1Q811

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81100
1N8R1 3OW2Z 1VQPZ 3CCEZ 1YI2Z 1YI21 1YJ9Z 3CCE1 1VQ7Z 1M901 3CXCY 1NJI2 1YHQ1 1K9M2 1VQKZ 3I55Z 1YHQZ 1VQO1 1VQOZ 1Q862 1JJ2Y 3CC2Z 1M1K2 1K731 1YJNZ 3CCR1 1YJW1 1KD11 2OTL1 2QEX1 1VQ5Z 3CMEZ 3CCSZ 1NJI1 1VQK1 1Q822 1K8A1 3CD6Z 1VQ8Z 1Q811 1QVGY 3OW2Y 3CXCZ 1Q812 2OTJ1 3CCUZ 1Q861 1KQSZ 1YITZ 1VQN1 1VQNZ 3CCRZ 1YJWZ 3CCJ1 3CCLZ 3CMAZ 1W2BZ 3CC41 1VQMZ 3CD61 1VQLZ 1QVFZ 3CCS1 3I551 1K9M1 1M1K1 3I56Z 3CCM1 3CC71 2OTLZ 1M902 1YJN1 1KD12 1VQ81 3CC21 2QA41 3CCMZ 3CC7Z 1S721 3CME1 3G4S1 1S72Z 1VQ4Z 1VQ6Z 2QEXZ 1VQ61 3CCVZ 3G6E1 1KC81 2QA4Z 1KQSY 1VQL1 1VQ71 1YJ91 1Q7Y2 3CMA1 1W2BY 1Q821 3CCV1 3CCQ1 3I561 1QVFY 1KC82 3CPWZ 2OTJZ 1VQ9Z 1VQM1 1VQP1 1YIT1 3CC4Z 3CCJZ 3CCL1 3CCU1 1YIJZ 1K8A2 3G711 1JJ2Z 1VQ51 1K732 3CCQZ 1Q7Y1 1N8R2 1VQ91 3G6EZ 3G71Z 3CPWY 3G4SZ 1VQ41 1YIJ1 1QVGZ
chains in the Genus database with same CATH superfamily
3HOWI 3I4NI 1TWAI 3CCE1 4E2ZA 4MXUA 2QLVB 1NJI2 1VQKZ 1YIJ1 1VQO1 2V45A 2E7ZA 2NAPA 1YJW1 4NB9A 2OTL1 1TFIA 3CCSZ 1NJI1 4QTUA 1Q822 3FQMA 3VMHA 3NFZA 5IP7I 1Q811 1JWHC 1QVGY 1S7MA 3S1NI 5D1OB 2M6NA 3GTJI 3GTMS 2YU9I 1VQN1 1VQMZ 2B63I 2JS4A 3HOZI 2NVXI 1QVFZ 3S2DI 2JUBA 5C3EI 2I3CA 3I551 3S17I 2PK7A 5T67A 3P5JB 4EWCA 4A3CI 3PO3S 2RIQA 3CC21 1S721 5C44I 1VQ4Z 1KC81 1KQSY 1VQ71 4MD7A 1WW9A 1Q7Y2 1W2BY 2J6AA 4RVHA 3IFUA 3CPWZ 3HOYI 4E30A 2JIRA 2OZKA 2V8IA 2JA8I 1VQP1 2KI7B 2LEXA 3CCL1 1K8A2 4BBSI 2IZ3A 2JMOA 4A3II 1PFTA 3I4MI 1Z03A 5IP9I 3NH8A 1N8R2 2QRDB 1YUKA 2W03A 1VQ41 2G2KA 3OW2Z 2DE5A 1X3ZA 2O53A 2QKDA 4RVGA 2RT9A 1YI21 1VQ7Z 4MD9A 3CXCY 1M901 3RZOI 1K9M2 4A3BI 4NBHA 3F3PC 1JJ2Y 4AYBA 1I3QI 4A93I 4RVFA 4S1TA 4MD8A 1AA6A 3CQZI 3BG0B 4RV9A 5IT9f 2E2JI 1VQK1 3M3YI 1K8A1 4XX2A 3CD6Z 2RBLA 4RVDA 3LUSA 2F4OA 2QREB 1ZH1A 2IV2X 2OTJ1 1SFOI 5IT9b 4NBGA 3JAMf 4NBEA 1Q861 2NVTI 3D6WA 4Y52I 3CCRZ 3CCJ1 3CC41 3CD61 3NH5A 3JAMb 1I6HI 3HOVI 5FLXb 1ZB8A 3HOUI 1K9M1 3I56Z 3S16I 4E31A 3FQQA 3CC71 1QYPA 2E9HA 2VPZA 3J81f 1L1OC 2PM9A 1VQ81 1VLAA 3CC7Z 1S72Z 2GU2A 1VQ6Z 2EGTA 2F4MA 3CCVZ 2OOYB 4HH4A 1LQLA 1YJ91 