1VQ6Z

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq6Z00
1YJ9Z 1KC81 1VQKZ 1YHQZ 2QEXZ 1Q812 2QA4Z 1W2BZ 1YIT1 1M901 2OTL1 3I551 3G4SZ 1QVGY 1KC82 1VQ91 1S72Z 1W2BY 3CC41 1VQM1 1JJ2Y 2OTJ1 1NJI2 1VQO1 1VQ7Z 3CCM1 3CCJ1 3CCL1 3CCQ1 3CCEZ 1VQLZ 1Q862 1QVGZ 3CPWZ 1VQ4Z 1YJNZ 1K732 1VQ81 1JJ2Z 3CPWY 1NJI1 3CME1 1YITZ 2OTLZ 1YIJ1 1M1K2 1VQ51 1VQ9Z 1YJ91 1YI21 1KQSY 1VQN1 1Q861 3CC2Z 1VQMZ 3CCRZ 2OTJZ 3CXCZ 1K731 3G4S1 3CCUZ 1YJW1 1VQOZ 3G711 3CD61 3CCMZ 3G6EZ 3CXCY 3CC71 1M1K1 3CMAZ 3CCS1 1QVFY 3CCQZ 1VQ61 3I561 1K8A2 1KQSZ 1VQP1 3CCV1 1VQ8Z 3I55Z 1N8R2 3CMEZ 1VQK1 1YHQ1 1YIJZ 2QEX1 3CC4Z 1VQ5Z 2QA41 1YI2Z 1K9M2 1KD12 1VQNZ 1QVFZ 3OW2Y 1Q7Y2 1K8A1 1S721 1YJWZ 3CCJZ 3CCLZ 1N8R1 3G71Z 3CD6Z 3CC7Z 3CC21 1Q821 3CCSZ 1M902 3CCR1 1K9M1 1VQ71 1VQ6Z 1KD11 3CCU1 3I56Z 3CCE1 1Q811 1Q7Y1 1VQL1 1VQPZ 3CCVZ 3G6E1 3OW2Z 1VQ41 1Q822 3CMA1 1YJN1
chains in the Genus database with same CATH superfamily
4BXXI 3HOWI 4NB9A 1KC81 4RS4A 2DE6A 1RO0A 3GTMS 4E2WA 2W04A 2QA4Z 1L1OC 2P3YA 1QVGY 1P9NA 1RQFA 3H0GI 4QTUA 1W2BY 1JJ2Y 3S1QI 4NBAA 3D9XA 5D1OB 3PO3S 3IX0A 2QR1B 4NBHA 2NVTI 2JR6A 4A3EI 3M4OI 2M48A 1VQ81 1RO2A 1USPB 2GU2A 3CPWY 1NJI1 1YITZ 2NVQI 1M1K2 3HOZI 1YJ91 1Q861 3CC2Z 3S16I 3D2LA 2VPZA 3CCUZ 1YJW1 3MZLB 1VQOZ 3CCMZ 3CXCY 3CC71 3S2DI 3CMAZ 3CCS1 2JMOA 3S14I 2RT9A 1N2FA 4BBSI 1VQ61 4MH4A 2JNYA 3I561 4E2ZA 1K8A2 4NOZA 4E32A 2JA6I 2HF1A 2R6MA 3CMEZ 5D1PA 1YHQ1 2RPRA 2LFUA 3CC4Z 1K9M2 3HKZA 1RO4A 1QVFZ 2JUBA 4CL1A 2OZKA 2WAQA 2IZ4A 1ML8A 1X0TA 4Y52I 2V3VA 1NUIA 1R9TI 1M902 3IF8A 2NAPA 4NH1C 4MD8A 5D1OA 2QREB 5T64A 3CCE1 2E7ZA 1I6HI 1VQ41 1WIIA 2E2JI 5A2Qb 1VQKZ 2EGTA 2QLVB 5T6BA 3QWUA 1W2BZ 2OTL1 3S15I 3PO2I 2JA5I 2Q51A 3I551 3G4SZ 3S1RI 2P28A 2PM9A 3H3VJ 1QYPA 1QXFA 1RNIA 4DK1A 3S1NI 4MRIA 1AA6A 3GTKI 4A3CI 1X3WA 2DE5A 2M6NA 2J6AA 4EWCA 1VQ7Z 3NDIA 3CCL1 1ZH1A 2JS4A 2R92I 1VQLZ 3CPWZ 2AKLA 2NVYI 3MONA 1YJNZ 4E30A 3NH4A 1K732 4BY7I 2E9HA 1Z02A 3VMIA 2Y0SA 2LIYA 2WB1A 4RV9A 1YIJ1 1VQ51 1YUKA 1YI21 4TNUA 2I3CA 2RBLA 5T67A 2O4HA 3CXCZ 2H85A 2R93I 4NBEA 1PFTA 2JA8I 4BY1I 2JA7I 1KRLA 5FLMI 3G6EZ 