GKQ A;  4NH1 C;  3I55 1;  1Q82 1;  2OTJ Z;  3IX0 A;  3FQM A;  3BG1 B;  1YJN 1;  3TE5 B;  1JJ2 Z;  2V8K A;  2JA5 I;  4NB9 A;  2DE6 A;  2E9H A;  1K9M 1;  4DQY B;  3GTL I;  4BBR I;  1I50 I;  3G71 1;  2E2H I;  1M90 2;  1TWH I;  3PO3 I;  3HOX I;  1QF8 A;  3CCR Z;  3I4N I;  3S1R I;  5IP9 I;  3HOU I;  2R6M A;  1X0T A;  1VQP 1;  1N8R 1;  1VQ9 1;  3CCE 1;  3J81 b;  2OTL Z;  1YIJ 1;  1TWG I;  4A3G I;  3GTM I;  1KD1 2;  3CQZ I;  3I07 A;  1VQ8 1;  3J81 f;  4A3J I;  1JWH C;  3RZD I;  3G4S 1;  3VTN A;  1PFT A;  3CME 1;  3S15 I;  1ZB9 A;  4NFR A;  3CCU 1;  1Y1W I;  4BBS I;  5FLM I;  1Z01 A;  4NBB A;  2GU2 A;  3S1Q I;  2I3C A;  1L1O C;  3S1N I;  4HH4 A;  2JA6 I;  2Y0S A;  1RO2 A;  5D1O A;  4QTT A;  3NDI A;  3S16 I;  4AYB A;  1WII A;  1QVF Y;  4XX2 A;  3CCL 1;  1USP A;  5A2Q b;  2OZK A;  1YI2 Z;  2Q4Z A;  2YAD A;  2F4O A;  1S7M A;  5A2Q f;  4NB8 A;  2LIY A;  3OW2 Y;  3CCM 1;  3F3F C;  1NJI 1;  1VQ5 Z;  3H0G I;  3CCQ Z;  1JJ2 Y;  4MRI A;  2QRD B;  4RVH A;  2RT9 A;  3Q87 A;  3U50 C;  1K9M 2;  2JMO A;  3CCJ 1;  2W04 A;  4NBA A;  2R93 I;  3S2H I;  1VQK Z;  2JR6 A;  3CD6 1;  3I56 1;  4MD7 A;  4E30 A;  1N8R 2;  2F4M A;  4Y7N I;  1Z03 A;  1RLY A;  3D6W A;  2HU9 A;  3NH5 A;  5C4X I;  3ESW A;  1X3Z A;  3NH4 A;  2QEX Z;  4HGZ A;  4MH4 A;  2O4H A;  4RVD A;  2QA4 1;  2YU9 I;  2QKD A;  1WW9 A;  1VQO 1;  1YHQ Z;  1R9T I;  4E2Y A;  2VF1 A;  4MON A;  3CC7 1;  4A3B I;  1P9N A;  2PM9 A;  3I55 Z;  1VQM 1;  2IZ4 A;  1WCM I;  2QR1 B;  1YJN Z;  1K8A 1;  3OW2 Z;  3TDH B;  3VMH A;  3CMA 1;  5C44 I;  1NUI A;  4EWC A;  4CL1 A;  3G71 Z;  2KPI A;  3EER A;  2GTH A;  3CCS 1;  4RVG A;  1NJI 2;  4BY7 I;  3GTP I;  5C3E I;  3J7A 4;  4NOZ A;  4E2W A;  1VQP Z;  1VQ9 Z;  5D1P A;  3CCE Z;  1Z02 A;  1YIJ Z;  3IF8 A;  4TNU A;  1YIT 1;  4A3C I;  2RPR A;  1VQ8 Z;  1VQ4 1;  1TWA I;  2QLV B;  3G4S Z;  1K83 I;  4E31 A;  4A3L I;  4A3K I;  1KC8 2;  3H3V J;  5FLX b;  3CME Z;  4NBE A;  2PK7 A;  4A3D I;  3VB9 A;  5FLX f;  3CCU Z;  4NBD A;  3NH8 A;  4E2X A;  5T64 A;  4QTU A;  4RVF A;  1TFI A;  2AKL A;  5IT9 b;  3D9X A;  3BG0 B;  2JA7 I;  2WB1 A;  3GTO I;  2WAQ A;  5IT9 f;  3S14 I;  1Q86 1;  2B63 I;  1QVG Y;  3CCL Z;  4NBH A;  3CCV 1;  1ZH1 A;  3NDJ A;  4MD8 A;  3PO3 S;  1Y1V I;  2IZ3 A;  3CCM Z;  1Q82 2;  2OOX B;  3HOY I;  3MON A;  5D1O B;  3CCJ Z;  1YJW Z;  3NFZ A;  1USP B;  1VQL 1;  1YUK A;  3CC4 1;  4E2Z A;  3CD6 Z;  3I56 Z;  1Q81 1;  1YI2 1;  1W2B Y;  1I6H I;  3IFU A;  4MD9 A;  4DK1 A;  1M90 1;  3T4N B;  1VQN 1;  3M3Y I;  3I4M I;  2H85 A;  2QA4 Z;  3PO2 I;  4A93 I;  5T67 A;  1KQS Z;  1VQO Z;  2JNY A;  2ZAE B;  2K5R A;  3HOV I;  2G2K A;  1SFO I;  3CC7 Z;  1S72 Z;  2OOY B;  1KD1 1;  4A3I I;  1QVG Z;  3CC2 1;  2BJO A;  1VQ7 1;  1Q7Y 1;  1VQM Z;  3RZO I;  1I3Q I;  3MZK B;  2K3R A;  3G6E 1;  2R92 I;  3S2D I;  3GTG I;  1YJ9 1;  3CMA Z;  1N2F A;  2P28 A;  3GTK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...