3CMA1 3D9XA 2YADA 2HU9A 1FDOA 2PMZA 5CM2M 3CCV1 1Q821 1TWHI 3I561 4A3EI 1QVFY 3GTQI 1NP6A 3TDHB 1VQ9Z 4DGLA 3PO2I 3S1MI 2E2II 1YIT1 5D1PA 1RQFA 1USPA 3IX0A 3G711 1TWCI 1K732 2P3YA 2JIMA 4NFRA 4NB8A 2R6MA 1WZNA 1VQ91 2DE7A 1WCMI 3G6EZ 2E2HI 3CPWY 1ML8A 2WB1A 1Q16A 3BG1B 1N8R1 2JA7I 1ZB9A 3J80f 2DE6A 1YI2Z 1YJ9Z 4A3KI 1YHQ1 1DL6A 3I55Z 2VPYA 1Q862 2VPXA 5C4XI 1YJNZ 2JA6I 2QEX1 2RPRA 3GTOI 1VQ5Z 1RNIA 1RO4A 4MRIA 2V8JA 1VQ8Z 5T6BA 2M48A 3K7AI 4A3JI 3OW2Y 1Y1WI 2OOXB 1WIIA 3F3FC 3CXCZ 4HGZA 3TE5B 3CCUZ 4MH4A 3EEDA 4BXXI 1YJWZ 3CCLZ 3S2HI 1VQLZ 1X0TA 3MZLB 3IR7A 3CCS1 2JIOA 1QXFA 3IF8A 2IZ4A 4NBCA 1M902 1YJN1 2W04A 3KIFA 4BBRI 4A3LI 1Y1VI 4E32A 2O4HA 1FDIA 2V3VA 1VQ61 2QEXZ 1Y8CA 1YUAA 4CL1A 3G6E1 1NUIA 2JR6A 1VQL1 2JA5I 2JIQA 4NBFA 3FKII 2KPIA 3QWUA 3MONA 2K3RA 4RS4A 3S14I 2ZAEB 2Y0SA 4Y7NI 1Y1VS 3MZKB 4MONA 3J80b 3H0GI 3H3VJ 3D2LA 3GTPI 1SIWA 3U50C 2H85A 1RLYA 1X3WA 3VB9A 1VQ51 1Q7Y1 2JNYA 5A2Qb 2GTHA 3Q87A 3G71Z 5C4JI 3S15I 3PO3I 1QVGZ 1TWFI 3CCEZ 1VQPZ 2R7ZI 5AN9F 2LFUA 3ESWA 3GCFA 3VMGA 5FLXf 1QF8A 1YHQZ 3S1RI 1VQOZ 3GKQA 3GTLI 3NDJA 3VTNA 3CC2Z 1M1K2 2AYDA 1K731 3GTKI 2VPWA 2QR1B 3CCR1 3RZDI 1KD11 3CMEZ 4A3GI 2Q4ZA 2JIPA 4HGYA 1P9NA 5LL6f 2V8KA 3S1QI 2LIYA 2RHBA 2K5RA 4E2XA 1Q812 5T64A 1RO0A 3NH4A 4NBDA 4X6AI 4DQYB 4NBBA 1USPB 1KQSZ 1YITZ 5D1OA 1VQNZ 3CMAZ 1W2BZ 2NVYI 1WJ2A 2VUMI 2R93I 1KRLA 1M1K1 1TWGI 3NDIA 3CCM1 2OTLZ 3I07A 2Q51A 4TNUA 3M4OI 1KD12 2QA41 3CCMZ 4A3FI 2VF1A 3CME1 3G4S1 5FLMI 2GTIA 2WAQA 3HKZA 4E33A 4NH1C 5A2Qf 2QA4Z 4A3DI 2VUGA 2AKLA 4BY1I 3GTMI 4NOZA 4E2WA 3CCQ1 1KC82 4NBAA 1I50I 2OTJZ 1VQM1 4DK1A 3J81b 3VMIA 3CC4Z 1Z02A 3CCJZ 1YIJZ 2P28A 3CCU1 4BY7I 3EERA 3T4NB 2HF1A 4QTTA 3GTGI 1RO2A 1JJ2Z 2BJOA 3J7A4 3KIHA 1N2FA 3CCQZ 1K83I 3HOXI 1R9TI 1Z01A 2NVQI 4E2YA 2QRCB 3G4SZ 4A3MI 2R92I
chains in the Genus database with same CATH topology
