1YI21

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2100
3CCJZ 1KQSZ 1N8R2 1YJ9Z 1Q811 1VQ7Z 2OTL1 3OW2Y 1KC81 1KD11 1VQ41 2QEXZ 3CCRZ 2QA41 1YITZ 3CD61 1Q7Y2 1JJ2Y 1KD12 1KQSY 1YI21 3CC7Z 1YJN1 1QVFZ 1K9M1 3CCE1 3CCJ1 1VQOZ 3CCV1 3CCQZ 1K731 1KC82 1JJ2Z 3CPWZ 3G71Z 3I551 3G4S1 1S72Z 3CCL1 3CMAZ 3OW2Z 1N8R1 1YJW1 1VQLZ 1Q822 1VQMZ 3CXCZ 3CCS1 1YHQ1 3CME1 1VQ61 2OTJZ 3I56Z 1VQ51 1M1K1 1K732 1QVGY 2QEX1 3CCR1 2QA4Z 1YIT1 3CC41 1K8A2 3CCUZ 1VQN1 1VQP1 3CC21 1YIJZ 1YI2Z 3CPWY 3CC71 1NJI1 1K9M2 1VQ4Z 1W2BY 1VQ91 3CCM1 1QVFY 1NJI2 2OTLZ 3G6EZ 3CXCY 1Q812 3CD6Z 1VQ6Z 1VQK1 1VQ5Z 1VQO1 1Q862 1VQ81 3CCU1 1YJ91 1S721 1VQ71 1M901 1YJNZ 3CCVZ 1K8A1 1VQL1 3CC4Z 3G711 3CCEZ 1W2BZ 3CCMZ 1VQNZ 1VQPZ 1M902 3I561 1YJWZ 3G6E1 1M1K2 1VQM1 3G4SZ 1VQKZ 1VQ9Z 3CCSZ 1VQ8Z 1YHQZ 3CMA1 2OTJ1 3CC2Z 1YIJ1 1QVGZ 3CCQ1 1Q821 1Q7Y1 3I55Z 3CMEZ 1Q861 3CCLZ
chains in the Genus database with same CATH superfamily
1Z01A 3VTNA 3H3VJ 1KQSZ 3GCFA 3PO2I 4NOZA 2H85A 1FDOA 3KIFA 2QEXZ 1TWHI 2NVXI 5FLMI 1KD12 2E2JI 2W03A 4E2YA 2O4HA 3M4OI 3FKII 2R7ZI 2GTIA 3CPWZ 2VPZA 3S16I 4MXUA 4MD9A 1N8R1 4A3KI 1Z03A 1ZB8A 1WIIA 3CXCZ 1X0TA 1VQ61 2NVTI 3KIHA 1SIWA 3GKQA 3LUSA 4A3BI 1RLYA 1ML8A 3GTGI 1QVGY 1YIT1 5C44I 2RIQA 1LQLA 2HU9A 4NB8A 4X6AI 1VQN1 5C3EI 3HOVI 5C4JI 2JIQA 3CCM1 1NJI2 4A3II 3I4NI 2OOYB 2DE6A 3CD6Z 1VQ6Z 1TFIA 3S17I 5AN9F 3F3PC 5D1PA 4NFRA 1WCMI 4E2ZA 5IT9b 3CCU1 5T6BA 2V45A 2JIRA 3HOXI 2PMZA 1TWAI 2OZKA 3CC4Z 2M48A 2R6MA 5IP9I 4QTTA 2GU2A 3I561 1Y1VS 1YJWZ 3S2DI 1DL6A 4Y52I 1RO2A 4NBAA 3G4SZ 4DQYB 3PO3S 3CCSZ 1VQ8Z 1YIJ1 3J81b 3CCQ1 3GTKI 2VUGA 3I55Z 1N2FA 3D6WA 3I4MI 3FQMA 5A2Qb 3GTOI 4E30A 2OTL1 3OW2Y 3HOZI 1KD11 1WZNA 4EWCA 3IF8A 1QXFA 2NVQI 1VQ41 3Q87A 1S7MA 1WW9A 4NBDA 5FLXb 3CD61 1TWGI 1Q7Y2 1JJ2Y 2E7ZA 3J81f 4MRIA 1YJN1 1QVFZ 1Q16A 3CCJ1 2V8KA 4AYBA 1K731 3PO3I 2JUBA 4MH4A 4A3MI 1S72Z 3CCL1 1ZB9A 4NBGA 3CMAZ 5CM2M 1VQLZ 2LEXA 1Q822 1VQMZ 2OOXB 1FDIA 3GTPI 3CME1 3MZKB 3J80f 2QRCB 2IV2X 5LL6f 1RO0A 1AA6A 4MD7A 3CCUZ 2B63I 3T4NB 1TWCI 1VQP1 4A3JI 2WAQA 2RBLA 1YI2Z 3CC71 1NJI1 2JA6I 1JWHC 1X3ZA 3NFZA 1W2BY 