1YI21

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2100
3CCSZ 2QA4Z 3CCLZ 3I56Z 1VQ6Z 1S721 1VQ5Z 3CC21 1YJW1 1KQSY 3CD6Z 2QA41 3CCL1 3I561 1Q7Y1 1VQ61 1KC82 3G6EZ 1YJ91 2OTLZ 1VQ51 1N8R2 1VQPZ 1VQ7Z 1K731 1KD11 1YHQZ 2OTJZ 3G6E1 1NJI1 3CCE1 1VQLZ 1S72Z 1VQ71 1K9M1 1VQO1 1Q811 3CMA1 1YJNZ 1YHQ1 3CPWZ 1QVGZ 1VQL1 1YJ9Z 1YJN1 3CME1 3CCM1 3CXCZ 1JJ2Z 3CCEZ 1M1K1 3G71Z 1M902 1VQOZ 1Q821 3CMAZ 3CCJ1 1YIJZ 1YITZ 3G711 2QEXZ 1QVFY 3CMEZ 3CCMZ 1VQM1 1Q861 1W2BY 1YIJ1 1YIT1 3CCRZ 1K8A1 1K732 3OW2Z 1KD12 2QEX1 3I55Z 1VQ4Z 3G4SZ 1QVGY 3CCJZ 3CC4Z 3CCR1 1K9M2 3I551 1VQ41 3G4S1 3CXCY 1KC81 3CCQZ 1JJ2Y 1VQKZ 1N8R1 1VQ9Z 1VQNZ 3CC41 1M901 1VQMZ 3CCUZ 3CC71 1KQSZ 1YI2Z 1Q7Y2 3CCQ1 1VQ81 1VQK1 1M1K2 1VQ91 1VQN1 3CCU1 3CCS1 3CCVZ 1Q822 1YI21 3CPWY 1NJI2 3CD61 3CCV1 3OW2Y 1Q812 1QVFZ 3CC7Z 2OTL1 1VQP1 1W2BZ 1Q862 1VQ8Z 3CC2Z 1K8A2 1YJWZ 2OTJ1
chains in the Genus database with same CATH superfamily
3CCSZ 1Z01A 4A3BI 1VQ6Z 1K83I 1S721 1QF8A 1P9NA 3TE5B 1Q7Y1 1VQ61 5CM2M 1YJ91 1VQPZ 2IZ4A 1VQ7Z 4NBBA 4A3CI 1TWAI 3NFZA 3IR7A 1YHQZ 1TWHI 3CCE1 1NJI1 4Y52I 3GTMI 1VQ71 5C4XI 1VQO1 2E9HA 1YJNZ 3VMHA 1YHQ1 3FQMA 5FLMI 2H85A 4E31A 2NVXI 1YJN1 3TDHB 3CME1 1I50I 4MRIA 4NBEA 4NOZA 3I07A 2KPIA 3EERA 4E30A 4A3EI 1M902 2O4HA 3GKQA 3I4NI 2JMOA 3NH8A 1I6HI 2IV2X 3MONA 3VB9A 2P3YA 3MZKB 3CCRZ 1QYPA 1ZB8A 3G4SZ 4DQYB 4MONA 3CCJZ 2JNYA 4RVGA 3CCR1 1RNIA 3QWUA 3G4S1 4MXUA 3CXCY 1WZNA 1KC81 1VQKZ 2JUBA 5C3EI 1VQ9Z 5AN9F 3CCUZ 4MH4A 4AYBA 2RIQA 1R9TI 2E2HI 3VTNA 1YI2Z 4E2YA 1VQK1 4E33A 1VQ81 1VQ91 3S2DI 3S2HI 4MD9A 3CCU1 1TFIA 1YI21 2VF1A 2QRCB 2DE6A 1VLAA 1USPA 3KIFA 3NDJA 4NBHA 1DL6A 3OW2Y 4BXXI 1QVFZ 5IT9f 4A3GI 2R7ZI 3GTOI 2OTJ1 1Y1VI 3J80b 3D9XA 3RZOI 2HU9A 2JIMA 4NH1C 1KC82 1PFTA 2OTLZ 1RO4A 3GTJI 1NP6A 3F3FC 3M3YI 1N2FA 2QLVB 4HGYA 2R93I 3GTMS 1S72Z 2Y0SA 1Q811 2M6NA 3CPWZ 2VUGA 2RPRA 5D1OA 1YJ9Z 4BY7I 2DE5A 1RO2A 3CCM1 3CXCZ 2JA8I 2O53A 3CCEZ 4A3JI 1M1K1 3LUSA 2GTHA 1FDOA 3VMGA 4QTTA 3J81f 1VQOZ 1Y1WI 3GTKI 3FKII 3HKZA 5D1PA 2I3CA 3S16I 2V8JA 2QEXZ 1NUIA 1QVFY 3CMEZ 4DGLA 1VQM1 1Q861 4A3KI 4E32A 3OW2Z 