2VUMI 3RZDI 1TWHI 3T4NB 1TFIA 1WJ2A 3K7AI 3IFUA 1KQSZ 1VQP1 3CCV1 1VQ8Z 1N8R2 3HOUI 3GTGI 2O53A 2QEX1 4E2XA 3HOXI 1SFOI 1KD12 1FDIA 5IP7I 3OW2Y 2BJOA 1S721 4X6AI 3EEDA 2IV2X 1YJWZ 3CCJZ 2V8IA 4DQYB 2VPYA 3CC7Z 3CC21 4HH4A 2JIMA 3CCSZ 2ZAEB 3EERA 1VQ6Z 5A2Qf 3CCU1 3I56Z 1Q7Y1 3VB9A 3P5JB 4A3BI 4HGZA 1Q822 3CMA1 3J80b 4QTTA 2NVXI 1YHQZ 3FQQA 2V8KA 3GTLI 1Q812 5IT9f 2KI7B 4Y7NI 4NB8A 3S2HI 1RLYA 1FDOA 2DE7A 1Y1VI 4NBGA 1VQ91 3D6WA 3CC41 1VQM1 4DGLA 3M3YI 2OTJ1 4A93I 3FQMA 3GTMI 1NJI2 2VPXA 1K83I 1X3ZA 2GTHA 1Z01A 3CCQ1 3CCEZ 1WW9A 2VUGA 4NBCA 2F4MA 1Q862 1QVGZ 1VQ4Z 2RIQA 3BG0B 1USPA 1ZB9A 3GKQA 4A3MI 1JJ2Z 5C3EI 4NBFA 3PO3I 2OTLZ 5IT9b 1TWCI 3TDHB 2PMZA 5C4JI 1VQN1 2VF1A 2F4OA 2YADA 3CQZI 3VMHA 3CCRZ 2E2HI 4A3LI 3I07A 3VMGA 1Q16A 3G4S1 1I50I 3NFZA 2LEXA 3J7A4 3G711 3CD61 3ESWA 5AN9F 1M1K1 2V45A 1QVFY 3MZKB 3KIFA 2GTIA 3JAMf 3GTPI 1Y1VS 4A3DI 2VPWA 4RVGA 4A3GI 1YIJZ 1VQ5Z 2QKDA 4E33A 2JIOA 2QA41 1YI2Z 1NP6A 4MD9A 2B63I 1QF8A 1K8A1 1WZNA 4RVFA 3NDJA 2PK7A 4AYBA 2AYDA 1Q821 5FLXb 4A3KI 3VTNA 1ZB8A 1K9M1 2IZ3A 3J80f 1S7MA 1Q811 1Y8CA 2V8JA 3JAMb 3NH5A 1VQPZ 3CCVZ 3G6E1 3GTQI 3J81f 3I4MI 3F3PC 1YJ9Z 3GTOI 2QEXZ 5C44I 2QRCB 3IR7A 1YIT1 1M901 4RVDA 1TWGI 1KC82 4BBRI 3NH8A 1S72Z 2OOXB 4RVHA 1YUAA 4A3JI 2Q4ZA 2KPIA 1VQO1 2G2KA 3CCM1 2K3RA 3F3FC 3CCJ1 3TE5B 4E31A 2HU9A 3HOYI 3KIHA 4A3II 3J81b 3CME1 4E2YA 5CM2M 4XX2A 1LQLA 2QRDB 3BG1B 4NBDA 1TWAI 1DL6A 3Q87A 1VQ9Z 1JWHC 1KQSY 1VQMZ 2W03A 3I4NI 2OTJZ 3S1MI 1K731 3RZOI 1Z03A 1TWFI 2RHBA 2E2II 4HGYA 2JIRA 4MONA 3HOVI 3S17I 4MD7A 5C4XI 3U50C 3GTJI 3CCQZ 3GCFA 2JIQA 2R7ZI 4NFRA 3I55Z 1VQK1 5IP9I 1SIWA 1VQNZ 3LUSA 3FKII 1Y1WI 1Q7Y2 1I3QI 1VLAA 2K5RA 4A3FI 2YU9I 5FLXf 3CCLZ 1N8R1 4S1TA 2OOYB 3G71Z 3CD6Z 2JIPA 3CCR1 4NBBA 1VQ71 1KD11 4MXUA 1WCMI 1VQL1 3OW2Z 1YJN1 5LL6f
chains in the Genus database with same CATH topology