4A3EI 2PK7A 1QYPA 4A3LI 1QVFY 3NH8A 3FQQA 4A3CI 2E2HI 1I6HI 1RNIA 2QRDB 4BBSI 2VPYA 3NDJA 1VQO1 1Q862 1VQ81 2F4OA 5FLXf 4TNUA 2IZ3A 2Y0SA 4RV9A 4A3GI 2RHBA 5T67A 2R92I 4E33A 1X3WA 2JMOA 4RVGA 4QTUA 5D1OB 4NBHA 1VQKZ 1ZH1A 2JA8I 3S1QI 5IT9f 4NBEA 1YUKA 3RZOI 3J7A4 2LFUA 4BY1I 3MONA 3HKZA 4NB9A 1Q821 4DK1A 3CCLZ 3EERA 3CCJZ 3TE5B 1R9TI 1Z02A 1YJ9Z 1Q811 1VQ7Z 2AKLA 4HGYA 4RVFA 1KC81 5T64A 4NBCA 3NH5A 2O53A 1YITZ 2Q4ZA 2GTHA 1KQSY 1YI21 2I3CA 2PM9A 2W04A 4DGLA 1K9M1 3NH4A 1Y1WI 3CCE1 2JA5I 2Q51A 3CCV1 2JIOA 1KC82 1JJ2Z 3D2LA 3G71Z 4A3DI 4MONA 2VUMI 1TWFI 2V8JA 2JA7I 1SFOI 3OW2Z 1YJW1 2WB1A 3HOUI 2VPWA 4BXXI 1YHQ1 2OTJZ 3I56Z 1VQ51 2AYDA 3HOWI 2JIMA 1K732 3ESWA 2QA4Z 3CCR1 3CC41 3MZLB 2R93I 2E9HA 3JAMf 2G2KA 3VB9A 3IFUA 3CC21 1PFTA 3QWUA 4XX2A 3VMGA 1K9M2 4RVDA 2QR1B 4RVHA 2IZ4A 2OTLZ 1I3QI 3VMHA 1Q812 2VPXA 1VQK1 1VQ5Z 1NUIA 3S14I 2V3VA 3S1NI 3S2HI 3S1RI 1YJ91 4A3FI 4NH1C 2RPRA 1VQ71 1Y8CA 1QF8A 5IP7I 1KRLA 3CQZI 4CL1A 3H0GI 1I50I 3I07A 1M902 3GTQI 5A2Qf 3G6E1 3M3YI 1M1K2 2ZAEB 1VQ9Z 4BY7I 3GTLI 1YHQZ 5C4XI 2OTJ1 3EEDA 4E32A 2J6AA 3GTMS 4BBRI 3BG0B 3VMIA 4NBBA 3CMEZ 1Q861 2KPIA 1N8R2 3GTJI 3S15I 4HH4A 1P9NA 3IX0A 2HF1A 2QREB 3CCRZ 2QA41 3IR7A 2BJOA 2YU9I 2JIPA 3CC7Z 2JNYA 2KI7B 1USPB 4HGZA 2P3YA 1VQOZ 1NP6A 3CCQZ 2NVYI 4E2WA 3I551 3G4S1 2E2II 4A93I 3NDIA 3CCS1 4MD8A 3RZDI 1USPA 1M1K1 2QEX1 2K3RA 2NAPA 1K83I 1K8A2 3F3FC 4E2XA 2M6NA 3P5JB 2RT9A 2QKDA 1YIJZ 3S1MI 3CPWY 1VQ4Z 3TDHB 2JR6A 4Y7NI 1VQ91 1RO4A 3J80b 3G6EZ 3CXCY 1RQFA 2F4MA 3U50C 3JAMb 4E31A 2VF1A 3GTMI 1S721 4S1TA 1L1OC 3D9XA 2K5RA 1M901 1YJNZ 3CCVZ 1K8A1 3BG1B 1YUAA 1VQL1 1Y1VI 3G711 3CCEZ 1W2BZ 3CCMZ 1VQNZ 1VQPZ 1WJ2A 1VQM1 2DE7A 2P28A 2LIYA 3K7AI 2EGTA 1VLAA 2QLVB 5D1OA 3CMA1 3CC2Z 2V8IA 1QVGZ 4RS4A 2JS4A 2DE5A 2YADA 3HOYI 1Q7Y1 4NBFA
chains in the Genus database with same CATH topology