2EGTA 2QEX1 2NAPA 4RVFA 1QVGY 5A2Qf 2R6MA 3NH4A 4NBAA 2JA6I 3NDIA 4QTUA 4MD7A 1Z02A 4S1TA 3CCQZ 2VPXA 2DE7A 4NB9A 1N8R1 1TWCI 1Q7Y2 3CCQ1 2GU2A 2PMZA 1M1K2 3GCFA 5IP9I 4BBSI 3CCVZ 4A3LI 3CPWY 2W04A 1NJI2 2RBLA 3S1NI 3CD61 3CCV1 3Q87A 2G2KA 5FLXf 3J7A4 3D2LA 3IX0A 4BY1I 1W2BZ 1Q16A 4CL1A 1Q862 1VQ8Z 3HOYI 3T4NB 1Y1VS 3CCLZ 4RV9A 4A93I 1VQ5Z 5T64A 2JA7I 2AYDA 1KQSY 1RO0A 3CCL1 2JS4A 3G6EZ 2QRDB 1JWHC 1VQ51 1N8R2 2RT9A 2WAQA 1K731 4NBCA 3J81b 2OTJZ 1LQLA 1S7MA 2P28A 1AA6A 3G6E1 3JAMf 1VQLZ 5T67A 1WIIA 1K9M1 4RVDA 3RZDI 3CMA1 3HOVI 1QVGZ 1VQL1 2R92I 5A2Qb 1SFOI 2NVTI 4E2XA 2IZ3A 3BG1B 3H3VJ 1WW9A 4HH4A 4RVHA 2F4MA 4BBRI 1YUKA 2V3VA 3PO2I 2JIRA 3MZLB 4NBFA 3CCMZ 1ZB9A 3KIHA 1KRLA 1W2BY 2Q4ZA 3FQQA 2KI7B 4HGZA 1SIWA 1K732 2E2JI 4E2ZA 5C4JI 2LIYA 3CC4Z 1K9M2 2QR1B 1USPB 3S14I 1JJ2Y 2NVYI 1VQNZ 3CC41 3S15I 1M901 1VQMZ 3CC71 2V8KA 2V8IA 1KQSZ 3M4OI 1VQN1 3GTGI 2F4OA 3CCS1 2JA5I 5C44I 3K7AI 4A3FI 1ZH1A 2RHBA 3NH5A 5LL6f 4NBDA 1WCMI 3PO3I 3HOZI 1Q812 1VQP1 5IT9b 3JAMb 2HF1A 3F3PC 4NB8A 3CC2Z 2E7ZA 2Q51A 1YJWZ 1TWFI 3J80f 4XX2A 2QA4Z 2OOYB 3I56Z 2W03A 3HOWI 1X3ZA 3CC21 5D1OB 2K5RA 2AKLA 1YJW1 3CD6Z 3GTQI 3HOXI 2QA41 3I561 4Y7NI 2VPYA 4DK1A 1I3QI 3IFUA 2JIPA 3S1RI 1X0TA 1KD11 2QKDA 1FDIA 1QXFA 1Y8CA 2LFUA 3BG0B 1X3WA 3CQZI 4TNUA 3P5JB 4RS4A 2NVQI 3HOUI 2VUMI 2QREB 1JJ2Z 2YADA 2OZKA 2PM9A 3G71Z 1Z03A 3I4MI 2BJOA 4NFRA 3CMAZ 1Q821 3CCJ1 4NBGA 3U50C 3GTLI 1YIJZ 1YITZ 2JR6A 3G711 3IF8A 2WB1A 4EWCA 3D6WA 1ML8A 3VMIA 1YIJ1 1YIT1 1K8A1 1KD12 3I55Z 5IP7I 4A3MI 1VQ4Z 3S17I 3ESWA 1RLYA 2K3RA 2ZAEB 2E2II 4A3DI 2J6AA 2JIOA 2M48A 4A3II 2JIQA 3I551 1VQ41 3H0GI 1TWGI 2VPZA 2PK7A 2YU9I 4E2WA 3S1QI 1WJ2A 1YUAA 3S1MI 2V45A 2VPWA 1Q822 4X6AI 2LEXA 2B63I 5T6BA 2OOXB 1L1OC 3PO3S 2GTIA 4MD8A 3CC7Z 5FLXb 2OTL1 3GTPI 1K8A2 3EEDA 1RQFA
chains in the Genus database with same CATH topology