3HOWI 3I4NI 1TWAI 3CCE1 4E2ZA 4MXUA 2QLVB 1NJI2 1VQKZ 1YIJ1 1VQO1 1YJW1 4NB9A 2OTL1 1TFIA 3CCSZ 1NJI1 4QTUA 1Q822 3FQMA 3VMHA 3NFZA 5IP7I 1Q811 1JWHC 1QVGY 1S7MA 3S1NI 5D1OB 2M6NA 3GTJI 3GTMS 2YU9I 1VQN1 1VQMZ 2B63I 2JS4A 3HOZI 2NVXI 1QVFZ 3S2DI 2JUBA 5C3EI 2I3CA 3I551 3S17I 2PK7A 5T67A 3P5JB 4EWCA 4A3CI 3PO3S 2RIQA 3CC21 1S721 5C44I 1VQ4Z 1KC81 1KQSY 1VQ71 4MD7A 1WW9A 1Q7Y2 1W2BY 2J6AA 4RVHA 3IFUA 3CPWZ 3HOYI 4E30A 2OZKA 2V8IA 2JA8I 1VQP1 2KI7B 3CCL1 1K8A2 4BBSI 2IZ3A 2JMOA 4A3II 1PFTA 3I4MI 1Z03A 5IP9I 3NH8A 1N8R2 2QRDB 1YUKA 2W03A 1VQ41 2G2KA 3OW2Z 2DE5A 2O53A 1X3ZA 2QKDA 4RVGA 2RT9A 1YI21 1VQ7Z 4MD9A 3CXCY 1M901 3RZOI 1K9M2 4A3BI 4NBHA 3F3PC 1JJ2Y 4AYBA 1I3QI 4A93I 4RVFA 4S1TA 4MD8A 3CQZI 3BG0B 4RV9A 5IT9f 2E2JI 1VQK1 3M3YI 1K8A1 4XX2A 3CD6Z 2RBLA 4RVDA 3LUSA 2F4OA 2QREB 1ZH1A 2OTJ1 1SFOI 5IT9b 4NBGA 3JAMf 4NBEA 1Q861 2NVTI 3D6WA 4Y52I 3CCRZ 3CCJ1 3CC41 3CD61 3NH5A 3JAMb 1I6HI 3HOVI 5FLXb 1ZB8A 3HOUI 1K9M1 3I56Z 3S16I 4E31A 3FQQA 3CC71 1QYPA 2E9HA 3J81f 1L1OC 2PM9A 1VQ81 1VLAA 3CC7Z 1S72Z 2GU2A 1VQ6Z 2EGTA 2F4MA 3CCVZ 2OOYB 4HH4A 1LQLA 1YJ91 3CMA1 3D9XA 2YADA 2HU9A 2PMZA 5CM2M 1Q821 3CCV1 1TWHI 3I561 4A3EI 1QVFY 3GTQI 1NP6A 3TDHB 1VQ9Z 4DGLA 3PO2I 3S1MI 2E2II 1YIT1 5D1PA 1RQFA 1USPA 3IX0A 3G711 1TWCI 1K732 2P3YA 4NFRA 4NB8A 2R6MA 1VQ91 2DE7A 1WCMI 3G6EZ 2E2HI 3CPWY 1ML8A 2WB1A 3BG1B 1N8R1 2JA7I 1ZB9A 3J80f 2DE6A 1YI2Z 1YJ9Z 4A3KI 1YHQ1 1DL6A 3I55Z 1Q862 5C4XI 1YJNZ 2JA6I 2QEX1 2RPRA 3GTOI 1VQ5Z 1RNIA 1RO4A 4MRIA 2V8JA 1VQ8Z 5T6BA 2M48A 3K7AI 4A3JI 3OW2Y 1Y1WI 2OOXB 1WIIA 3F3FC 3CXCZ 4HGZA 3TE5B 3CCUZ 4MH4A 3EEDA 4BXXI 1YJWZ 3CCLZ 3S2HI 1VQLZ 1X0TA 3MZLB 3CCS1 3IF8A 2IZ4A 4NBCA 1M902 1YJN1 2W04A 3KIFA 4BBRI 4A3LI 1Y1VI 4E32A 2O4HA 1VQ61 2QEXZ 1YUAA 4CL1A 3G6E1 1NUIA 2JR6A 1VQL1 2JA5I 4NBFA 3FKII 2KPIA 3QWUA 3MONA 2K3RA 4RS4A 3S14I 2ZAEB 2Y0SA 4Y7NI 1Y1VS 3MZKB 4MONA 3J80b 3H0GI 3H3VJ 3GTPI 3U50C 2H85A 1RLYA 1X3WA 3VB9A 1VQ51 1Q7Y1 2JNYA 5A2Qb 2GTHA 3Q87A 3G71Z 5C4JI 3S15I 3PO3I 1QVGZ 1TWFI 3CCEZ 1VQPZ 2R7ZI 5AN9F 2LFUA 3ESWA 3GCFA 3VMGA 5FLXf 1QF8A 1YHQZ 3S1RI 1VQOZ 3GKQA 3GTLI 3NDJA 3VTNA 3CC2Z 1M1K2 1K731 3GTKI 2QR1B 3CCR1 3RZDI 1KD11 3CMEZ 4A3GI 2Q4ZA 4HGYA 1P9NA 5LL6f 2V8KA 3S1QI 2LIYA 2RHBA 2K5RA 4E2XA 1Q812 5T64A 1RO0A 3NH4A 4NBDA 4X6AI 4DQYB 4NBBA 1USPB 1KQSZ 1YITZ 5D1OA 1VQNZ 3CMAZ 1W2BZ 2NVYI 2VUMI 