1Z01A 3VTNA 3H3VJ 1KQSZ 3GCFA 3PO2I 4NOZA 2H85A 3KIFA 2QEXZ 1TWHI 2NVXI 5FLMI 1KD12 2E2JI 2W03A 4E2YA 2O4HA 3M4OI 3FKII 2R7ZI 2GTIA 3CPWZ 3S16I 4MXUA 4MD9A 1N8R1 4A3KI 1Z03A 1ZB8A 1WIIA 3CXCZ 1X0TA 1VQ61 2NVTI 3KIHA 3GKQA 3LUSA 4A3BI 1RLYA 1ML8A 3GTGI 1QVGY 1YIT1 5C44I 2RIQA 1LQLA 2HU9A 4NB8A 4X6AI 1VQN1 5C3EI 3HOVI 5C4JI 3CCM1 1NJI2 4A3II 3I4NI 2OOYB 2DE6A 3CD6Z 1VQ6Z 1TFIA 3S17I 5AN9F 3F3PC 5D1PA 4NFRA 1WCMI 4E2ZA 5IT9b 3CCU1 5T6BA 3HOXI 2PMZA 1TWAI 2OZKA 3CC4Z 2M48A 2R6MA 5IP9I 4QTTA 2GU2A 3I561 1Y1VS 1YJWZ 3S2DI 1DL6A 4Y52I 1RO2A 4NBAA 3G4SZ 4DQYB 3PO3S 3CCSZ 1VQ8Z 1YIJ1 3J81b 3CCQ1 3GTKI 2VUGA 3I55Z 1N2FA 3D6WA 3I4MI 3FQMA 5A2Qb 3GTOI 4E30A 2OTL1 3OW2Y 3HOZI 1KD11 3IF8A 4EWCA 2NVQI 1VQ41 3Q87A 1S7MA 1WW9A 4NBDA 5FLXb 3CD61 1TWGI 1Q7Y2 1JJ2Y 3J81f 4MRIA 1YJN1 1QVFZ 3CCJ1 2V8KA 4AYBA 1K731 3PO3I 2JUBA 4MH4A 4A3MI 1S72Z 3CCL1 1ZB9A 4NBGA 3CMAZ 5CM2M 1VQLZ 1Q822 1VQMZ 2OOXB 3GTPI 3CME1 3MZKB 3J80f 2QRCB 5LL6f 1RO0A 4MD7A 3CCUZ 2B63I 3T4NB 1TWCI 1VQP1 4A3JI 2WAQA 2RBLA 1YI2Z 3CC71 1NJI1 2JA6I 1JWHC 1X3ZA 3NFZA 1W2BY 4A3EI 2PK7A 1QYPA 4A3LI 1QVFY 3NH8A 3FQQA 4A3CI 2E2HI 1I6HI 1RNIA 2QRDB 4BBSI 3NDJA 1VQO1 1Q862 1VQ81 2F4OA 5FLXf 4TNUA 2IZ3A 2Y0SA 4RV9A 4A3GI 2RHBA 5T67A 2R92I 4E33A 1X3WA 2JMOA 4RVGA 4QTUA 5D1OB 4NBHA 1VQKZ 1ZH1A 2JA8I 3S1QI 5IT9f 4NBEA 1YUKA 3RZOI 3J7A4 2LFUA 4BY1I 3MONA 3HKZA 4NB9A 1Q821 4DK1A 3CCLZ 3EERA 3CCJZ 3TE5B 1R9TI 1Z02A 1YJ9Z 1Q811 1VQ7Z 2AKLA 4HGYA 4RVFA 1KC81 5T64A 4NBCA 3NH5A 2O53A 1YITZ 2Q4ZA 2GTHA 1KQSY 1YI21 2I3CA 2PM9A 2W04A 4DGLA 1K9M1 3NH4A 1Y1WI 3CCE1 2JA5I 2Q51A 3CCV1 1KC82 1JJ2Z 3G71Z 4A3DI 4MONA 2VUMI 1TWFI 2V8JA 2JA7I 1SFOI 3OW2Z 1YJW1 2WB1A 3HOUI 4BXXI 1YHQ1 2OTJZ 3I56Z 1VQ51 3HOWI 1K732 3ESWA 3CCR1 2QA4Z 3CC41 3MZLB 2R93I 2E9HA 3JAMf 2G2KA 3VB9A 3IFUA 3CC21 1PFTA 3QWUA 4XX2A 3VMGA 1K9M2 4RVDA 2QR1B 4RVHA 2IZ4A 2OTLZ 1I3QI 3VMHA 1Q812 1VQK1 1VQ5Z 1NUIA 3S14I 3S1NI 3S2HI 3S1RI 1YJ91 4A3FI 4NH1C 2RPRA 1VQ71 1QF8A 5IP7I 1KRLA 3CQZI 4CL1A 3H0GI 1I50I 3I07A 1M902 3GTQI 5A2Qf 3G6E1 3M3YI 1M1K2 2ZAEB 1VQ9Z 4BY7I 3GTLI 1YHQZ 5C4XI 2OTJ1 3EEDA 4E32A 2J6AA 3GTMS 4BBRI 3BG0B 3VMIA 4NBBA 3CMEZ 1Q861 2KPIA 1N8R2 3GTJI 3S15I 4HH4A 1P9NA 3IX0A 2HF1A 2QREB 3CCRZ 2QA41 2BJOA 2YU9I 3CC7Z 2JNYA 2KI7B 1USPB 4HGZA 2P3YA 1VQOZ 1NP6A 3CCQZ 2NVYI 4E2WA 3I551 3G4S1 2E2II 4A93I 3NDIA 3CCS1 4MD8A 