3CCSZ 1Z01A 4A3BI 1VQ6Z 1K83I 1S721 1QF8A 1P9NA 3TE5B 1Q7Y1 1VQ61 5CM2M 1YJ91 1VQPZ 2IZ4A 1VQ7Z 4NBBA 4A3CI 1TWAI 3NFZA 1YHQZ 1TWHI 3CCE1 1NJI1 4Y52I 3GTMI 1VQ71 5C4XI 1VQO1 2E9HA 1YJNZ 3VMHA 1YHQ1 3FQMA 5FLMI 2H85A 4E31A 2NVXI 1YJN1 3TDHB 3CME1 1I50I 4MRIA 4NBEA 4NOZA 3I07A 2KPIA 3EERA 4E30A 4A3EI 1M902 2O4HA 3GKQA 3I4NI 2JMOA 3NH8A 1I6HI 3MONA 3VB9A 2P3YA 3MZKB 3CCRZ 1QYPA 1ZB8A 3G4SZ 4DQYB 4MONA 3CCJZ 2JNYA 4RVGA 3CCR1 1RNIA 3QWUA 3G4S1 4MXUA 3CXCY 1KC81 1VQKZ 2JUBA 5C3EI 1VQ9Z 5AN9F 3CCUZ 4MH4A 4AYBA 2RIQA 1R9TI 2E2HI 3VTNA 1YI2Z 4E2YA 1VQK1 4E33A 1VQ81 1VQ91 3S2DI 3S2HI 4MD9A 3CCU1 1TFIA 1YI21 2VF1A 2QRCB 2DE6A 1VLAA 1USPA 3KIFA 3NDJA 4NBHA 1DL6A 3OW2Y 4BXXI 1QVFZ 5IT9f 4A3GI 2R7ZI 3GTOI 2OTJ1 1Y1VI 3J80b 3D9XA 3RZOI 2HU9A 4NH1C 1KC82 1PFTA 2OTLZ 1RO4A 3GTJI 1NP6A 3F3FC 3M3YI 1N2FA 2QLVB 4HGYA 2R93I 3GTMS 1S72Z 2Y0SA 1Q811 2M6NA 3CPWZ 2VUGA 2RPRA 5D1OA 1YJ9Z 4BY7I 2DE5A 1RO2A 3CCM1 3CXCZ 2JA8I 2O53A 3CCEZ 4A3JI 1M1K1 3LUSA 2GTHA 3VMGA 1VQOZ 4QTTA 3J81f 1Y1WI 3GTKI 3FKII 3HKZA 5D1PA 2I3CA 3S16I 2V8JA 2QEXZ 1NUIA 1QVFY 3CMEZ 4DGLA 1VQM1 1Q861 4A3KI 4E32A 3OW2Z 2EGTA 2QEX1 4RVFA 1QVGY 5A2Qf 2R6MA 3NH4A 4NBAA 2JA6I 3NDIA 4QTUA 4MD7A 1Z02A 4S1TA 3CCQZ 2DE7A 4NB9A 1N8R1 1TWCI 1Q7Y2 3CCQ1 2GU2A 2PMZA 1M1K2 3GCFA 5IP9I 4BBSI 3CCVZ 4A3LI 3CPWY 2W04A 1NJI2 2RBLA 3S1NI 3CD61 3CCV1 3Q87A 2G2KA 5FLXf 3J7A4 4BY1I 3IX0A 1W2BZ 4CL1A 1Q862 1VQ8Z 3HOYI 3T4NB 1Y1VS 3CCLZ 4RV9A 4A93I 1VQ5Z 5T64A 2JA7I 1KQSY 1RO0A 3CCL1 2JS4A 3G6EZ 2QRDB 1JWHC 1VQ51 1N8R2 2RT9A 2WAQA 1K731 4NBCA 3J81b 2OTJZ 1LQLA 1S7MA 2P28A 3G6E1 3JAMf 1VQLZ 5T67A 1WIIA 1K9M1 4RVDA 3RZDI 3CMA1 3HOVI 1QVGZ 1VQL1 2R92I 5A2Qb 1SFOI 2NVTI 4E2XA 2IZ3A 3BG1B 3H3VJ 1WW9A 4HH4A 4RVHA 2F4MA 4BBRI 1YUKA 3PO2I 3MZLB 4NBFA 3CCMZ 1ZB9A 3KIHA 1KRLA 1W2BY 2Q4ZA 3FQQA 2KI7B 4HGZA 1K732 2E2JI 4E2ZA 5C4JI 2LIYA 3CC4Z 1K9M2 2QR1B 1USPB 3S14I 1JJ2Y 2NVYI 1VQNZ 3CC41 3S15I 1M901 1VQMZ 3CC71 2V8KA 2V8IA 1KQSZ 3M4OI 1VQN1 3GTGI 2F4OA 3CCS1 2JA5I 5C44I 3K7AI 4A3FI 1ZH1A 2RHBA 3NH5A 5LL6f 4NBDA 1WCMI 3PO3I 3HOZI 1Q812 1VQP1 5IT9b 3JAMb 2HF1A 3F3PC 4NB8A 3CC2Z 2Q51A 1YJWZ 1TWFI 3J80f 4XX2A 2QA4Z 2OOYB 3I56Z 2W03A 3HOWI 1X3ZA 3CC21 5D1OB 2K5RA 2AKLA 1YJW1 3CD6Z 3GTQI 3HOXI 2QA41 3I561 4Y7NI 4DK1A 1I3QI 3IFUA 3S1RI 1X0TA 1KD11 2QKDA 2LFUA 3BG0B 1X3WA 3CQZI 4TNUA 3P5JB 4RS4A 2NVQI 3HOUI 