2R93I 1KRLA 1M1K1 1TWGI 3NDIA 3CCM1 2OTLZ 3I07A 2Q51A 4TNUA 3M4OI 1KD12 2QA41 3CCMZ 4A3FI 2VF1A 3CME1 3G4S1 5FLMI 2GTIA 2WAQA 3HKZA 4E33A 4NH1C 5A2Qf 2QA4Z 4A3DI 2VUGA 2AKLA 4BY1I 3GTMI 4NOZA 4E2WA 3CCQ1 1KC82 4NBAA 1I50I 2OTJZ 1VQM1 4DK1A 3J81b 3VMIA 3CC4Z 1Z02A 3CCJZ 1YIJZ 2P28A 3CCU1 4BY7I 3EERA 3T4NB 2HF1A 4QTTA 3GTGI 1RO2A 1JJ2Z 2BJOA 3J7A4 3KIHA 1N2FA 3CCQZ 1K83I 3HOXI 1R9TI 1Z01A 2NVQI 4E2YA 2QRCB 3G4SZ 4A3MI 2R92I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 1;  3OW2 Z;  1VQP Z;  3CCE Z;  1YI2 Z;  1YI2 1;  1YJ9 Z;  3CCE 1;  1VQ7 Z;  1M90 1;  3CXC Y;  1NJI 2;  1YHQ 1;  1K9M 2;  1VQK Z;  3I55 Z;  1YHQ Z;  1VQO 1;  1VQO Z;  1Q86 2;  1JJ2 Y;  3CC2 Z;  1M1K 2;  1K73 1;  1YJN Z;  3CCR 1;  1YJW 1;  1KD1 1;  2OTL 1;  2QEX 1;  1VQ5 Z;  3CME Z;  3CCS Z;  1NJI 1;  1VQK 1;  1Q82 2;  1K8A 1;  3CD6 Z;  1VQ8 Z;  1Q81 1;  1QVG Y;  3OW2 Y;  3CXC Z;  1Q81 2;  2OTJ 1;  3CCU Z;  1Q86 1;  1KQS Z;  1YIT Z;  1VQN 1;  1VQN Z;  3CCR Z;  1YJW Z;  3CCJ 1;  3CCL Z;  3CMA Z;  1W2B Z;  3CC4 1;  1VQM Z;  3CD6 1;  1VQL Z;  1QVF Z;  3CCS 1;  3I55 1;  1K9M 1;  1M1K 1;  3I56 Z;  3CCM 1;  3CC7 1;  2OTL Z;  1M90 2;  1YJN 1;  1KD1 2;  1VQ8 1;  3CC2 1;  2QA4 1;  3CCM Z;  3CC7 Z;  1S72 1;  3CME 1;  3G4S 1;  1S72 Z;  1VQ4 Z;  1VQ6 Z;  2QEX Z;  1VQ6 1;  3CCV Z;  3G6E 1;  1KC8 1;  2QA4 Z;  1KQS Y;  1VQL 1;  1VQ7 1;  1YJ9 1;  1Q7Y 2;  3CMA 1;  1W2B Y;  1Q82 1;  3CCV 1;  3CCQ 1;  3I56 1;  1QVF Y;  1KC8 2;  3CPW Z;  2OTJ Z;  1VQ9 Z;  1VQM 1;  1VQP 1;  1YIT 1;  3CC4 Z;  3CCJ Z;  3CCL 1;  3CCU 1;  1YIJ Z;  1K8A 2;  3G71 1;  1JJ2 Z;  1VQ5 1;  1K73 2;  3CCQ Z;  1Q7Y 1;  1N8R 2;  1VQ9 1;  3G6E Z;  3G71 Z;  3CPW Y;  3G4S Z;  1VQ4 1;  1YIJ 1;  1QVG Z; 
#chains in the Genus database with same CATH topology
 3HOW I;  3I4N I;  1TWA I;  3CCE 1;  4E2Z A;  4MXU A;  2QLV B;  1NJI 2;  1VQK Z;  1YIJ 1;  1VQO 1;  2V45 A;  2E7Z A;  2NAP A;  1YJW 1;  4NB9 A;  2OTL 1;  1TFI A;  3CCS Z;  1NJI 1;  4QTU A;  1Q82 2;  3FQM A;  3VMH A;  3NFZ A;  5IP7 I;  1Q81 1;  1JWH C;  1QVG Y;  1S7M A;  3S1N I;  5D1O B;  2M6N A;  3GTJ I;  3GTM S;  2YU9 