1YI21

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2100
1YITZ 1KC82 3CD61 1Q822 1M1K2 1K9M2 3CCQZ 1VQM1 1Q7Y2 1YHQ1 1YIT1 3CCJ1 1VQO1 3CCQ1 3CXCY 1QVGZ 1JJ2Z 1VQ9Z 1VQ7Z 3CCU1 1KQSY 2QA4Z 1QVFY 1YJNZ 1M901 1N8R2 1VQ91 1Q812 1VQ71 1NJI1 2QA41 1KD11 1YJN1 1K8A2 1KC81 1Q821 1M1K1 1K9M1 3CMEZ 1Q7Y1 1YJWZ 1VQ6Z 3CME1 1YJW1 1VQ61 2OTJ1 1Q862 3CC4Z 1N8R1 3OW2Y 1Q811 3CC41 3CCVZ 1K8A1 3CCEZ 3CMAZ 3G71Z 3CPWY 3CCE1 1VQ5Z 3G6EZ 3G711 3CMA1 1YIJZ 1VQ51 3G6E1 1K732 1VQ4Z 3CCSZ 1S72Z 1YIJ1 3CXCZ 1VQLZ 1W2BY 1VQ41 3CCS1 1S721 1KQSZ 3CCLZ 3CCMZ 3G4SZ 1QVFZ 1VQL1 3CCL1 3CCM1 3G4S1 3I55Z 3CC2Z 1QVGY 3I551 3CC21 3CCV1 1K731 1YI2Z 1YHQZ 3CCJZ 1VQOZ 3CCRZ 1YI21 1Q861 3CCR1 3OW2Z 2OTLZ 3CCUZ 3I56Z 1VQKZ 2OTL1 2QEXZ 3I561 3CPWZ 1VQK1 2QEX1 1VQ8Z 1VQPZ 1VQNZ 1JJ2Y 1YJ9Z 3CC7Z 1VQ81 1M902 1VQP1 1VQN1 1NJI2 1YJ91 3CD6Z 3CC71 1KD12 1VQMZ 2OTJZ 1W2BZ
chains in the Genus database with same CATH superfamily
1YITZ 1SIWA 3D2LA 3IF8A 1K9M2 1X3ZA 2M48A 3D6WA 1ZB8A 1Q7Y2 3FKII 2VPYA 1VQO1 1I50I 4HGZA 2Q51A 1KQSY 4NBFA 2V8IA 1QVFY 1M901 1N8R2 3JAMf 1Q812 2QA41 2AYDA 3IX0A 1Y1VI 4BXXI 1WCMI 4CL1A 1M1K1 3NDIA 2RPRA 4NB8A 4DQYB 3CME1 4NOZA 5FLXf 3J7A4 4TNUA 3VMIA 1YJW1 4EWCA 1VQ61 2F4OA 2OTJ1 1Q862 1WIIA 3S1NI 2I3CA 1N2FA 1NP6A 3FQMA 5C44I 3CC41 2JA6I 1QF8A 4A3II 1Y8CA 3GTMI 5A2Qf 2B63I 3CMA1 3S1RI 2R93I 1RLYA 2KI7B 1RO2A 4MRIA 1VQ51 4A3DI 2ZAEB 1YIJ1 3PO2I 2PK7A 2DE7A 1W2BY 1VQ41 5D1OA 1I6HI 4Y52I 2W03A 3CCMZ 3RZOI 1Z01A 3CCL1 3I55Z 3CC2Z 1QVGY 2F4MA 1Q16A 2R7ZI 3KIFA 3CCV1 1Z02A 1YHQZ 1P9NA 3CCRZ 4Y7NI 2RIQA 1Q861 4S1TA 3I4NI 2OTLZ 2Y0SA 3I56Z 2E9HA 4RVFA 3M3YI 1Y1VS 2GTHA 3P5JB 2JUBA 2DE5A 1VQPZ 2PMZA 3RZDI 4A3EI 4A3KI 1WJ2A 3MZLB 1M902 2DE6A 1QYPA 4DGLA 3MONA 1YJ91 3CD6Z 1FDIA 2EGTA 1M1K2 1VQM1 1YIT1 2IV2X 2H85A 3GTMS 2VUGA 3BG1B 3VTNA 3CXCY 4NBEA 2V8JA 1VQ9Z 3GTQI 1YJNZ 4RVHA 3MZKB 3S17I 1SFOI 4A3GI 1RO0A 4NBDA 4E2XA 4E2ZA 4MONA 1USPA 2O4HA 5CM2M 3J81f 3I4MI 2JA5I 4NBCA 2G2KA 2JIOA 4E2YA 3NH5A 1TWGI 3S15I 2NVXI 2JNYA 5C4JI 3GTKI 2NVTI 3D9XA 1K8A1 3CCEZ 4A3CI 3G71Z 3CPWY 4BY7I 3H3VJ 4BBSI 3T4NB 2QR1B 3CCSZ 