4BXXI 3HOWI 4NB9A 1KC81 4RS4A 2DE6A 1RO0A 3GTMS 4E2WA 2W04A 2QA4Z 1L1OC 2P3YA 1QVGY 1P9NA 1RQFA 3H0GI 4QTUA 1W2BY 1JJ2Y 3S1QI 4NBAA 3D9XA 5D1OB 3PO3S 3IX0A 2QR1B 4NBHA 2NVTI 2JR6A 4A3EI 3M4OI 2M48A 1VQ81 1RO2A 1USPB 2GU2A 3CPWY 1NJI1 1YITZ 2NVQI 1M1K2 3HOZI 1YJ91 1Q861 3CC2Z 3S16I 3CCUZ 1YJW1 3MZLB 1VQOZ 3CCMZ 3CXCY 3CC71 3S2DI 3CMAZ 3CCS1 2JMOA 3S14I 2RT9A 1N2FA 4BBSI 1VQ61 4MH4A 2JNYA 3I561 4E2ZA 1K8A2 4NOZA 4E32A 2JA6I 2HF1A 2R6MA 3CMEZ 5D1PA 1YHQ1 2RPRA 2LFUA 3CC4Z 1K9M2 3HKZA 1RO4A 1QVFZ 2JUBA 4CL1A 2OZKA 2WAQA 2IZ4A 1ML8A 1X0TA 4Y52I 1NUIA 1R9TI 1M902 3IF8A 4NH1C 5D1OA 4MD8A 2QREB 5T64A 3CCE1 1I6HI 1VQ41 1WIIA 2E2JI 5A2Qb 1VQKZ 2EGTA 2QLVB 5T6BA 3QWUA 1W2BZ 2OTL1 3S15I 3PO2I 2JA5I 2Q51A 3I551 3G4SZ 3S1RI 2P28A 2PM9A 3H3VJ 1QYPA 1RNIA 4DK1A 3S1NI 4MRIA 3GTKI 4A3CI 1X3WA 2DE5A 2M6NA 2J6AA 4EWCA 1VQ7Z 3NDIA 3CCL1 1ZH1A 2JS4A 2R92I 1VQLZ 3CPWZ 2AKLA 2NVYI 3MONA 1YJNZ 4E30A 3NH4A 1K732 4BY7I 2E9HA 1Z02A 3VMIA 2Y0SA 2LIYA 2WB1A 4RV9A 1YIJ1 1VQ51 1YUKA 1YI21 4TNUA 2I3CA 2RBLA 5T67A 2O4HA 3CXCZ 2H85A 2R93I 4NBEA 1PFTA 2JA8I 4BY1I 2JA7I 1KRLA 5FLMI 3G6EZ 2VUMI 3RZDI 1TWHI 3T4NB 1TFIA 3K7AI 3IFUA 1KQSZ 1VQP1 3CCV1 1VQ8Z 1N8R2 3HOUI 3GTGI 2O53A 2QEX1 4E2XA 3HOXI 1SFOI 1KD12 5IP7I 3OW2Y 2BJOA 1S721 4X6AI 3EEDA 1YJWZ 3CCJZ 2V8IA 4DQYB 3CC7Z 3CC21 4HH4A 3CCSZ 2ZAEB 3EERA 1VQ6Z 5A2Qf 3CCU1 3I56Z 1Q7Y1 3VB9A 3P5JB 4A3BI 4HGZA 1Q822 3CMA1 3J80b 4QTTA 2NVXI 1YHQZ 3FQQA 2V8KA 3GTLI 1Q812 5IT9f 2KI7B 4Y7NI 4NB8A 3S2HI 1RLYA 2DE7A 1Y1VI 4NBGA 1VQ91 3D6WA 3CC41 1VQM1 4DGLA 3M3YI 2OTJ1 4A93I 3FQMA 3GTMI 1NJI2 1K83I 1X3ZA 2GTHA 1Z01A 3CCQ1 3CCEZ 1WW9A 2VUGA 4NBCA 2F4MA 1Q862 1QVGZ 1VQ4Z 2RIQA 3BG0B 1USPA 1ZB9A 3GKQA 4A3MI 1JJ2Z 5C3EI 4NBFA 3PO3I 2OTLZ 5IT9b 1TWCI 3TDHB 2PMZA 5C4JI 1VQN1 2VF1A 2F4OA 2YADA 3CQZI 3VMHA 3CCRZ 2E2HI 4A3LI 3I07A 3VMGA 3G4S1 1I50I 3NFZA 3J7A4 3G711 3CD61 3ESWA 5AN9F 1M1K1 1QVFY 3MZKB 3KIFA 2GTIA 3JAMf 3GTPI 1Y1VS 4A3DI 4RVGA 4A3GI 1YIJZ 1VQ5Z 2QKDA 4E33A 2QA41 1YI2Z 1NP6A 4MD9A 2B63I 1QF8A 1K8A1 4RVFA 3NDJA 2PK7A 4AYBA 1Q821 5FLXb 4A3KI 3VTNA 1ZB8A 1K9M1 2IZ3A 3J80f 1S7MA 1Q811 2V8JA 3JAMb 3NH5A 1VQPZ 3CCVZ 3G6E1 3GTQI 3J81f 3I4MI 3F3PC 1YJ9Z 3GTOI 2QEXZ 5C44I 2QRCB 1M901 1YIT1 4RVDA 1TWGI 1KC82 4BBRI 3NH8A 1S72Z 2OOXB 4RVHA 1YUAA 4A3JI 2Q4ZA 2KPIA 1VQO1 2G2KA 3CCM1 2K3RA 3F3FC 3CCJ1 3TE5B 4E31A 2HU9A 