3RZDI 1USPA 1M1K1 2QEX1 2K3RA 1K83I 1K8A2 3F3FC 4E2XA 2M6NA 3P5JB 2RT9A 2QKDA 1YIJZ 3S1MI 3CPWY 1VQ4Z 3TDHB 2JR6A 4Y7NI 1VQ91 1RO4A 3J80b 3G6EZ 3CXCY 1RQFA 2F4MA 3U50C 3JAMb 4E31A 2VF1A 3GTMI 1S721 4S1TA 1L1OC 3D9XA 2K5RA 1M901 1YJNZ 3CCVZ 1K8A1 3BG1B 1YUAA 1VQL1 1Y1VI 3G711 3CCEZ 1W2BZ 3CCMZ 1VQNZ 1VQPZ 1VQM1 2DE7A 2P28A 2LIYA 3K7AI 2EGTA 1VLAA 2QLVB 5D1OA 3CMA1 3CC2Z 2V8IA 1QVGZ 4RS4A 2JS4A 2DE5A 2YADA 3HOYI 1Q7Y1 4NBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ Z;  1KQS Z;  1N8R 2;  1YJ9 Z;  1Q81 1;  1VQ7 Z;  2OTL 1;  3OW2 Y;  1KC8 1;  1KD1 1;  1VQ4 1;  2QEX Z;  3CCR Z;  2QA4 1;  1YIT Z;  3CD6 1;  1Q7Y 2;  1JJ2 Y;  1KD1 2;  1KQS Y;  1YI2 1;  3CC7 Z;  1YJN 1;  1QVF Z;  1K9M 1;  3CCE 1;  3CCJ 1;  1VQO Z;  3CCV 1;  3CCQ Z;  1K73 1;  1KC8 2;  1JJ2 Z;  3CPW Z;  3G71 Z;  3I55 1;  3G4S 1;  1S72 Z;  3CCL 1;  3CMA Z;  3OW2 Z;  1N8R 1;  1YJW 1;  1VQL Z;  1Q82 2;  1VQM Z;  3CXC Z;  3CCS 1;  1YHQ 1;  3CME 1;  1VQ6 1;  2OTJ Z;  3I56 Z;  1VQ5 1;  1M1K 1;  1K73 2;  1QVG Y;  2QEX 1;  3CCR 1;  2QA4 Z;  1YIT 1;  3CC4 1;  1K8A 2;  3CCU Z;  1VQN 1;  1VQP 1;  3CC2 1;  1YIJ Z;  1YI2 Z;  3CPW Y;  3CC7 1;  1NJI 1;  1K9M 2;  1VQ4 Z;  1W2B Y;  1VQ9 1;  3CCM 1;  1QVF Y;  1NJI 2;  2OTL Z;  3G6E Z;  3CXC Y;  1Q81 2;  3CD6 Z;  1VQ6 Z;  1VQK 1;  1VQ5 Z;  1VQO 1;  1Q86 2;  1VQ8 1;  3CCU 1;  1YJ9 1;  1S72 1;  1VQ7 1;  1M90 1;  1YJN Z;  3CCV Z;  1K8A 1;  1VQL 1;  3CC4 Z;  3G71 1;  3CCE Z;  1W2B Z;  3CCM Z;  1VQN Z;  1VQP Z;  1M90 2;  3I56 1;  1YJW Z;  3G6E 1;  1M1K 2;  1VQM 1;  3G4S Z;  1VQK Z;  1VQ9 Z;  3CCS Z;  1VQ8 Z;  1YHQ Z;  3CMA 1;  2OTJ 1;  3CC2 Z;  1YIJ 1;  1QVG Z;  3CCQ 1;  1Q82 1;  1Q7Y 1;  3I55 Z;  3CME Z;  1Q86 1;  3CCL Z; 
#chains in the Genus database with same CATH topology
 1Z01 A;  3VTN A;  3H3V J;  1KQS Z;  3GCF A;  3PO2 I;  4NOZ A;  2H85 A;  1FDO A;  3KIF A;  2QEX Z;  1TWH I;  2NVX I;  5FLM I;  1KD1 2;  2E2J I;  2W03 A;  4E2Y A;  2O4H A;  3M4O I;  3FKI I;  2R7Z I;  2GTI A;  3CPW Z;  2VPZ A;  3S16 I;  4MXU A;  4MD9 A;  1N8R 1;  4A3K I;  1Z03 A;  1ZB8 A;  1WII A;  3CXC Z;  1X0T A;  1VQ6 1;  2NVT I;  3KIH A;  1SIW A;  3GKQ A;  3LUS A;  4A3B I;  1RLY A;  1ML8 A;  3GTG I;  1QVG Y;  1YIT 1;  5C44 I;  2RIQ A;  1LQL A;  2HU9 A;  4NB8 A;  4X6A I;  1VQN 1;  5C3E I;  3HOV I;  5C4J I;  2JIQ A;  3CCM 1;  1NJI 2;  4A3I I;  3I4N I;  2OOY B;  2DE6 A;  3CD6 Z;  1VQ6 Z;  1TFI A;  3S17 I;  5AN9 F;  3F3P C;  5D1P A;  4NFR A;  1WCM I;  4E2Z A;  5IT9 b;  3CCU 1;  5T6B A;  2V45 A;  2JIR A;  3HOX I;  2PMZ A;  1TWA I;  2OZK A;  3CC4 Z;  2M48 A;  2R6M A;  5IP9 I;  4QTT A;  2GU2 A;  3I56 1;  1Y1V S;  1YJW Z;  3S2D I;  1DL6 A;  4Y52 I;  1RO2 A;  4NBA A;  3G4S Z;  4DQY B;  3PO3 S;  3CCS Z;  1VQ8 Z;  1YIJ 1;  3J81 b;  3CCQ 1;  3GTK I;  2VUG A;  3I55 Z;  1N2F A;  3D6W A;  3I4M I;  3FQM A;  5A2Q b;  3GTO I;  4E30 A;  2OTL 1;  3OW2 Y;  3HOZ I;  1KD1 1;  1WZN A;  4EWC A;  3IF8 A;  1QXF A;  2NVQ I;  1VQ4 1;  3Q87 A;  1S7M A;  1WW9 A;  4NBD A;  5FLX b;  3CD6 1;  1TWG I;  1Q7Y 2;  1JJ2 Y;  2E7Z A;  3J81 f;  4MRI A;  1YJN 1;  1QVF Z;  1Q16 A;  3CCJ 1;  2V8K A;  4AYB A;  1K73 1;  3PO3 I;  2JUB A;  4MH4 A;  4A3M I;  1S72 Z;  3CCL 1;  1ZB9 A;  4NBG A;  3CMA Z;  5CM2 M;  1VQL Z;  2LEX A;  1Q82 2;  1VQM Z;  2OOX B;  1FDI A;  3GTP I;  3CME 1;  3MZK B;  3J80 f;  2QRC B;  2IV2 X;  5LL6 f;  1RO0 A;  1AA6 A;  4MD7 A;  3CCU Z;  2B63 I;  3T4N B;  1TWC I;  1VQP 1;  4A3J I;  2WAQ A;  2RBL A;  1YI2 Z;  3CC7 1;  1NJI 1;  2JA6 I;  1JWH C;  1X3Z A;  3NFZ A;  1W2B Y;  4A3E I;  2PK7 A;  1QYP A;  4A3L I;  1QVF Y;  3NH8 A;  3FQQ A;  4A3C I;  2E2H I;  1I6H I;  1RNI A;  2QRD B;  4BBS I;  2VPY A;  3NDJ A;  1VQO 1;  1Q86 2;  1VQ8 1;  2F4O A;  5FLX f;  4TNU A;  2IZ3 A;  2Y0S A;  4RV9 A;  4A3G I;  2RHB A;  5T67 A;  2R92 I;  4E33 A;  1X3W A;  2JMO A;  4RVG A;  4QTU A;  5D1O B;  4NBH A;  1VQK Z;  1ZH1 A;  2JA8 I;  3S1Q I;  5IT9 f;  4NBE A;  1YUK A;  3RZO I;  3J7A 4;  2LFU A;  4BY1 I;  3MON A;  3HKZ A;  4NB9 A;  1Q82 1;  4DK1 A;  3CCL Z;  3EER A;  3CCJ Z;  3TE5 B;  1R9T I;  1Z02 A;  1YJ9 Z;  1Q81 1;  1VQ7 Z;  2AKL A;  4HGY A;  4RVF A;  1KC8 1;  5T64 A;  4NBC A;  3NH5 A;  2O53 A;  1YIT Z;  2Q4Z A;  2GTH A;  1KQS Y;  1YI2 1;  