2K5RA 1S72Z 1VQLZ 2VUMI 4NFRA 2RT9A 1KQSZ 4XX2A 3H0GI 2E2HI 2NAPA 1QVFZ 2Q4ZA 3FQQA 3CCM1 2NVQI 3ESWA 3I551 3CC21 3HOXI 2BJOA 1K731 1YI2Z 3HOZI 4RV9A 2JIPA 1VQOZ 2YU9I 4NH1C 3S1QI 3LUSA 3M4OI 2W04A 3HOVI 1QXFA 1LQLA 3CCR1 2E2II 4HGYA 1L1OC 2AKLA 2OTL1 2RHBA 3I561 1TFIA 4E32A 4NBBA 3IR7A 2HU9A 1VQP1 4MD8A 4X6AI 3QWUA 4MXUA 1WW9A 2OTJZ 1W2BZ 3CD61 3CCQZ 1KRLA 3CQZI 3CCJ1 4E30A 2JMOA 1Z03A 1QVGZ 1R9TI 4NBHA 3PO3I 3EEDA 1VQ7Z 3CCU1 1VQ91 1NJI1 1KD11 2QRCB 1YJN1 1DL6A 3NFZA 3J80b 3GCFA 1K8A2 1KC81 3HOUI 4A3FI 4NBGA 1Q821 5AN9F 5IP7I 5D1OB 3GTJI 5IT9b 1TWCI 2YADA 1RQFA 3OW2Y 4DK1A 4HH4A 5C4XI 3CCVZ 2QLVB 2J6AA 4A3LI 4RS4A 5FLXb 5IP9I 3TDHB 2O53A 2JIMA 3TE5B 3CCE1 3G6EZ 3G711 3GTLI 3EERA 4A93I 2GTIA 1K732 5D1PA 3CXCZ 4RVGA 3CCS1 1S721 3HOYI 3G4SZ 3HOWI 1VQL1 5A2Qb 3Q87A 2LIYA 2PM9A 2KPIA 2QREB 1PFTA 4E2WA 2K3RA 4E33A 2WB1A 1YUKA 3IFUA 1YI21 3J80f 3PO3S 2R6MA 3K7AI 1Y1WI 2R92I 2P28A 1S7MA 2JIQA 1VQKZ 2QEXZ 2OZKA 5IT9f 3CPWZ 4A3BI 3S2HI 1VQ8Z 1VQNZ 1TWHI 1JJ2Y 3CC7Z 2HF1A 1NJI2 1USPB 3GKQA 1KD12 1KC82 1X3WA 1Q822 3VMHA 1YHQ1 1TWFI 2IZ3A 2JIRA 3CCQ1 2QKDA 2WAQA 4BBRI 2OOYB 1JJ2Z 2JR6A 1FDOA 2QA4Z 4A3MI 3F3PC 1VQ71 2JA8I 3GTGI 2E7ZA 4MD9A 3GTPI 2V3VA 3NH4A 1K9M1 3CMEZ 3GTOI 1ML8A 1Q7Y1 3VMGA 4NB9A 2OOXB 1YJWZ 1VQ6Z 3NDJA 1I3QI 1TWAI 3S16I 2VF1A 3CC4Z 1NUIA 2RBLA 1ZH1A 3NH8A 1N8R1 2NVYI 1Q811 2JS4A 2VPXA 4NBAA 3S1MI 3CMAZ 3J81b 5T64A 2M6NA 1VQ5Z 2LEXA 5FLMI 2QRDB 1YIJZ 4RVDA 1WZNA 2GU2A 4MD7A 3G6E1 1VQ4Z 3S2DI 3HKZA 5C3EI 5T67A 4E31A 3JAMb 3CCLZ 3KIHA 2P3YA 4A3JI 1VLAA 4BY1I 3U50C 3G4S1 3VB9A 3BG0B 5LL6f 1K83I 1AA6A 3CCJZ 1JWHC 2V8KA 3OW2Z 3F3FC 2VPWA 2JA7I 3CCUZ 2VPZA 1RNIA 4AYBA 1VQK1 4MH4A 2V45A 2QEX1 3S14I 1X0TA 3I07A 1RO4A 1YJ9Z 1YUAA 1ZB9A 5T6BA 1VQ81 2LFUA 1VQN1 2E2JI 3CC71 4QTTA 1VQMZ 4QTUA 2IZ4A
chains in the Genus database with same CATH topology