2VUMI 2QREB 1JJ2Z 2YADA 2OZKA 2PM9A 3G71Z 1Z03A 3I4MI 2BJOA 4NFRA 3CMAZ 1Q821 3CCJ1 4NBGA 3U50C 3GTLI 1YIJZ 1YITZ 2JR6A 3G711 3IF8A 2WB1A 4EWCA 3D6WA 1ML8A 3VMIA 1YIJ1 1YIT1 1K8A1 1KD12 3I55Z 5IP7I 4A3MI 1VQ4Z 3S17I 3ESWA 1RLYA 2K3RA 2ZAEB 2E2II 4A3DI 2J6AA 2M48A 4A3II 3I551 1VQ41 3H0GI 1TWGI 2PK7A 2YU9I 4E2WA 3S1QI 1YUAA 3S1MI 1Q822 4X6AI 2B63I 5T6BA 2OOXB 1L1OC 3PO3S 2GTIA 4MD8A 3CC7Z 5FLXb 2OTL1 3GTPI 1K8A2 3EEDA 1RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  2QA4 Z;  3CCL Z;  3I56 Z;  1VQ6 Z;  1S72 1;  1VQ5 Z;  3CC2 1;  1YJW 1;  1KQS Y;  3CD6 Z;  2QA4 1;  3CCL 1;  3I56 1;  1Q7Y 1;  1VQ6 1;  1KC8 2;  3G6E Z;  1YJ9 1;  2OTL Z;  1VQ5 1;  1N8R 2;  1VQP Z;  1VQ7 Z;  1K73 1;  1KD1 1;  1YHQ Z;  2OTJ Z;  3G6E 1;  1NJI 1;  3CCE 1;  1VQL Z;  1S72 Z;  1VQ7 1;  1K9M 1;  1VQO 1;  1Q81 1;  3CMA 1;  1YJN Z;  1YHQ 1;  3CPW Z;  1QVG Z;  1VQL 1;  1YJ9 Z;  1YJN 1;  3CME 1;  3CCM 1;  3CXC Z;  1JJ2 Z;  3CCE Z;  1M1K 1;  3G71 Z;  1M90 2;  1VQO Z;  1Q82 1;  3CMA Z;  3CCJ 1;  1YIJ Z;  1YIT Z;  3G71 1;  2QEX Z;  1QVF Y;  3CME Z;  3CCM Z;  1VQM 1;  1Q86 1;  1W2B Y;  1YIJ 1;  1YIT 1;  3CCR Z;  1K8A 1;  1K73 2;  3OW2 Z;  1KD1 2;  2QEX 1;  3I55 Z;  1VQ4 Z;  3G4S Z;  1QVG Y;  3CCJ Z;  3CC4 Z;  3CCR 1;  1K9M 2;  3I55 1;  1VQ4 1;  3G4S 1;  3CXC Y;  1KC8 1;  3CCQ Z;  1JJ2 Y;  1VQK Z;  1N8R 1;  1VQ9 Z;  1VQN Z;  3CC4 1;  1M90 1;  1VQM Z;  3CCU Z;  3CC7 1;  1KQS Z;  1YI2 Z;  1Q7Y 2;  3CCQ 1;  1VQ8 1;  1VQK 1;  1M1K 2;  1VQ9 1;  1VQN 1;  3CCU 1;  3CCS 1;  3CCV Z;  1Q82 2;  1YI2 1;  3CPW Y;  1NJI 2;  3CD6 1;  3CCV 1;  3OW2 Y;  1Q81 2;  1QVF Z;  3CC7 Z;  2OTL 1;  1VQP 1;  1W2B Z;  1Q86 2;  1VQ8 Z;  3CC2 Z;  1K8A 2;  1YJW Z;  2OTJ 1; 
#chains in the Genus database with same CATH topology
 3CCS Z;  1Z01 A;  4A3B I;  1VQ6 Z;  1K83 I;  1S72 1;  1QF8 A;  1P9N A;  3TE5 B;  1Q7Y 1;  1VQ6 1;  5CM2 M;  1YJ9 1;  1VQP Z;  2IZ4 A;  1VQ7 Z;  4NBB A;  4A3C I;  1TWA I;  3NFZ A;  3IR7 A;  1YHQ Z;  1TWH I;  3CCE 1;  1NJI 1;  4Y52 I;  3GTM I;  1VQ7 1;  5C4X I;  1VQO 1;  2E9H A;  1YJN Z;  3VMH A;  1YHQ 1;  3FQM A;  5FLM