2I3C A;  2PM9 A;  2W04 A;  4DGL A;  1K9M 1;  3NH4 A;  1Y1W I;  3CCE 1;  2JA5 I;  2Q51 A;  3CCV 1;  2JIO A;  1KC8 2;  1JJ2 Z;  3D2L A;  3G71 Z;  4A3D I;  4MON A;  2VUM I;  1TWF I;  2V8J A;  2JA7 I;  1SFO I;  3OW2 Z;  1YJW 1;  2WB1 A;  3HOU I;  2VPW A;  4BXX I;  1YHQ 1;  2OTJ Z;  3I56 Z;  1VQ5 1;  2AYD A;  3HOW I;  2JIM A;  1K73 2;  3ESW A;  2QA4 Z;  3CCR 1;  3CC4 1;  3MZL B;  2R93 I;  2E9H A;  3JAM f;  2G2K A;  3VB9 A;  3IFU A;  3CC2 1;  1PFT A;  3QWU A;  4XX2 A;  3VMG A;  1K9M 2;  4RVD A;  2QR1 B;  4RVH A;  2IZ4 A;  2OTL Z;  1I3Q I;  3VMH A;  1Q81 2;  2VPX A;  1VQK 1;  1VQ5 Z;  1NUI A;  3S14 I;  2V3V A;  3S1N I;  3S2H I;  3S1R I;  1YJ9 1;  4A3F I;  4NH1 C;  2RPR A;  1VQ7 1;  1Y8C A;  1QF8 A;  5IP7 I;  1KRL A;  3CQZ I;  4CL1 A;  3H0G I;  1I50 I;  3I07 A;  1M90 2;  3GTQ I;  5A2Q f;  3G6E 1;  3M3Y I;  1M1K 2;  2ZAE B;  1VQ9 Z;  4BY7 I;  3GTL I;  1YHQ Z;  5C4X I;  2OTJ 1;  3EED A;  4E32 A;  2J6A A;  3GTM S;  4BBR I;  3BG0 B;  3VMI A;  4NBB A;  3CME Z;  1Q86 1;  2KPI A;  1N8R 2;  3GTJ I;  3S15 I;  4HH4 A;  1P9N A;  3IX0 A;  2HF1 A;  2QRE B;  3CCR Z;  2QA4 1;  3IR7 A;  2BJO A;  2YU9 I;  2JIP A;  3CC7 Z;  2JNY A;  2KI7 B;  1USP B;  4HGZ A;  2P3Y A;  1VQO Z;  1NP6 A;  3CCQ Z;  2NVY I;  4E2W A;  3I55 1;  3G4S 1;  2E2I I;  4A93 I;  3NDI A;  3CCS 1;  4MD8 A;  3RZD I;  1USP A;  1M1K 1;  2QEX 1;  2K3R A;  2NAP A;  1K83 I;  1K8A 2;  3F3F C;  4E2X A;  2M6N A;  3P5J B;  2RT9 A;  2QKD A;  1YIJ Z;  3S1M I;  3CPW Y;  1VQ4 Z;  3TDH B;  2JR6 A;  4Y7N I;  1VQ9 1;  1RO4 A;  3J80 b;  3G6E Z;  3CXC Y;  1RQF A;  2F4M A;  3U50 C;  3JAM b;  4E31 A;  2VF1 A;  3GTM I;  1S72 1;  4S1T A;  1L1O C;  3D9X A;  2K5R A;  1M90 1;  1YJN Z;  3CCV Z;  1K8A 1;  3BG1 B;  1YUA A;  1VQL 1;  1Y1V I;  3G71 1;  3CCE Z;  1W2B Z;  3CCM Z;  1VQN Z;  1VQP Z;  1WJ2 A;  1VQM 1;  2DE7 A;  2P28 A;  2LIY A;  3K7A I;  2EGT A;  1VLA A;  2QLV B;  5D1O A;  3CMA 1;  3CC2 Z;  2V8I A;  1QVG Z;  4RS4 A;  2JS4 A;  2DE5 A;  2YAD A;  3HOY I;  1Q7Y 1;  4NBF A; 
#chains in the Genus database with same CATH homology