3HOYI 3KIHA 4A3II 3J81b 3CME1 4E2YA 5CM2M 4XX2A 1LQLA 2QRDB 3BG1B 4NBDA 1TWAI 1DL6A 3Q87A 1VQ9Z 1JWHC 1KQSY 1VQMZ 2W03A 3I4NI 2OTJZ 3S1MI 1K731 3RZOI 1Z03A 1TWFI 2RHBA 2E2II 4HGYA 4MONA 3HOVI 3S17I 4MD7A 5C4XI 3U50C 3GTJI 3CCQZ 3GCFA 2R7ZI 4NFRA 3I55Z 1VQK1 5IP9I 1VQNZ 3LUSA 3FKII 1Y1WI 1Q7Y2 1I3QI 1VLAA 2K5RA 4A3FI 2YU9I 5FLXf 3CCLZ 1N8R1 4S1TA 2OOYB 3G71Z 3CD6Z 3CCR1 4NBBA 1VQ71 1KD11 4MXUA 1WCMI 1VQL1 3OW2Z 1YJN1 5LL6f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  1KC8 1;  1VQK Z;  1YHQ Z;  2QEX Z;  1Q81 2;  2QA4 Z;  1W2B Z;  1YIT 1;  1M90 1;  2OTL 1;  3I55 1;  3G4S Z;  1QVG Y;  1KC8 2;  1VQ9 1;  1S72 Z;  1W2B Y;  3CC4 1;  1VQM 1;  1JJ2 Y;  2OTJ 1;  1NJI 2;  1VQO 1;  1VQ7 Z;  3CCM 1;  3CCJ 1;  3CCL 1;  3CCQ 1;  3CCE Z;  1VQL Z;  1Q86 2;  1QVG Z;  3CPW Z;  1VQ4 Z;  1YJN Z;  1K73 2;  1VQ8 1;  1JJ2 Z;  3CPW Y;  1NJI 1;  3CME 1;  1YIT Z;  2OTL Z;  1YIJ 1;  1M1K 2;  1VQ5 1;  1VQ9 Z;  1YJ9 1;  1YI2 1;  1KQS Y;  1VQN 1;  1Q86 1;  3CC2 Z;  1VQM Z;  3CCR Z;  2OTJ Z;  3CXC Z;  1K73 1;  3G4S 1;  3CCU Z;  1YJW 1;  1VQO Z;  3G71 1;  3CD6 1;  3CCM Z;  3G6E Z;  3CXC Y;  3CC7 1;  1M1K 1;  3CMA Z;  3CCS 1;  1QVF Y;  3CCQ Z;  1VQ6 1;  3I56 1;  1K8A 2;  1KQS Z;  1VQP 1;  3CCV 1;  1VQ8 Z;  3I55 Z;  1N8R 2;  3CME Z;  1VQK 1;  1YHQ 1;  1YIJ Z;  2QEX 1;  3CC4 Z;  1VQ5 Z;  2QA4 1;  1YI2 Z;  1K9M 2;  1KD1 2;  1VQN Z;  1QVF Z;  3OW2 Y;  1Q7Y 2;  1K8A 1;  1S72 1;  1YJW Z;  3CCJ Z;  3CCL Z;  1N8R 1;  3G71 Z;  3CD6 Z;  3CC7 Z;  3CC2 1;  1Q82 1;  3CCS Z;  1M90 2;  3CCR 1;  1K9M 1;  1VQ7 1;  1VQ6 Z;  1KD1 1;  3CCU 1;  3I56 Z;  3CCE 1;  1Q81 1;  1Q7Y 1;  1VQL 1;  1VQP Z;  3CCV Z;  3G6E 1;  3OW2 Z;  1VQ4 1;  1Q82 2;  3CMA 1;  1YJN 1; 
#chains in the Genus database with same CATH topology
 4BXX I;  3HOW I;  4NB9 A;  1KC8 1;  4RS4 A;  2DE6 A;  1RO0 A;  3GTM S;  4E2W A;  2W04 A;  2QA4 Z;  1L1O C;  2P3Y A;  1QVG Y;  1P9N A;  1RQF A;  3H0G I;  4QTU A;  1W2B Y;  1JJ2 Y;  3S1Q I;  4NBA A;  3D9X A;  5D1O B;  3PO3 S;  3IX0 A;  2QR1 B;  4NBH A;  2NVT I;  2JR6 A;  4A3E I;  3M4O I;  2M48 A;  1VQ8 1;  1RO2 A;  1USP