1YITZ 3IF8A 1K9M2 1X3ZA 2M48A 3D6WA 1ZB8A 1Q7Y2 3FKII 1VQO1 1I50I 4HGZA 2Q51A 1KQSY 4NBFA 2V8IA 1QVFY 1M901 1N8R2 3JAMf 1Q812 2QA41 3IX0A 1Y1VI 4BXXI 1WCMI 4CL1A 1M1K1 3NDIA 2RPRA 4NB8A 4DQYB 3CME1 4NOZA 5FLXf 3J7A4 4TNUA 3VMIA 1YJW1 4EWCA 1VQ61 2F4OA 2OTJ1 1Q862 1WIIA 3S1NI 2I3CA 1N2FA 1NP6A 3FQMA 5C44I 3CC41 2JA6I 1QF8A 4A3II 3GTMI 5A2Qf 2B63I 3CMA1 3S1RI 2R93I 1RLYA 2KI7B 1RO2A 4MRIA 1VQ51 4A3DI 2ZAEB 1YIJ1 3PO2I 2PK7A 2DE7A 1W2BY 1VQ41 5D1OA 1I6HI 4Y52I 2W03A 3CCMZ 3RZOI 1Z01A 3CCL1 3I55Z 3CC2Z 1QVGY 2F4MA 2R7ZI 3KIFA 3CCV1 1Z02A 1YHQZ 1P9NA 3CCRZ 4Y7NI 2RIQA 1Q861 4S1TA 3I4NI 2OTLZ 2Y0SA 3I56Z 2E9HA 4RVFA 3M3YI 1Y1VS 2GTHA 3P5JB 2JUBA 2DE5A 1VQPZ 2PMZA 3RZDI 4A3EI 4A3KI 3MZLB 1M902 2DE6A 1QYPA 4DGLA 3MONA 1YJ91 3CD6Z 2EGTA 1M1K2 1VQM1 1YIT1 2H85A 3GTMS 2VUGA 3BG1B 3VTNA 3CXCY 4NBEA 2V8JA 1VQ9Z 3GTQI 1YJNZ 4RVHA 3MZKB 3S17I 1SFOI 4A3GI 1RO0A 4NBDA 4E2XA 4E2ZA 4MONA 1USPA 2O4HA 5CM2M 3J81f 3I4MI 2JA5I 4NBCA 2G2KA 4E2YA 3NH5A 1TWGI 3S15I 2NVXI 2JNYA 5C4JI 3GTKI 2NVTI 3D9XA 1K8A1 3CCEZ 4A3CI 3G71Z 3CPWY 4BY7I 3H3VJ 4BBSI 3T4NB 2QR1B 3CCSZ 2K5RA 1S72Z 1VQLZ 2VUMI 4NFRA 2RT9A 1KQSZ 4XX2A 3H0GI 2E2HI 1QVFZ 2Q4ZA 3FQQA 3CCM1 2NVQI 3ESWA 3I551 3CC21 3HOXI 2BJOA 1K731 1YI2Z 3HOZI 4RV9A 2YU9I 1VQOZ 4NH1C 3S1QI 3LUSA 3M4OI 2W04A 3HOVI 1LQLA 3CCR1 2E2II 4HGYA 1L1OC 2AKLA 2OTL1 2RHBA 3I561 1TFIA 4E32A 4NBBA 2HU9A 1VQP1 4MD8A 4X6AI 3QWUA 4MXUA 1WW9A 2OTJZ 1W2BZ 3CD61 3CCQZ 1KRLA 3CQZI 3CCJ1 4E30A 2JMOA 1Z03A 1QVGZ 1R9TI 4NBHA 3PO3I 3EEDA 1VQ7Z 3CCU1 1VQ91 1NJI1 1KD11 2QRCB 1YJN1 1DL6A 3NFZA 3J80b 3GCFA 1K8A2 1KC81 3HOUI 4A3FI 4NBGA 1Q821 5AN9F 5IP7I 5D1OB 3GTJI 5IT9b 1TWCI 2YADA 1RQFA 3OW2Y 4DK1A 4HH4A 5C4XI 3CCVZ 2QLVB 2J6AA 4A3LI 4RS4A 5FLXb 5IP9I 3TDHB 2O53A 3TE5B 3CCE1 3G6EZ 3G711 3GTLI 3EERA 4A93I 2GTIA 1K732 5D1PA 3CXCZ 4RVGA 3CCS1 1S721 3HOYI 3G4SZ 3HOWI 1VQL1 5A2Qb 3Q87A 2LIYA 2PM9A 2KPIA 2QREB 1PFTA 4E2WA 2K3RA 4E33A 2WB1A 1YUKA 3IFUA 1YI21 3J80f 3PO3S 2R6MA 3K7AI 1Y1WI 2R92I 2P28A 1S7MA 1VQKZ 2QEXZ 2OZKA 5IT9f 3CPWZ 4A3BI 3S2HI 1VQ8Z 1VQNZ 1TWHI 1JJ2Y 3CC7Z 2HF1A 1NJI2 1USPB 3GKQA 1KD12 1KC82 1X3WA 1Q822 3VMHA 1YHQ1 1TWFI 2IZ3A 3CCQ1 2QKDA 2WAQA 4BBRI 2OOYB 1JJ2Z 2JR6A 2QA4Z 4A3MI 3F3PC 1VQ71 2JA8I 3GTGI 4MD9A 3GTPI 3NH4A 1K9M1 3CMEZ 3GTOI 1ML8A 1Q7Y1 3VMGA 4NB9A 2OOXB 1YJWZ 1VQ6Z 3NDJA 1I3QI 1TWAI 3S16I 2VF1A 