 1Z01 A;  3VTN A;  3H3V J;  1KQS Z;  3GCF A;  3PO2 I;  4NOZ A;  2H85 A;  3KIF A;  2QEX Z;  1TWH I;  2NVX I;  5FLM I;  1KD1 2;  2E2J I;  2W03 A;  4E2Y A;  2O4H A;  3M4O I;  3FKI I;  2R7Z I;  2GTI A;  3CPW Z;  3S16 I;  4MXU A;  4MD9 A;  1N8R 1;  4A3K I;  1Z03 A;  1ZB8 A;  1WII A;  3CXC Z;  1X0T A;  1VQ6 1;  2NVT I;  3KIH A;  3GKQ A;  3LUS A;  4A3B I;  1RLY A;  1ML8 A;  3GTG I;  1QVG Y;  1YIT 1;  5C44 I;  2RIQ A;  1LQL A;  2HU9 A;  4NB8 A;  4X6A I;  1VQN 1;  5C3E I;  3HOV I;  5C4J I;  3CCM 1;  1NJI 2;  4A3I I;  3I4N I;  2OOY B;  2DE6 A;  3CD6 Z;  1VQ6 Z;  1TFI A;  3S17 I;  5AN9 F;  3F3P C;  5D1P A;  4NFR A;  1WCM I;  4E2Z A;  5IT9 b;  3CCU 1;  5T6B A;  3HOX I;  2PMZ A;  1TWA I;  2OZK A;  3CC4 Z;  2M48 A;  2R6M A;  5IP9 I;  4QTT A;  2GU2 A;  3I56 1;  1Y1V S;  1YJW Z;  3S2D I;  1DL6 A;  4Y52 I;  1RO2 A;  4NBA A;  3G4S Z;  4DQY B;  3PO3 S;  3CCS Z;  1VQ8 Z;  1YIJ 1;  3J81 b;  3CCQ 1;  3GTK I;  2VUG A;  3I55 Z;  1N2F A;  3D6W A;  3I4M I;  3FQM A;  5A2Q b;  3GTO I;  4E30 A;  2OTL 1;  3OW2 Y;  3HOZ I;  1KD1 1;  3IF8 A;  4EWC A;  2NVQ I;  1VQ4 1;  3Q87 A;  1S7M A;  1WW9 A;  4NBD A;  5FLX b;  3CD6 1;  1TWG I;  1Q7Y 2;  1JJ2 Y;  3J81 f;  4MRI A;  1YJN 1;  1QVF Z;  3CCJ 1;  2V8K A;  4AYB A;  1K73 1;  3PO3 I;  2JUB A;  4MH4 A;  4A3M I;  1S72 Z;  3CCL 1;  1ZB9 A;  4NBG A;  3CMA Z;  5CM2 M;  1VQL Z;  1Q82 2;  1VQM Z;  2OOX B;  3GTP I;  3CME 1;  3MZK B;  3J80 f;  2QRC B;  5LL6 f;  1RO0 A;  4MD7 A;  3CCU Z;  2B63 I;  3T4N B;  1TWC I;  1VQP 1;  4A3J I;  2WAQ A;  2RBL A;  1YI2 Z;  3CC7 1;  1NJI 1;  2JA6 I;  1JWH C;  1X3Z A;  3NFZ A;  1W2B Y;  4A3E I;  2PK7 A;  1QYP A;  4A3L I;  1QVF Y;  3NH8 A;  3FQQ A;  4A3C I;  2E2H I;  1I6H I;  1RNI A;  2QRD B;  4BBS I;  3NDJ A;  1VQO 1;  1Q86 2;  1VQ8 1;  2F4O A;  5FLX f;  4TNU A;  2IZ3 A;  2Y0S A;  4RV9 A;  4A3G I;  2RHB A;  5T67 A;  2R92 I;  4E33 A;  1X3W A;  2JMO A;  4RVG A;  4QTU A;  5D1O B;  4NBH A;  1VQK Z;  1ZH1 A;  2JA8 I;  3S1Q I;  5IT9 f;  4NBE A;  1YUK A;  3RZO I;  3J7A 4;  2LFU A;  4BY1 I;  3MON A;  3HKZ A;  4NB9 A;  1Q82 1;  4DK1 A;  3CCL Z;  3EER A;  3CCJ Z;  3TE5 B;  1R9T I;  1Z02 