I;  2H85 A;  4E31 A;  2NVX I;  1YJN 1;  3TDH B;  3CME 1;  1I50 I;  4MRI A;  4NBE A;  4NOZ A;  3I07 A;  2KPI A;  3EER A;  4E30 A;  4A3E I;  1M90 2;  2O4H A;  3GKQ A;  3I4N I;  2JMO A;  3NH8 A;  1I6H I;  2IV2 X;  3MON A;  3VB9 A;  2P3Y A;  3MZK B;  3CCR Z;  1QYP A;  1ZB8 A;  3G4S Z;  4DQY B;  4MON A;  3CCJ Z;  2JNY A;  4RVG A;  3CCR 1;  1RNI A;  3QWU A;  3G4S 1;  4MXU A;  3CXC Y;  1WZN A;  1KC8 1;  1VQK Z;  2JUB A;  5C3E I;  1VQ9 Z;  5AN9 F;  3CCU Z;  4MH4 A;  4AYB A;  2RIQ A;  1R9T I;  2E2H I;  3VTN A;  1YI2 Z;  4E2Y A;  1VQK 1;  4E33 A;  1VQ8 1;  1VQ9 1;  3S2D I;  3S2H I;  4MD9 A;  3CCU 1;  1TFI A;  1YI2 1;  2VF1 A;  2QRC B;  2DE6 A;  1VLA A;  1USP A;  3KIF A;  3NDJ A;  4NBH A;  1DL6 A;  3OW2 Y;  4BXX I;  1QVF Z;  5IT9 f;  4A3G I;  2R7Z I;  3GTO I;  2OTJ 1;  1Y1V I;  3J80 b;  3D9X A;  3RZO I;  2HU9 A;  2JIM A;  4NH1 C;  1KC8 2;  1PFT A;  2OTL Z;  1RO4 A;  3GTJ I;  1NP6 A;  3F3F C;  3M3Y I;  1N2F A;  2QLV B;  4HGY A;  2R93 I;  3GTM S;  1S72 Z;  2Y0S A;  1Q81 1;  2M6N A;  3CPW Z;  2VUG A;  2RPR A;  5D1O A;  1YJ9 Z;  4BY7 I;  2DE5 A;  1RO2 A;  3CCM 1;  3CXC Z;  2JA8 I;  2O53 A;  3CCE Z;  4A3J I;  1M1K 1;  3LUS A;  2GTH A;  1FDO A;  3VMG A;  4QTT A;  3J81 f;  1VQO Z;  1Y1W I;  3GTK I;  3FKI I;  3HKZ A;  5D1P A;  2I3C A;  3S16 I;  2V8J A;  2QEX Z;  1NUI A;  1QVF Y;  3CME Z;  4DGL A;  1VQM 1;  1Q86 1;  4A3K I;  4E32 A;  3OW2 Z;  2EGT A;  2QEX 1;  2NAP A;  4RVF A;  1QVG Y;  5A2Q f;  2R6M A;  3NH4 A;  4NBA A;  2JA6 I;  3NDI A;  4QTU A;  4MD7 A;  1Z02 A;  4S1T A;  3CCQ Z;  2VPX A;  2DE7 A;  4NB9 A;  1N8R 1;  1TWC I;  1Q7Y 2;  3CCQ 1;  2GU2 A;  2PMZ A;  1M1K 2;  3GCF A;  5IP9 I;  4BBS I;  3CCV Z;  4A3L I;  3CPW Y;  2W04 A;  1NJI 2;  2RBL A;  3S1N I;  3CD6 1;  3CCV 1;  3Q87 A;  2G2K A;  5FLX f;  3J7A 4;  3D2L A;  3IX0 A;  4BY1 I;  1W2B Z;  1Q16 A;  4CL1 A;  1Q86 2;  1VQ8 Z;  3HOY I;  3T4N B;  1Y1V S;  3CCL Z;  4RV9 A;  4A93 I;  1VQ5 Z;  5T64 A;  2JA7 I;  2AYD A;  1KQS Y;  1RO0 A;  3CCL 1;  2JS4 A;  3G6E Z;  2QRD B;  1JWH C;  1VQ5 1;  1N8R 2;  2RT9 A;  2WAQ A;  1K73 1;  4NBC A;  3J81 b;  2OTJ Z;  1LQL A;  1S7M A;  2P28 A;  1AA6 A;  3G6E 1;  3JAM f;  1VQL Z;  5T67 A;  1WII A;  1K9M 1;  4RVD A;  3RZD I;  3CMA 1;  3HOV I;  1QVG Z;  1VQL 1;  2R92 I;  5A2Q b;  1SFO I;  2NVT I;  4E2X A;  2IZ3 A;  3BG1 B;  3H3V J;  1WW9 A;  4HH4 A;  4RVH A;  2F4M A;  4BBR I;  1YUK A;  2V3V A;  3PO2 I;  2JIR A;  3MZL B;  4NBF A;  3CCM Z;  1ZB9 A;  3KIH A;  1KRL A;  1W2B Y;  2Q4Z A;  3FQQ A;  2KI7 B;  4HGZ A;  1SIW A;  1K73 2;  2E2J I;  4E2Z A;  5C4J I;  2LIY A;  3CC4 Z;  1K9M 2;  2QR1 B;  1USP B;  3S14 I;  1JJ2 Y;  2NVY I;  1VQN Z;  3CC4 1;  3S15 I;  1M90 1;  1VQM Z;  3CC7 1;  2V8K A;  2V8I A;  1KQS Z;  3M4O I;  1VQN 1;  3GTG I;  2F4O A;  3CCS 1;  2JA5 I;  5C44 I;  3K7A I;  4A3F I;  1ZH1 A;  2RHB A;  3NH5 A;  5LL6 f;  4NBD A;  1WCM I;  3PO3 I;  3HOZ I;  1Q81 2;  1VQP 1;  5IT9 b;  3JAM b;  2HF1 A;  3F3P C;  4NB8 A;  3CC2 Z;  2E7Z A;  2Q51 A;  1YJW Z;  1TWF I;  3J80 f;  4XX2 A;  2QA4 Z;  2OOY B;  3I56 Z;  2W03 A;  3HOW I;  1X3Z A;  3CC2 1;  5D1O B;  2K5R A;  2AKL A;  1YJW 1;  3CD6 Z;  3GTQ I;  3HOX I;  2QA4 1;  3I56 1;  4Y7N I;  2VPY A;  4DK1 A;  1I3Q I;  3IFU A;  2JIP A;  3S1R I;  1X0T A;  1KD1 1;  2QKD A;  1FDI A;  1QXF A;  1Y8C A;  2LFU A;  3BG0 B;  1X3W A;  3CQZ I;  4TNU A;  3P5J B;  4RS4 A;  2NVQ I;  3HOU I;  2VUM I;  2QRE B;  1JJ2 Z;  2YAD A;  2OZK A;  2PM9 A;  3G71 Z;  1Z03 A;  3I4M I;  2BJO A;  4NFR A;  3CMA Z;  1Q82 1;  3CCJ 1;  4NBG A;  3U50 C;  3GTL I;  1YIJ Z;  1YIT Z;  2JR6 A;  3G71 1;  3IF8 A;  2WB1 A;  4EWC A;  3D6W A;  1ML8 A;  3VMI A;  1YIJ 1;  1YIT 1;  1K8A 1;  1KD1 2;  3I55 Z;  5IP7 I;  4A3M I;  1VQ4 Z;  3S17 I;  3ESW A;  1RLY A;  2K3R A;  2ZAE B;  2E2I I;  4A3D I;  2J6A A;  2JIO A;  2M48 A;  4A3I I;  2JIQ A;  3I55 1;  1VQ4 1;  3H0G I;  1TWG I;  2VPZ A;  2PK7 A;  2YU9 I;  4E2W A;  3S1Q I;  1WJ2 A;  1YUA A;  3S1M I;  2V45 A;  2VPW A;  1Q82 2;  4X6A I;  2LEX A;  2B63 I;  5T6B A;  2OOX B;  1L1O C;  3PO3 S;  2GTI A;  4MD8 A;  3CC7 Z;  5FLX b;  2OTL 1;  3GTP I;  1K8A 2;  3EED A;  1RQF A; 
#chains in the Genus database with same CATH homology