3CC4Z 1NUIA 2RBLA 1ZH1A 3NH8A 1N8R1 2NVYI 1Q811 2JS4A 4NBAA 3S1MI 3CMAZ 3J81b 5T64A 2M6NA 1VQ5Z 5FLMI 2QRDB 1YIJZ 4RVDA 2GU2A 4MD7A 3G6E1 1VQ4Z 3S2DI 3HKZA 5C3EI 5T67A 4E31A 3JAMb 3CCLZ 3KIHA 2P3YA 4A3JI 1VLAA 4BY1I 3U50C 3G4S1 3VB9A 3BG0B 5LL6f 1K83I 3CCJZ 1JWHC 2V8KA 3OW2Z 3F3FC 2JA7I 3CCUZ 1RNIA 4AYBA 1VQK1 4MH4A 2QEX1 3S14I 1X0TA 3I07A 1RO4A 1YJ9Z 1YUAA 1ZB9A 5T6BA 1VQ81 2LFUA 1VQN1 2E2JI 3CC71 4QTTA 1VQMZ 4QTUA 2IZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT Z;  1KC8 2;  3CD6 1;  1Q82 2;  1M1K 2;  1K9M 2;  3CCQ Z;  1VQM 1;  1Q7Y 2;  1YHQ 1;  1YIT 1;  3CCJ 1;  1VQO 1;  3CCQ 1;  3CXC Y;  1QVG Z;  1JJ2 Z;  1VQ9 Z;  1VQ7 Z;  3CCU 1;  1KQS Y;  2QA4 Z;  1QVF Y;  1YJN Z;  1M90 1;  1N8R 2;  1VQ9 1;  1Q81 2;  1VQ7 1;  1NJI 1;  2QA4 1;  1KD1 1;  1YJN 1;  1K8A 2;  1KC8 1;  1Q82 1;  1M1K 1;  1K9M 1;  3CME Z;  1Q7Y 1;  1YJW Z;  1VQ6 Z;  3CME 1;  1YJW 1;  1VQ6 1;  2OTJ 1;  1Q86 2;  3CC4 Z;  1N8R 1;  3OW2 Y;  1Q81 1;  3CC4 1;  3CCV Z;  1K8A 1;  3CCE Z;  3CMA Z;  3G71 Z;  3CPW Y;  3CCE 1;  1VQ5 Z;  3G6E Z;  3G71 1;  3CMA 1;  1YIJ Z;  1VQ5 1;  3G6E 1;  1K73 2;  1VQ4 Z;  3CCS Z;  1S72 Z;  1YIJ 1;  3CXC Z;  1VQL Z;  1W2B Y;  1VQ4 1;  3CCS 1;  1S72 1;  1KQS Z;  3CCL Z;  3CCM Z;  3G4S Z;  1QVF Z;  1VQL 1;  3CCL 1;  3CCM 1;  3G4S 1;  3I55 Z;  3CC2 Z;  1QVG Y;  3I55 1;  3CC2 1;  3CCV 1;  1K73 1;  1YI2 Z;  1YHQ Z;  3CCJ Z;  1VQO Z;  3CCR Z;  1YI2 1;  1Q86 1;  3CCR 1;  3OW2 Z;  2OTL Z;  3CCU Z;  3I56 Z;  1VQK Z;  2OTL 1;  2QEX Z;  3I56 1;  3CPW Z;  1VQK 1;  2QEX 1;  1VQ8 Z;  1VQP Z;  1VQN Z;  1JJ2 Y;  1YJ9 Z;  3CC7 Z;  1VQ8 1;  1M90 2;  1VQP 1;  1VQN 1;  1NJI 2;  1YJ9 1;  3CD6 Z;  3CC7 1;  1KD1 2;  1VQM Z;  2OTJ Z;  1W2B Z; 
#chains in the Genus database with same CATH topology
 1YIT Z;  1SIW A;  3D2L A;  3IF8 A;  1K9M 2;  1X3Z A;  2M48 A;  3D6W A;  1ZB8 A;  1Q7Y 2;  3FKI I;  2VPY A;  1VQO 1;  1I50 I;  4HGZ A;  2Q51 A;  1KQS Y;  4NBF A;  2V8I A;  1QVF Y;  1M90 1;  1N8R 2;  3JAM f;  1Q81 2;  2QA4 1;  2AYD A;  3IX0 A;  1Y1V I;  4BXX I;  1WCM I;  4CL1 A;  1M1K 1;  3NDI A;  2RPR A;  4NB8 A;  4DQY