I;  1VQN 1;  1VQM Z;  2B63 I;  2JS4 A;  3HOZ I;  2NVX I;  1QVF Z;  3S2D I;  2JUB A;  5C3E I;  2I3C A;  3I55 1;  3S17 I;  2PK7 A;  5T67 A;  3P5J B;  4EWC A;  4A3C I;  3PO3 S;  2RIQ A;  3CC2 1;  1S72 1;  5C44 I;  1VQ4 Z;  1KC8 1;  1KQS Y;  1VQ7 1;  4MD7 A;  1WW9 A;  1Q7Y 2;  1W2B Y;  2J6A A;  4RVH A;  3IFU A;  3CPW Z;  3HOY I;  4E30 A;  2JIR A;  2OZK A;  2V8I A;  2JA8 I;  1VQP 1;  2KI7 B;  2LEX A;  3CCL 1;  1K8A 2;  4BBS I;  2IZ3 A;  2JMO A;  4A3I I;  1PFT A;  3I4M I;  1Z03 A;  5IP9 I;  3NH8 A;  1N8R 2;  2QRD B;  1YUK A;  2W03 A;  1VQ4 1;  2G2K A;  3OW2 Z;  2DE5 A;  1X3Z A;  2O53 A;  2QKD A;  4RVG A;  2RT9 A;  1YI2 1;  1VQ7 Z;  4MD9 A;  3CXC Y;  1M90 1;  3RZO I;  1K9M 2;  4A3B I;  4NBH A;  3F3P C;  1JJ2 Y;  4AYB A;  1I3Q I;  4A93 I;  4RVF A;  4S1T A;  4MD8 A;  1AA6 A;  3CQZ I;  3BG0 B;  4RV9 A;  5IT9 f;  2E2J I;  1VQK 1;  3M3Y I;  1K8A 1;  4XX2 A;  3CD6 Z;  2RBL A;  4RVD A;  3LUS A;  2F4O A;  2QRE B;  1ZH1 A;  2IV2 X;  2OTJ 1;  1SFO I;  5IT9 b;  4NBG A;  3JAM f;  4NBE A;  1Q86 1;  2NVT I;  3D6W A;  4Y52 I;  3CCR Z;  3CCJ 1;  3CC4 1;  3CD6 1;  3NH5 A;  3JAM b;  1I6H I;  3HOV I;  5FLX b;  1ZB8 A;  3HOU I;  1K9M 1;  3I56 Z;  3S16 I;  4E31 A;  3FQQ A;  3CC7 1;  1QYP A;  2E9H A;  2VPZ A;  3J81 f;  1L1O C;  2PM9 A;  1VQ8 1;  1VLA A;  3CC7 Z;  1S72 Z;  2GU2 A;  1VQ6 Z;  2EGT A;  2F4M A;  3CCV Z;  2OOY B;  4HH4 A;  1LQL A;  1YJ9 1;  3CMA 1;  3D9X A;  2YAD A;  2HU9 A;  1FDO A;  2PMZ A;  5CM2 M;  3CCV 1;  1Q82 1;  1TWH I;  3I56 1;  4A3E I;  1QVF Y;  3GTQ I;  1NP6 A;  3TDH B;  1VQ9 Z;  4DGL A;  3PO2 I;  3S1M I;  2E2I I;  1YIT 1;  5D1P A;  1RQF A;  1USP A;  3IX0 A;  3G71 1;  1TWC I;  1K73 2;  2P3Y A;  2JIM A;  4NFR A;  4NB8 A;  2R6M A;  1WZN A;  1VQ9 1;  2DE7 A;  1WCM I;  3G6E Z;  2E2H I;  3CPW Y;  1ML8 A;  2WB1 A;  1Q16 A;  3BG1 B;  1N8R 1;  2JA7 I;  1ZB9 A;  3J80 f;  2DE6 A;  1YI2 Z;  1YJ9 Z;  4A3K I;  1YHQ 1;  1DL6 A;  3I55 Z;  2VPY A;  1Q86 2;  2VPX A;  5C4X I;  1YJN Z;  2JA6 I;  2QEX 1;  2RPR A;  3GTO I;  1VQ5 Z;  1RNI A;  1RO4 A;  4MRI A;  2V8J A;  1VQ8 Z;  5T6B A;  2M48 A;  3K7A I;  