B;  2GU2 A;  3CPW Y;  1NJI 1;  1YIT Z;  2NVQ I;  1M1K 2;  3HOZ I;  1YJ9 1;  1Q86 1;  3CC2 Z;  3S16 I;  3D2L A;  2VPZ A;  3CCU Z;  1YJW 1;  3MZL B;  1VQO Z;  3CCM Z;  3CXC Y;  3CC7 1;  3S2D I;  3CMA Z;  3CCS 1;  2JMO A;  3S14 I;  2RT9 A;  1N2F A;  4BBS I;  1VQ6 1;  4MH4 A;  2JNY A;  3I56 1;  4E2Z A;  1K8A 2;  4NOZ A;  4E32 A;  2JA6 I;  2HF1 A;  2R6M A;  3CME Z;  5D1P A;  1YHQ 1;  2RPR A;  2LFU A;  3CC4 Z;  1K9M 2;  3HKZ A;  1RO4 A;  1QVF Z;  2JUB A;  4CL1 A;  2OZK A;  2WAQ A;  2IZ4 A;  1ML8 A;  1X0T A;  4Y52 I;  2V3V A;  1NUI A;  1R9T I;  1M90 2;  3IF8 A;  2NAP A;  4NH1 C;  4MD8 A;  5D1O A;  2QRE B;  5T64 A;  3CCE 1;  2E7Z A;  1I6H I;  1VQ4 1;  1WII A;  2E2J I;  5A2Q b;  1VQK Z;  2EGT A;  2QLV B;  5T6B A;  3QWU A;  1W2B Z;  2OTL 1;  3S15 I;  3PO2 I;  2JA5 I;  2Q51 A;  3I55 1;  3G4S Z;  3S1R I;  2P28 A;  2PM9 A;  3H3V J;  1QYP A;  1QXF A;  1RNI A;  4DK1 A;  3S1N I;  4MRI A;  1AA6 A;  3GTK I;  4A3C I;  1X3W A;  2DE5 A;  2M6N A;  2J6A A;  4EWC A;  1VQ7 Z;  3NDI A;  3CCL 1;  1ZH1 A;  2JS4 A;  2R92 I;  1VQL Z;  3CPW Z;  2AKL A;  2NVY I;  3MON A;  1YJN Z;  4E30 A;  3NH4 A;  1K73 2;  4BY7 I;  2E9H A;  1Z02 A;  3VMI A;  2Y0S A;  2LIY A;  2WB1 A;  4RV9 A;  1YIJ 1;  1VQ5 1;  1YUK A;  1YI2 1;  4TNU A;  2I3C A;  2RBL A;  5T67 A;  2O4H A;  3CXC Z;  2H85 A;  2R93 I;  4NBE A;  1PFT A;  2JA8 I;  4BY1 I;  2JA7 I;  1KRL A;  5FLM I;  3G6E Z;  2VUM I;  3RZD I;  1TWH I;  3T4N B;  1TFI A;  1WJ2 A;  3K7A I;  3IFU A;  1KQS Z;  1VQP 1;  3CCV 1;  1VQ8 Z;  1N8R 2;  3HOU I;  3GTG I;  2O53 A;  2QEX 1;  4E2X A;  3HOX I;  1SFO I;  1KD1 2;  1FDI A;  5IP7 I;  3OW2 Y;  2BJO A;  1S72 1;  4X6A I;  3EED A;  2IV2 X;  1YJW Z;  3CCJ Z;  2V8I A;  4DQY B;  2VPY A;  3CC7 Z;  3CC2 1;  4HH4 A;  2JIM A;  3CCS Z;  2ZAE B;  3EER A;  1VQ6 Z;  5A2Q f;  3CCU 1;  3I56 Z;  1Q7Y 1;  3VB9 A;  3P5J B;  4A3B I;  4HGZ A;  1Q82 2;  3CMA 1;  3J80 b;  4QTT A;  2NVX I;  1YHQ Z;  3FQQ A;  2V8K A;  3GTL I;  1Q81 2;  5IT9 f;  2KI7 B;  4Y7N I;  4NB8 A;  3S2H I;  1RLY A;  1FDO A;  2DE7 A;  1Y1V I;  4NBG A;  1VQ9 1;  3D6W A;  3CC4 1;  1VQM 1;  4DGL