B;  3CME 1;  4NOZ A;  5FLX f;  3J7A 4;  4TNU A;  3VMI A;  1YJW 1;  4EWC A;  1VQ6 1;  2F4O A;  2OTJ 1;  1Q86 2;  1WII A;  3S1N I;  2I3C A;  1N2F A;  1NP6 A;  3FQM A;  5C44 I;  3CC4 1;  2JA6 I;  1QF8 A;  4A3I I;  1Y8C A;  3GTM I;  5A2Q f;  2B63 I;  3CMA 1;  3S1R I;  2R93 I;  1RLY A;  2KI7 B;  1RO2 A;  4MRI A;  1VQ5 1;  4A3D I;  2ZAE B;  1YIJ 1;  3PO2 I;  2PK7 A;  2DE7 A;  1W2B Y;  1VQ4 1;  5D1O A;  1I6H I;  4Y52 I;  2W03 A;  3CCM Z;  3RZO I;  1Z01 A;  3CCL 1;  3I55 Z;  3CC2 Z;  1QVG Y;  2F4M A;  1Q16 A;  2R7Z I;  3KIF A;  3CCV 1;  1Z02 A;  1YHQ Z;  1P9N A;  3CCR Z;  4Y7N I;  2RIQ A;  1Q86 1;  4S1T A;  3I4N I;  2OTL Z;  2Y0S A;  3I56 Z;  2E9H A;  4RVF A;  3M3Y I;  1Y1V S;  2GTH A;  3P5J B;  2JUB A;  2DE5 A;  1VQP Z;  2PMZ A;  3RZD I;  4A3E I;  4A3K I;  1WJ2 A;  3MZL B;  1M90 2;  2DE6 A;  1QYP A;  4DGL A;  3MON A;  1YJ9 1;  3CD6 Z;  1FDI A;  2EGT A;  1M1K 2;  1VQM 1;  1YIT 1;  2IV2 X;  2H85 A;  3GTM S;  2VUG A;  3BG1 B;  3VTN A;  3CXC Y;  4NBE A;  2V8J A;  1VQ9 Z;  3GTQ I;  1YJN Z;  4RVH A;  3MZK B;  3S17 I;  1SFO I;  4A3G I;  1RO0 A;  4NBD A;  4E2X A;  4E2Z A;  4MON A;  1USP A;  2O4H A;  5CM2 M;  3J81 f;  3I4M I;  2JA5 I;  4NBC A;  2G2K A;  2JIO A;  4E2Y A;  3NH5 A;  1TWG I;  3S15 I;  2NVX I;  2JNY A;  5C4J I;  3GTK I;  2NVT I;  3D9X A;  1K8A 1;  3CCE Z;  4A3C I;  3G71 Z;  3CPW Y;  4BY7 I;  3H3V J;  4BBS I;  3T4N B;  2QR1 B;  3CCS Z;  2K5R A;  1S72 Z;  1VQL Z;  2VUM I;  4NFR A;  2RT9 A;  1KQS Z;  4XX2 A;  3H0G I;  2E2H I;  2NAP A;  1QVF Z;  2Q4Z A;  3FQQ A;  3CCM 1;  2NVQ I;  3ESW A;  3I55 1;  3CC2 1;  3HOX I;  2BJO A;  1K73 1;  1YI2 Z;  3HOZ I;  4RV9 A;  2JIP A;  1VQO Z;  2YU9 I;  4NH1 C;  3S1Q I;  3LUS A;  3M4O I;  2W04 A;  3HOV I;  1QXF A;  1LQL A;  3CCR 1;  2E2I I;  4HGY A;  1L1O C;  2AKL A;  2OTL 1;  2RHB A;  3I56 1;  1TFI A;  4E32 A;  4NBB A;  3IR7 A;  2HU9 A;  1VQP 1;  4MD8 A;  4X6A I;  3QWU A;  4MXU A;  1WW9 A;  2OTJ Z;  1W2B Z;  3CD6 1;  3CCQ Z;  1KRL A;  3CQZ I;  3CCJ 1;  4E30 A;  2JMO A;  1Z03 A;  1QVG Z;  1R9T I;  4NBH A;  3PO3 I;  3EED A;  1VQ7 Z;  3CCU 1;  1VQ9 1;  