4A3J I;  3OW2 Y;  1Y1W I;  2OOX B;  1WII A;  3F3F C;  3CXC Z;  4HGZ A;  3TE5 B;  3CCU Z;  4MH4 A;  3EED A;  4BXX I;  1YJW Z;  3CCL Z;  3S2H I;  1VQL Z;  1X0T A;  3MZL B;  3IR7 A;  3CCS 1;  2JIO A;  1QXF A;  3IF8 A;  2IZ4 A;  4NBC A;  1M90 2;  1YJN 1;  2W04 A;  3KIF A;  4BBR I;  4A3L I;  1Y1V I;  4E32 A;  2O4H A;  1FDI A;  2V3V A;  1VQ6 1;  2QEX Z;  1Y8C A;  1YUA A;  4CL1 A;  3G6E 1;  1NUI A;  2JR6 A;  1VQL 1;  2JA5 I;  2JIQ A;  4NBF A;  3FKI I;  2KPI A;  3QWU A;  3MON A;  2K3R A;  4RS4 A;  3S14 I;  2ZAE B;  2Y0S A;  4Y7N I;  1Y1V S;  3MZK B;  4MON A;  3J80 b;  3H0G I;  3H3V J;  3D2L A;  3GTP I;  1SIW A;  3U50 C;  2H85 A;  1RLY A;  1X3W A;  3VB9 A;  1VQ5 1;  1Q7Y 1;  2JNY A;  5A2Q b;  2GTH A;  3Q87 A;  3G71 Z;  5C4J I;  3S15 I;  3PO3 I;  1QVG Z;  1TWF I;  3CCE Z;  1VQP Z;  2R7Z I;  5AN9 F;  2LFU A;  3ESW A;  3GCF A;  3VMG A;  5FLX f;  1QF8 A;  1YHQ Z;  3S1R I;  1VQO Z;  3GKQ A;  3GTL I;  3NDJ A;  3VTN A;  3CC2 Z;  1M1K 2;  2AYD A;  1K73 1;  3GTK I;  2VPW A;  2QR1 B;  3CCR 1;  3RZD I;  1KD1 1;  3CME Z;  4A3G I;  2Q4Z A;  2JIP A;  4HGY A;  1P9N A;  5LL6 f;  2V8K A;  3S1Q I;  2LIY A;  2RHB A;  2K5R A;  4E2X A;  1Q81 2;  5T64 A;  1RO0 A;  3NH4 A;  4NBD A;  4X6A I;  4DQY B;  4NBB A;  1USP B;  1KQS Z;  1YIT Z;  5D1O A;  1VQN Z;  3CMA Z;  1W2B Z;  2NVY I;  1WJ2 A;  2VUM I;  2R93 I;  1KRL A;  1M1K 1;  1TWG I;  3NDI A;  3CCM 1;  2OTL Z;  3I07 A;  2Q51 A;  4TNU A;  3M4O I;  1KD1 2;  2QA4 1;  3CCM Z;  4A3F I;  2VF1 A;  3CME 1;  3G4S 1;  5FLM I;  2GTI A;  2WAQ A;  3HKZ A;  4E33 A;  4NH1 C;  5A2Q f;  2QA4 Z;  4A3D I;  2VUG A;  2AKL A;  4BY1 I;  3GTM I;  4NOZ A;  4E2W A;  3CCQ 1;  1KC8 2;  4NBA A;  1I50 I;  2OTJ Z;  1VQM 1;  4DK1 A;  3J81 b;  3VMI A;  3CC4 Z;  1Z02 A;  3CCJ Z;  1YIJ Z;  2P28 A;  3CCU 1;  4BY7 I;  3EER A;  3T4N B;  2HF1 A;  4QTT A;  3GTG I;  1RO2 A;  1JJ2 Z;  2BJO A;  3J7A 4;  3KIH A;  1N2F A;  3CCQ Z;  1K83 I;  3HOX I;  1R9T I;  1Z01 A;  2NVQ I;  4E2Y A;  2QRC B;  3G4S Z;  4A3M I;  2R92 I; 
#chains in the Genus database with same CATH homology