 3CCS Z;  1Z01 A;  4A3B I;  1VQ6 Z;  1K83 I;  1S72 1;  1QF8 A;  1P9N A;  3TE5 B;  1Q7Y 1;  1VQ6 1;  5CM2 M;  1YJ9 1;  1VQP Z;  2IZ4 A;  1VQ7 Z;  4NBB A;  4A3C I;  1TWA I;  3NFZ A;  1YHQ Z;  1TWH I;  3CCE 1;  1NJI 1;  4Y52 I;  3GTM I;  1VQ7 1;  5C4X I;  1VQO 1;  2E9H A;  1YJN Z;  3VMH A;  1YHQ 1;  3FQM A;  5FLM I;  2H85 A;  4E31 A;  2NVX I;  1YJN 1;  3TDH B;  3CME 1;  1I50 I;  4MRI A;  4NBE A;  4NOZ A;  3I07 A;  2KPI A;  3EER A;  4E30 A;  4A3E I;  1M90 2;  2O4H A;  3GKQ A;  3I4N I;  2JMO A;  3NH8 A;  1I6H I;  3MON A;  3VB9 A;  2P3Y A;  3MZK B;  3CCR Z;  1QYP A;  1ZB8 A;  3G4S Z;  4DQY B;  4MON A;  3CCJ Z;  2JNY A;  4RVG A;  3CCR 1;  1RNI A;  3QWU A;  3G4S 1;  4MXU A;  3CXC Y;  1KC8 1;  1VQK Z;  2JUB A;  5C3E I;  1VQ9 Z;  5AN9 F;  3CCU Z;  4MH4 A;  4AYB A;  2RIQ A;  1R9T I;  2E2H I;  3VTN A;  1YI2 Z;  4E2Y A;  1VQK 1;  4E33 A;  1VQ8 1;  1VQ9 1;  3S2D I;  3S2H I;  4MD9 A;  3CCU 1;  1TFI A;  1YI2 1;  2VF1 A;  2QRC B;  2DE6 A;  1VLA A;  1USP A;  3KIF A;  3NDJ A;  4NBH A;  1DL6 A;  3OW2 Y;  4BXX I;  1QVF Z;  5IT9 f;  4A3G I;  2R7Z I;  3GTO I;  2OTJ 1;  1Y1V I;  3J80 b;  3D9X A;  3RZO I;  2HU9 A;  4NH1 C;  1KC8 2;  1PFT A;  2OTL Z;  1RO4 A;  3GTJ I;  1NP6 A;  3F3F C;  3M3Y I;  1N2F A;  2QLV B;  4HGY A;  2R93 I;  3GTM S;  1S72 Z;  2Y0S A;  1Q81 1;  2M6N A;  3CPW Z;  2VUG A;  2RPR A;  5D1O A;  1YJ9 Z;  4BY7 I;  2DE5 A;  1RO2 A;  3CCM 1;  3CXC Z;  2JA8 I;  2O53 A;  3CCE Z;  4A3J I;  1M1K 1;  3LUS A;  2GTH A;  3VMG A;  1VQO Z;  4QTT A;  3J81 f;  1Y1W I;  3GTK I;  3FKI I;  3HKZ A;  5D1P A;  2I3C A;  3S16 I;  2V8J A;  2QEX Z;  1NUI A;  1QVF Y;  3CME Z;  4DGL A;  1VQM 1;  1Q86 1;  4A3K I;  4E32 A;  3OW2 Z;  2EGT A;  2QEX 1;  4RVF A;  1QVG Y;  5A2Q f;  2R6M A;  3NH4 A;  4NBA A;  2JA6 I;  3NDI A;  4QTU A;  4MD7 A;  1Z02 A;  4S1T A;  3CCQ Z;  2DE7 A;  4NB9 A;  1N8R 1;  1TWC I;  1Q7Y 2;  3CCQ 1;  2GU2 A;  2PMZ A;  1M1K 2;  3GCF A;  5IP9 I;  4BBS I;  3CCV Z;  4A3L I;  3CPW Y;  2W04 A;  1NJI 2;  2RBL A;  3S1N I;  3CD6 1;  3CCV 1;  3Q87 A;  2G2K A;  5FLX f;  3J7A 4;  4BY1 I;  3IX0 A;  1W2B Z;  4CL1 A;  1Q86 2;  1VQ8 Z;  3HOY I;  3T4N