1NJI 1;  1KD1 1;  2QRC B;  1YJN 1;  1DL6 A;  3NFZ A;  3J80 b;  3GCF A;  1K8A 2;  1KC8 1;  3HOU I;  4A3F I;  4NBG A;  1Q82 1;  5AN9 F;  5IP7 I;  5D1O B;  3GTJ I;  5IT9 b;  1TWC I;  2YAD A;  1RQF A;  3OW2 Y;  4DK1 A;  4HH4 A;  5C4X I;  3CCV Z;  2QLV B;  2J6A A;  4A3L I;  4RS4 A;  5FLX b;  5IP9 I;  3TDH B;  2O53 A;  2JIM A;  3TE5 B;  3CCE 1;  3G6E Z;  3G71 1;  3GTL I;  3EER A;  4A93 I;  2GTI A;  1K73 2;  5D1P A;  3CXC Z;  4RVG A;  3CCS 1;  1S72 1;  3HOY I;  3G4S Z;  3HOW I;  1VQL 1;  5A2Q b;  3Q87 A;  2LIY A;  2PM9 A;  2KPI A;  2QRE B;  1PFT A;  4E2W A;  2K3R A;  4E33 A;  2WB1 A;  1YUK A;  3IFU A;  1YI2 1;  3J80 f;  3PO3 S;  2R6M A;  3K7A I;  1Y1W I;  2R92 I;  2P28 A;  1S7M A;  2JIQ A;  1VQK Z;  2QEX Z;  2OZK A;  5IT9 f;  3CPW Z;  4A3B I;  3S2H I;  1VQ8 Z;  1VQN Z;  1TWH I;  1JJ2 Y;  3CC7 Z;  2HF1 A;  1NJI 2;  1USP B;  3GKQ A;  1KD1 2;  1KC8 2;  1X3W A;  1Q82 2;  3VMH A;  1YHQ 1;  1TWF I;  2IZ3 A;  2JIR A;  3CCQ 1;  2QKD A;  2WAQ A;  4BBR I;  2OOY B;  1JJ2 Z;  2JR6 A;  1FDO A;  2QA4 Z;  4A3M I;  3F3P C;  1VQ7 1;  2JA8 I;  3GTG I;  2E7Z A;  4MD9 A;  3GTP I;  2V3V A;  3NH4 A;  1K9M 1;  3CME Z;  3GTO I;  1ML8 A;  1Q7Y 1;  3VMG A;  4NB9 A;  2OOX B;  1YJW Z;  1VQ6 Z;  3NDJ A;  1I3Q I;  1TWA I;  3S16 I;  2VF1 A;  3CC4 Z;  1NUI A;  2RBL A;  1ZH1 A;  3NH8 A;  1N8R 1;  2NVY I;  1Q81 1;  2JS4 A;  2VPX A;  4NBA A;  3S1M I;  3CMA Z;  3J81 b;  5T64 A;  2M6N A;  1VQ5 Z;  2LEX A;  5FLM I;  2QRD B;  1YIJ Z;  4RVD A;  1WZN A;  2GU2 A;  4MD7 A;  3G6E 1;  1VQ4 Z;  3S2D I;  3HKZ A;  5C3E I;  5T67 A;  4E31 A;  3JAM b;  3CCL Z;  3KIH A;  2P3Y A;  4A3J I;  1VLA A;  4BY1 I;  3U50 C;  3G4S 1;  3VB9 A;  3BG0 B;  5LL6 f;  1K83 I;  1AA6 A;  3CCJ Z;  1JWH C;  2V8K A;  3OW2 Z;  3F3F C;  2VPW A;  2JA7 I;  3CCU Z;  2VPZ A;  1RNI A;  4AYB A;  1VQK 1;  4MH4 A;  2V45 A;  2QEX 1;  3S14 I;  1X0T A;  3I07 A;  1RO4 A;  1YJ9 Z;  1YUA A;  1ZB9 A;  5T6B A;  1VQ8 1;  2LFU A;  1VQN 1;  2E2J I;  3CC7 1;  4QTT A;  1VQM Z;  4QTU A;  2IZ4 A; 
#chains in the Genus database with same CATH homology