 3HOW I;  3I4N I;  1TWA I;  3CCE 1;  4E2Z A;  4MXU A;  2QLV B;  1NJI 2;  1VQK Z;  1YIJ 1;  1VQO 1;  1YJW 1;  4NB9 A;  2OTL 1;  1TFI A;  3CCS Z;  1NJI 1;  4QTU A;  1Q82 2;  3FQM A;  3VMH A;  3NFZ A;  5IP7 I;  1Q81 1;  1JWH C;  1QVG Y;  1S7M A;  3S1N I;  5D1O B;  2M6N A;  3GTJ I;  3GTM S;  2YU9 I;  1VQN 1;  1VQM Z;  2B63 I;  2JS4 A;  3HOZ I;  2NVX I;  1QVF Z;  3S2D I;  2JUB A;  5C3E I;  2I3C A;  3I55 1;  3S17 I;  2PK7 A;  5T67 A;  3P5J B;  4EWC A;  4A3C I;  3PO3 S;  2RIQ A;  3CC2 1;  1S72 1;  5C44 I;  1VQ4 Z;  1KC8 1;  1KQS Y;  1VQ7 1;  4MD7 A;  1WW9 A;  1Q7Y 2;  1W2B Y;  2J6A A;  4RVH A;  3IFU A;  3CPW Z;  3HOY I;  4E30 A;  2OZK A;  2V8I A;  2JA8 I;  1VQP 1;  2KI7 B;  3CCL 1;  1K8A 2;  4BBS I;  2IZ3 A;  2JMO A;  4A3I I;  1PFT A;  3I4M I;  1Z03 A;  5IP9 I;  3NH8 A;  1N8R 2;  2QRD B;  1YUK A;  2W03 A;  1VQ4 1;  2G2K A;  3OW2 Z;  2DE5 A;  2O53 A;  1X3Z A;  2QKD A;  4RVG A;  2RT9 A;  1YI2 1;  1VQ7 Z;  4MD9 A;  3CXC Y;  1M90 1;  3RZO I;  1K9M 2;  4A3B I;  4NBH A;  3F3P C;  1JJ2 Y;  4AYB A;  1I3Q I;  4A93 I;  4RVF A;  4S1T A;  4MD8 A;  3CQZ I;  3BG0 B;  4RV9 A;  5IT9 f;  2E2J I;  1VQK 1;  3M3Y I;  1K8A 1;  4XX2 A;  3CD6 Z;  2RBL A;  4RVD A;  3LUS A;  2F4O A;  2QRE B;  1ZH1 A;  2OTJ 1;  1SFO I;  5IT9 b;  4NBG A;  3JAM f;  4NBE A;  1Q86 1;  2NVT I;  3D6W A;  4Y52 I;  3CCR Z;  3CCJ 1;  3CC4 1;  3CD6 1;  3NH5 A;  3JAM b;  1I6H I;  3HOV I;  5FLX b;  1ZB8 A;  3HOU I;  1K9M 1;  3I56 Z;  3S16 I;  4E31 A;  3FQQ A;  3CC7 1;  1QYP A;  2E9H A;  3J81 f;  1L1O C;  2PM9 A;  1VQ8 1;  1VLA A;  3CC7 Z;  1S72 Z;  2GU2 A;  1VQ6 Z;  2EGT A;  2F4M A;  3CCV Z;  2OOY B;  4HH4 A;  1LQL A;  1YJ9 1;  3CMA 1;  3D9X A;  2YAD A;  2HU9 A;  2PMZ A;  5CM2 M;  1Q82 1;  3CCV 1;  1TWH I;  3I56 1;  4A3E I;  1QVF Y;  3GTQ I;  1NP6 A;  3TDH B;  1VQ9 Z;  4DGL A;  3PO2 I;  3S1M I;  2E2I I;  1YIT 1;  5D1P A;  1RQF A;  1USP A;  3IX0 A;  3G71 1;  1TWC I;  1K73 2;  2P3Y A;  4NFR A;  4NB8 A;  2R6M A;  1VQ9 1;  2DE7 A;  1WCM I;  3G6E Z;  2E2H I;  3CPW Y;  1ML8 A;  2WB1 A;  3BG1 B;  1N8R 1;  2JA7 I;  1ZB9 A;  3J80 f;  2DE6 A;  1YI2 Z;  1YJ9 Z;  4A3K I;  1YHQ 1;  1DL6 A;  