A;  1YJ9 Z;  1Q81 1;  1VQ7 Z;  2AKL A;  4HGY A;  4RVF A;  1KC8 1;  5T64 A;  4NBC A;  3NH5 A;  2O53 A;  1YIT Z;  2Q4Z A;  2GTH A;  1KQS Y;  1YI2 1;  2I3C A;  2PM9 A;  2W04 A;  4DGL A;  1K9M 1;  3NH4 A;  1Y1W I;  3CCE 1;  2JA5 I;  2Q51 A;  3CCV 1;  1KC8 2;  1JJ2 Z;  3G71 Z;  4A3D I;  4MON A;  2VUM I;  1TWF I;  2V8J A;  2JA7 I;  1SFO I;  3OW2 Z;  1YJW 1;  2WB1 A;  3HOU I;  4BXX I;  1YHQ 1;  2OTJ Z;  3I56 Z;  1VQ5 1;  3HOW I;  1K73 2;  3ESW A;  3CCR 1;  2QA4 Z;  3CC4 1;  3MZL B;  2R93 I;  2E9H A;  3JAM f;  2G2K A;  3VB9 A;  3IFU A;  3CC2 1;  1PFT A;  3QWU A;  4XX2 A;  3VMG A;  1K9M 2;  4RVD A;  2QR1 B;  4RVH A;  2IZ4 A;  2OTL Z;  1I3Q I;  3VMH A;  1Q81 2;  1VQK 1;  1VQ5 Z;  1NUI A;  3S14 I;  3S1N I;  3S2H I;  3S1R I;  1YJ9 1;  4A3F I;  4NH1 C;  2RPR A;  1VQ7 1;  1QF8 A;  5IP7 I;  1KRL A;  3CQZ I;  4CL1 A;  3H0G I;  1I50 I;  3I07 A;  1M90 2;  3GTQ I;  5A2Q f;  3G6E 1;  3M3Y I;  1M1K 2;  2ZAE B;  1VQ9 Z;  4BY7 I;  3GTL I;  1YHQ Z;  5C4X I;  2OTJ 1;  3EED A;  4E32 A;  2J6A A;  3GTM S;  4BBR I;  3BG0 B;  3VMI A;  4NBB A;  3CME Z;  1Q86 1;  2KPI A;  1N8R 2;  3GTJ I;  3S15 I;  4HH4 A;  1P9N A;  3IX0 A;  2HF1 A;  2QRE B;  3CCR Z;  2QA4 1;  2BJO A;  2YU9 I;  3CC7 Z;  2JNY A;  2KI7 B;  1USP B;  4HGZ A;  2P3Y A;  1VQO Z;  1NP6 A;  3CCQ Z;  2NVY I;  4E2W A;  3I55 1;  3G4S 1;  2E2I I;  4A93 I;  3NDI A;  3CCS 1;  4MD8 A;  3RZD I;  1USP A;  1M1K 1;  2QEX 1;  2K3R A;  1K83 I;  1K8A 2;  3F3F C;  4E2X A;  2M6N A;  3P5J B;  2RT9 A;  2QKD A;  1YIJ Z;  3S1M I;  3CPW Y;  1VQ4 Z;  3TDH B;  2JR6 A;  4Y7N I;  1VQ9 1;  1RO4 A;  3J80 b;  3G6E Z;  3CXC Y;  1RQF A;  2F4M A;  3U50 C;  3JAM b;  4E31 A;  2VF1 A;  3GTM I;  1S72 1;  4S1T A;  1L1O C;  3D9X A;  2K5R A;  1M90 1;  1YJN Z;  3CCV Z;  1K8A 1;  3BG1 B;  1YUA A;  1VQL 1;  1Y1V I;  3G71 1;  3CCE Z;  1W2B Z;  3CCM Z;  1VQN Z;  1VQP Z;  1VQM 1;  2DE7 A;  2P28 A;  2LIY A;  3K7A I;  2EGT A;  1VLA A;  2QLV B;  5D1O A;  3CMA 1;  3CC2 Z;  2V8I A;  1QVG Z;  4RS4 A;  2JS4 A;  2DE5 A;  2YAD A;  3HOY I;  1Q7Y 1;  4NBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...