 1YIT Z;  3IF8 A;  1K9M 2;  1X3Z A;  2M48 A;  3D6W A;  1ZB8 A;  1Q7Y 2;  3FKI I;  1VQO 1;  1I50 I;  4HGZ A;  2Q51 A;  1KQS Y;  4NBF A;  2V8I A;  1QVF Y;  1M90 1;  1N8R 2;  3JAM f;  1Q81 2;  2QA4 1;  3IX0 A;  1Y1V I;  4BXX I;  1WCM I;  4CL1 A;  1M1K 1;  3NDI A;  2RPR A;  4NB8 A;  4DQY B;  3CME 1;  4NOZ A;  5FLX f;  3J7A 4;  4TNU A;  3VMI A;  1YJW 1;  4EWC A;  1VQ6 1;  2F4O A;  2OTJ 1;  1Q86 2;  1WII A;  3S1N I;  2I3C A;  1N2F A;  1NP6 A;  3FQM A;  5C44 I;  3CC4 1;  2JA6 I;  1QF8 A;  4A3I I;  3GTM I;  5A2Q f;  2B63 I;  3CMA 1;  3S1R I;  2R93 I;  1RLY A;  2KI7 B;  1RO2 A;  4MRI A;  1VQ5 1;  4A3D I;  2ZAE B;  1YIJ 1;  3PO2 I;  2PK7 A;  2DE7 A;  1W2B Y;  1VQ4 1;  5D1O A;  1I6H I;  4Y52 I;  2W03 A;  3CCM Z;  3RZO I;  1Z01 A;  3CCL 1;  3I55 Z;  3CC2 Z;  1QVG Y;  2F4M A;  2R7Z I;  3KIF A;  3CCV 1;  1Z02 A;  1YHQ Z;  1P9N A;  3CCR Z;  4Y7N I;  2RIQ A;  1Q86 1;  4S1T A;  3I4N I;  2OTL Z;  2Y0S A;  3I56 Z;  2E9H A;  4RVF A;  3M3Y I;  1Y1V S;  2GTH A;  3P5J B;  2JUB A;  2DE5 A;  1VQP Z;  2PMZ A;  3RZD I;  4A3E I;  4A3K I;  3MZL B;  1M90 2;  2DE6 A;  1QYP A;  4DGL A;  3MON A;  1YJ9 1;  3CD6 Z;  2EGT A;  1M1K 2;  1VQM 1;  1YIT 1;  2H85 A;  3GTM S;  2VUG A;  3BG1 B;  3VTN A;  3CXC Y;  4NBE A;  2V8J A;  1VQ9 Z;  3GTQ I;  1YJN Z;  4RVH A;  3MZK B;  3S17 I;  1SFO I;  4A3G I;  1RO0 A;  4NBD A;  4E2X A;  4E2Z A;  4MON A;  1USP A;  2O4H A;  5CM2 M;  3J81 f;  3I4M I;  2JA5 I;  4NBC A;  2G2K A;  4E2Y A;  3NH5 A;  1TWG I;  3S15 I;  2NVX I;  2JNY A;  5C4J I;  3GTK I;  2NVT I;  3D9X A;  1K8A 1;  3CCE Z;  4A3C I;  3G71 Z;  3CPW Y;  4BY7 I;  3H3V J;  4BBS I;  3T4N B;  2QR1 B;  3CCS Z;  2K5R A;  1S72 Z;  1VQL Z;  2VUM I;  4NFR A;  2RT9 A;  1KQS Z;  4XX2 A;  3H0G I;  2E2H I;  1QVF Z;  2Q4Z A;  3FQQ A;  3CCM 1;  2NVQ I;  3ESW A;  3I55 1;  3CC2 1;  3HOX I;  2BJO A;  1K73 1;  1YI2 Z;  3HOZ I;  4RV9 A;  2YU9 I;  1VQO Z;  4NH1 C;  3S1Q I;  3LUS A;  3M4O I;  2W04 A;  3HOV I;  1LQL A;  3CCR 1;  2E2I I;  4HGY A;  1L1O C;  2AKL A;  2OTL 1;  2RHB A;  3I56 1;  1TFI A;  4E32 A;  4NBB A;  2HU9 A;  1VQP 1;  4MD8 A;  4X6A I;  3QWU A;  4MXU A;  1WW9 A;  2OTJ Z;  1W2B Z;  3CD6 1;  3CCQ Z;  1KRL A;  3CQZ I;  3CCJ 1;  4E30 A;  2JMO A;  1Z03 A;  1QVG Z;  1R9T I;  4NBH A;  3PO3 I;  3EED A;  1VQ7 Z;  3CCU 1;  1VQ9 1;  1NJI 1;  1KD1 1;  2QRC B;  1YJN 1;  1DL6 A;  3NFZ A;  3J80 b;  3GCF A;  1K8A 2;  1KC8 1;  3HOU I;  4A3F I;  4NBG A;  1Q82 1;  5AN9 F;  5IP7 I;  5D1O B;  3GTJ I;  5IT9 b;  1TWC I;  2YAD A;  1RQF A;  3OW2 Y;  4DK1 A;  4HH4 A;  5C4X I;  3CCV Z;  2QLV B;  2J6A A;  4A3L I;  4RS4 A;  5FLX b;  5IP9 I;  3TDH B;  2O53 A;  3TE5 B;  3CCE 1;  3G6E Z;  3G71 1;  3GTL I;  3EER A;  4A93 I;  2GTI A;  1K73 2;  5D1P A;  3CXC Z;  4RVG A;  3CCS 1;  1S72 1;  3HOY I;  3G4S Z;  3HOW I;  1VQL 1;  5A2Q b;  3Q87 A;  2LIY A;  2PM9 A;  2KPI A;  2QRE B;  1PFT A;  4E2W A;  2K3R A;  4E33 A;  2WB1 A;  1YUK A;  3IFU A;  1YI2 1;  3J80 f;  3PO3 S;  2R6M A;  3K7A I;  1Y1W I;  2R92 I;  2P28 A;  1S7M A;  1VQK Z;  2QEX Z;  2OZK A;  5IT9 f;  3CPW Z;  4A3B I;  3S2H I;  1VQ8 Z;  1VQN Z;  1TWH I;  1JJ2 Y;  3CC7 Z;  2HF1 A;  1NJI 2;  1USP B;  3GKQ A;  1KD1 2;  1KC8 2;  1X3W A;  1Q82 2;  3VMH A;  1YHQ 1;  1TWF I;  2IZ3 A;  3CCQ 1;  2QKD A;  2WAQ A;  4BBR I;  2OOY B;  1JJ2 Z;  2JR6 A;  2QA4 Z;  4A3M I;  3F3P C;  1VQ7 1;  2JA8 I;  3GTG I;  4MD9 A;  3GTP I;  3NH4 A;  1K9M 1;  3CME Z;  3GTO I;  1ML8 A;  1Q7Y 1;  3VMG A;  4NB9 A;  2OOX B;  1YJW Z;  1VQ6 Z;  3NDJ A;  1I3Q I;  1TWA I;  3S16 I;  2VF1 A;  3CC4 Z;  1NUI A;  2RBL A;  1ZH1 A;  3NH8 A;  1N8R 1;  2NVY I;  1Q81 1;  2JS4 A;  4NBA A;  3S1M I;  3CMA Z;  3J81 b;  5T64 A;  2M6N A;  1VQ5 Z;  5FLM I;  2QRD B;  1YIJ Z;  4RVD A;  2GU2 A;  4MD7 A;  3G6E 1;  1VQ4 Z;  3S2D I;  3HKZ A;  5C3E I;  5T67 A;  4E31 A;  3JAM b;  3CCL Z;  3KIH A;  2P3Y A;  4A3J I;  1VLA A;  4BY1 I;  3U50 C;  3G4S 1;  3VB9 A;  3BG0 B;  5LL6 f;  1K83 I;  3CCJ Z;  1JWH C;  2V8K A;  3OW2 Z;  3F3F C;  2JA7 I;  3CCU Z;  1RNI A;  4AYB A;  1VQK 1;  4MH4 A;  2QEX 1;  3S14 I;  1X0T A;  3I07 A;  1RO4 A;  1YJ9 Z;  1YUA A;  1ZB9 A;  5T6B A;  1VQ8 1;  2LFU A;  1VQN 1;  2E2J I;  3CC7 1;  4QTT A;  1VQM Z;  4QTU A;  2IZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...