3I55 Z;  1Q86 2;  5C4X I;  1YJN Z;  2JA6 I;  2QEX 1;  2RPR A;  3GTO I;  1VQ5 Z;  1RNI A;  1RO4 A;  4MRI A;  2V8J A;  1VQ8 Z;  5T6B A;  2M48 A;  3K7A I;  4A3J I;  3OW2 Y;  1Y1W I;  2OOX B;  1WII A;  3F3F C;  3CXC Z;  4HGZ A;  3TE5 B;  3CCU Z;  4MH4 A;  3EED A;  4BXX I;  1YJW Z;  3CCL Z;  3S2H I;  1VQL Z;  1X0T A;  3MZL B;  3CCS 1;  3IF8 A;  2IZ4 A;  4NBC A;  1M90 2;  1YJN 1;  2W04 A;  3KIF A;  4BBR I;  4A3L I;  1Y1V I;  4E32 A;  2O4H A;  1VQ6 1;  2QEX Z;  1YUA A;  4CL1 A;  3G6E 1;  1NUI A;  2JR6 A;  1VQL 1;  2JA5 I;  4NBF A;  3FKI I;  2KPI A;  3QWU A;  3MON A;  2K3R A;  4RS4 A;  3S14 I;  2ZAE B;  2Y0S A;  4Y7N I;  1Y1V S;  3MZK B;  4MON A;  3J80 b;  3H0G I;  3H3V J;  3GTP I;  3U50 C;  2H85 A;  1RLY A;  1X3W A;  3VB9 A;  1VQ5 1;  1Q7Y 1;  2JNY A;  5A2Q b;  2GTH A;  3Q87 A;  3G71 Z;  5C4J I;  3S15 I;  3PO3 I;  1QVG Z;  1TWF I;  3CCE Z;  1VQP Z;  2R7Z I;  5AN9 F;  2LFU A;  3ESW A;  3GCF A;  3VMG A;  5FLX f;  1QF8 A;  1YHQ Z;  3S1R I;  1VQO Z;  3GKQ A;  3GTL I;  3NDJ A;  3VTN A;  3CC2 Z;  1M1K 2;  1K73 1;  3GTK I;  2QR1 B;  3CCR 1;  3RZD I;  1KD1 1;  3CME Z;  4A3G I;  2Q4Z A;  4HGY A;  1P9N A;  5LL6 f;  2V8K A;  3S1Q I;  2LIY A;  2RHB A;  2K5R A;  4E2X A;  1Q81 2;  5T64 A;  1RO0 A;  3NH4 A;  4NBD A;  4X6A I;  4DQY B;  4NBB A;  1USP B;  1KQS Z;  1YIT Z;  5D1O A;  1VQN Z;  3CMA Z;  1W2B Z;  2NVY I;  2VUM I;  2R93 I;  1KRL A;  1M1K 1;  1TWG I;  3NDI A;  3CCM 1;  2OTL Z;  3I07 A;  2Q51 A;  4TNU A;  3M4O I;  1KD1 2;  2QA4 1;  3CCM Z;  4A3F I;  2VF1 A;  3CME 1;  3G4S 1;  5FLM I;  2GTI A;  2WAQ A;  3HKZ A;  4E33 A;  4NH1 C;  5A2Q f;  2QA4 Z;  4A3D I;  2VUG A;  2AKL A;  4BY1 I;  3GTM I;  4NOZ A;  4E2W A;  3CCQ 1;  1KC8 2;  4NBA A;  1I50 I;  2OTJ Z;  1VQM 1;  4DK1 A;  3J81 b;  3VMI A;  3CC4 Z;  1Z02 A;  3CCJ Z;  1YIJ Z;  2P28 A;  3CCU 1;  4BY7 I;  3EER A;  3T4N B;  2HF1 A;  4QTT A;  3GTG I;  1RO2 A;  1JJ2 Z;  2BJO A;  3J7A 4;  3KIH A;  1N2F A;  3CCQ Z;  1K83 I;  3HOX I;  1R9T I;  1Z01 A;  2NVQ I;  4E2Y A;  2QRC B;  3G4S Z;  4A3M I;  2R92 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...