B;  1Y1V S;  3CCL Z;  4RV9 A;  4A93 I;  1VQ5 Z;  5T64 A;  2JA7 I;  1KQS Y;  1RO0 A;  3CCL 1;  2JS4 A;  3G6E Z;  2QRD B;  1JWH C;  1VQ5 1;  1N8R 2;  2RT9 A;  2WAQ A;  1K73 1;  4NBC A;  3J81 b;  2OTJ Z;  1LQL A;  1S7M A;  2P28 A;  3G6E 1;  3JAM f;  1VQL Z;  5T67 A;  1WII A;  1K9M 1;  4RVD A;  3RZD I;  3CMA 1;  3HOV I;  1QVG Z;  1VQL 1;  2R92 I;  5A2Q b;  1SFO I;  2NVT I;  4E2X A;  2IZ3 A;  3BG1 B;  3H3V J;  1WW9 A;  4HH4 A;  4RVH A;  2F4M A;  4BBR I;  1YUK A;  3PO2 I;  3MZL B;  4NBF A;  3CCM Z;  1ZB9 A;  3KIH A;  1KRL A;  1W2B Y;  2Q4Z A;  3FQQ A;  2KI7 B;  4HGZ A;  1K73 2;  2E2J I;  4E2Z A;  5C4J I;  2LIY A;  3CC4 Z;  1K9M 2;  2QR1 B;  1USP B;  3S14 I;  1JJ2 Y;  2NVY I;  1VQN Z;  3CC4 1;  3S15 I;  1M90 1;  1VQM Z;  3CC7 1;  2V8K A;  2V8I A;  1KQS Z;  3M4O I;  1VQN 1;  3GTG I;  2F4O A;  3CCS 1;  2JA5 I;  5C44 I;  3K7A I;  4A3F I;  1ZH1 A;  2RHB A;  3NH5 A;  5LL6 f;  4NBD A;  1WCM I;  3PO3 I;  3HOZ I;  1Q81 2;  1VQP 1;  5IT9 b;  3JAM b;  2HF1 A;  3F3P C;  4NB8 A;  3CC2 Z;  2Q51 A;  1YJW Z;  1TWF I;  3J80 f;  4XX2 A;  2QA4 Z;  2OOY B;  3I56 Z;  2W03 A;  3HOW I;  1X3Z A;  3CC2 1;  5D1O B;  2K5R A;  2AKL A;  1YJW 1;  3CD6 Z;  3GTQ I;  3HOX I;  2QA4 1;  3I56 1;  4Y7N I;  4DK1 A;  1I3Q I;  3IFU A;  3S1R I;  1X0T A;  1KD1 1;  2QKD A;  2LFU A;  3BG0 B;  1X3W A;  3CQZ I;  4TNU A;  3P5J B;  4RS4 A;  2NVQ I;  3HOU I;  2VUM I;  2QRE B;  1JJ2 Z;  2YAD A;  2OZK A;  2PM9 A;  3G71 Z;  1Z03 A;  3I4M I;  2BJO A;  4NFR A;  3CMA Z;  1Q82 1;  3CCJ 1;  4NBG A;  3U50 C;  3GTL I;  1YIJ Z;  1YIT Z;  2JR6 A;  3G71 1;  3IF8 A;  2WB1 A;  4EWC A;  3D6W A;  1ML8 A;  3VMI A;  1YIJ 1;  1YIT 1;  1K8A 1;  1KD1 2;  3I55 Z;  5IP7 I;  4A3M I;  1VQ4 Z;  3S17 I;  3ESW A;  1RLY A;  2K3R A;  2ZAE B;  2E2I I;  4A3D I;  2J6A A;  2M48 A;  4A3I I;  3I55 1;  1VQ4 1;  3H0G I;  1TWG I;  2PK7 A;  2YU9 I;  4E2W A;  3S1Q I;  1YUA A;  3S1M I;  1Q82 2;  4X6A I;  2B63 I;  5T6B A;  2OOX B;  1L1O C;  3PO3 S;  2GTI A;  4MD8 A;  3CC7 Z;  5FLX b;  2OTL 1;  3GTP I;  1K8A 2;  3EED A;  1RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...