A;  3M3Y I;  2OTJ 1;  4A93 I;  3FQM A;  3GTM I;  1NJI 2;  2VPX A;  1K83 I;  1X3Z A;  2GTH A;  1Z01 A;  3CCQ 1;  3CCE Z;  1WW9 A;  2VUG A;  4NBC A;  2F4M A;  1Q86 2;  1QVG Z;  1VQ4 Z;  2RIQ A;  3BG0 B;  1USP A;  1ZB9 A;  3GKQ A;  4A3M I;  1JJ2 Z;  5C3E I;  4NBF A;  3PO3 I;  2OTL Z;  5IT9 b;  1TWC I;  3TDH B;  2PMZ A;  5C4J I;  1VQN 1;  2VF1 A;  2F4O A;  2YAD A;  3CQZ I;  3VMH A;  3CCR Z;  2E2H I;  4A3L I;  3I07 A;  3VMG A;  1Q16 A;  3G4S 1;  1I50 I;  3NFZ A;  2LEX A;  3J7A 4;  3G71 1;  3CD6 1;  3ESW A;  5AN9 F;  1M1K 1;  2V45 A;  1QVF Y;  3MZK B;  3KIF A;  2GTI A;  3JAM f;  3GTP I;  1Y1V S;  4A3D I;  2VPW A;  4RVG A;  4A3G I;  1YIJ Z;  1VQ5 Z;  2QKD A;  4E33 A;  2JIO A;  2QA4 1;  1YI2 Z;  1NP6 A;  4MD9 A;  2B63 I;  1QF8 A;  1K8A 1;  1WZN A;  4RVF A;  3NDJ A;  2PK7 A;  4AYB A;  2AYD A;  1Q82 1;  5FLX b;  4A3K I;  3VTN A;  1ZB8 A;  1K9M 1;  2IZ3 A;  3J80 f;  1S7M A;  1Q81 1;  1Y8C A;  2V8J A;  3JAM b;  3NH5 A;  1VQP Z;  3CCV Z;  3G6E 1;  3GTQ I;  3J81 f;  3I4M I;  3F3P C;  1YJ9 Z;  3GTO I;  2QEX Z;  5C44 I;  2QRC B;  3IR7 A;  1YIT 1;  1M90 1;  4RVD A;  1TWG I;  1KC8 2;  4BBR I;  3NH8 A;  1S72 Z;  2OOX B;  4RVH A;  1YUA A;  4A3J I;  2Q4Z A;  2KPI A;  1VQO 1;  2G2K A;  3CCM 1;  2K3R A;  3F3F C;  3CCJ 1;  3TE5 B;  4E31 A;  2HU9 A;  3HOY I;  3KIH A;  4A3I I;  3J81 b;  3CME 1;  4E2Y A;  5CM2 M;  4XX2 A;  1LQL A;  2QRD B;  3BG1 B;  4NBD A;  1TWA I;  1DL6 A;  3Q87 A;  1VQ9 Z;  1JWH C;  1KQS Y;  1VQM Z;  2W03 A;  3I4N I;  2OTJ Z;  3S1M I;  1K73 1;  3RZO I;  1Z03 A;  1TWF I;  2RHB A;  2E2I I;  4HGY A;  2JIR A;  4MON A;  3HOV I;  3S17 I;  4MD7 A;  5C4X I;  3U50 C;  3GTJ I;  3CCQ Z;  3GCF A;  2JIQ A;  2R7Z I;  4NFR A;  3I55 Z;  1VQK 1;  5IP9 I;  1SIW A;  1VQN Z;  3LUS A;  3FKI I;  1Y1W I;  1Q7Y 2;  1I3Q I;  1VLA A;  2K5R A;  4A3F I;  2YU9 I;  5FLX f;  3CCL Z;  1N8R 1;  4S1T A;  2OOY B;  3G71 Z;  3CD6 Z;  2JIP A;  3CCR 1;  4NBB A;  1VQ7 1;  1KD1 1;  4MXU A;  1WCM I;  1VQL 1;  3OW2 Z;  1YJN 1;  5LL6 f; 
#chains in the Genus database with same CATH homology
 4BXX I;  3HOW I;  4NB9 A;  1KC8 1;  4RS4 A;  2DE6 A;  1RO0 A;  3GTM S;  4E2W A;  2W04 A;  2QA4 Z;  1L1O C;  2P3Y A;  1QVG Y;  1P9N A;  1RQF A;  3H0G I;  4QTU A;  1W2B Y;  1JJ2 Y;  3S1Q I;  4NBA A;  3D9X A;  5D1O B;  3PO3 S;  3IX0 A;  2QR1 B;  4NBH A;  2NVT I;  2JR6 A;  4A3E I;  3M4O I;  2M48 A;  1VQ8 1;  1RO2 A;  1USP B;  2GU2 A;  3CPW Y;  1NJI 1;  1YIT Z;  2NVQ I;  1M1K 2;  3HOZ I;  1YJ9 1;  1Q86 1;  3CC2 Z;  3S16 I;  3CCU Z;  1YJW 1;  3MZL B;  1VQO Z;  3CCM Z;  3CXC Y;  3CC7 1;  3S2D I;  3CMA Z;  3CCS 1;  2JMO A;  3S14 I;  2RT9 A;  1N2F A;  4BBS I;  1VQ6 1;  4MH4 A;  2JNY A;  3I56 1;  4E2Z A;  1K8A 2;  4NOZ A;  4E32 A;  2JA6 I;  2HF1 A;  2R6M A;  3CME Z;  5D1P A;  1YHQ 1;  2RPR A;  2LFU A;  3CC4 Z;  1K9M 2;  3HKZ A;  1RO4 A;  1QVF Z;  2JUB A;  4CL1 A;  2OZK A;  2WAQ A;  2IZ4 A;  1ML8 A;  1X0T A;  4Y52 I;  1NUI A;  1R9T I;  1M90 2;  3IF8 A;  4NH1 C;  5D1O A;  4MD8 A;  2QRE B;  5T64 A;  3CCE 1;  1I6H I;  1VQ4 1;  1WII A;  2E2J I;  5A2Q b;  1VQK Z;  2EGT A;  2QLV B;  5T6B A;  3QWU A;  1W2B Z;  2OTL 1;  3S15 I;  3PO2 I;  2JA5 I;  2Q51 A;  3I55 1;  3G4S Z;  3S1R I;  2P28 A;  2PM9 A;  3H3V J;  1QYP A;  1RNI A;  4DK1 A;  3S1N I;  4MRI A;  3GTK I;  4A3C I;  1X3W A;  2DE5 A;  2M6N A;  2J6A A;  4EWC A;  1VQ7 Z;  3NDI A;  3CCL 1;  1ZH1 A;  2JS4 A;  2R92 I;  1VQL Z;  3CPW Z;  2AKL A;  2NVY I;  3MON A;  1YJN Z;  4E30 A;  3NH4 A;  1K73 2;  4BY7 I;  2E9H A;  1Z02 A;  3VMI A;  2Y0S A;  2LIY A;  2WB1 A;  4RV9 A;  1YIJ 1;  1VQ5 1;  1YUK A;  1YI2 1;  4TNU A;  2I3C A;  2RBL A;  5T67 A;  2O4H A;  3CXC Z;  2H85 A;  2R93 I;  4NBE A;  1PFT A;  2JA8 I;  4BY1 I;  2JA7 I;  1KRL A;  5FLM I;  3G6E Z;  2VUM I;  3RZD I;  1TWH I;  3T4N B;  1TFI A;  3K7A I;  3IFU A;  1KQS Z;  1VQP 1;  3CCV 1;  1VQ8 Z;  1N8R 2;  3HOU I;  3GTG I;  2O53 A;  2QEX 1;  4E2X A;  3HOX I;  1SFO I;  1KD1 2;  5IP7 I;  3OW2 Y;  2BJO A;  1S72 1;  4X6A I;  3EED A;  1YJW Z;  3CCJ Z;  2V8I A;  4DQY B;  3CC7 Z;  3CC2 1;  4HH4 A;  3CCS Z;  2ZAE B;  3EER A;  1VQ6 Z;  5A2Q f;  3CCU 1;  3I56 Z;  1Q7Y 1;  3VB9 A;  3P5J B;  4A3B I;  4HGZ A;  1Q82 2;  3CMA 1;  3J80 b;  4QTT A;  2NVX I;  1YHQ Z;  3FQQ A;  2V8K A;  3GTL I;  1Q81 2;  5IT9 f;  2KI7 B;  4Y7N I;  4NB8 A;  3S2H I;  1RLY A;  2DE7 A;  1Y1V I;  4NBG A;  1VQ9 1;  3D6W A;  3CC4 1;  1VQM 1;  4DGL A;  3M3Y I;  2OTJ 1;  4A93 I;  3FQM A;  3GTM I;  1NJI 2;  1K83 I;  1X3Z A;  2GTH A;  1Z01 A;  3CCQ 1;  3CCE Z;  1WW9 A;  2VUG A;  4NBC A;  2F4M A;  1Q86 2;  1QVG Z;  1VQ4 Z;  2RIQ A;  3BG0 B;  1USP A;  1ZB9 A;  3GKQ A;  4A3M I;  1JJ2 Z;  5C3E I;  4NBF A;  3PO3 I;  2OTL Z;  5IT9 b;  1TWC I;  3TDH B;  2PMZ A;  5C4J I;  1VQN 1;  2VF1 A;  2F4O A;  2YAD A;  3CQZ I;  3VMH A;  3CCR Z;  2E2H I;  4A3L I;  3I07 A;  3VMG A;  3G4S 1;  1I50 I;  3NFZ A;  3J7A 4;  3G71 1;  3CD6 1;  3ESW A;  5AN9 F;  1M1K 1;  1QVF Y;  3MZK B;  3KIF A;  2GTI A;  3JAM f;  3GTP I;  1Y1V S;  4A3D I;  4RVG A;  4A3G I;  1YIJ Z;  1VQ5 Z;  2QKD A;  4E33 A;  2QA4 1;  1YI2 Z;  1NP6 A;  4MD9 A;  2B63 I;  1QF8 A;  1K8A 1;  4RVF A;  3NDJ A;  2PK7 A;  4AYB A;  1Q82 1;  5FLX b;  4A3K I;  3VTN A;  1ZB8 A;  1K9M 1;  2IZ3 A;  3J80 f;  1S7M A;  1Q81 1;  2V8J A;  3JAM b;  3NH5 A;  1VQP Z;  3CCV Z;  3G6E 1;  3GTQ I;  3J81 f;  3I4M I;  3F3P C;  1YJ9 Z;  3GTO I;  2QEX Z;  5C44 I;  2QRC B;  1M90 1;  1YIT 1;  4RVD A;  1TWG I;  1KC8 2;  4BBR I;  3NH8 A;  1S72 Z;  2OOX B;  4RVH A;  1YUA A;  4A3J I;  2Q4Z A;  2KPI A;  1VQO 1;  2G2K A;  3CCM 1;  2K3R A;  3F3F C;  3CCJ 1;  3TE5 B;  4E31 A;  2HU9 A;  3HOY I;  3KIH A;  4A3I I;  3J81 b;  3CME 1;  4E2Y A;  5CM2 M;  4XX2 A;  1LQL A;  2QRD B;  3BG1 B;  4NBD A;  1TWA I;  1DL6 A;  3Q87 A;  1VQ9 Z;  1JWH C;  1KQS Y;  1VQM Z;  2W03 A;  3I4N I;  2OTJ Z;  3S1M I;  1K73 1;  3RZO I;  1Z03 A;  1TWF I;  2RHB A;  2E2I I;  4HGY A;  4MON A;  3HOV I;  3S17 I;  4MD7 A;  5C4X I;  3U50 C;  3GTJ I;  3CCQ Z;  3GCF A;  2R7Z I;  4NFR A;  3I55 Z;  1VQK 1;  5IP9 I;  1VQN Z;  3LUS A;  3FKI I;  1Y1W I;  1Q7Y 2;  1I3Q I;  1VLA A;  2K5R A;  4A3F I;  2YU9 I;  5FLX f;  3CCL Z;  1N8R 1;  4S1T A;  2OOY B;  3G71 Z;  3CD6 Z;  3CCR 1;  4NBB A;  1VQ7 1;  1KD1 1;  4MXU A;  1WCM I;  1VQL 1;  3OW2 Z;  1YJN 1;  5LL6 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...