1VQ6Z

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq6Z00
1KD12 1VQK1 1K731 1Q821 1KC82 1VQLZ 1VQ91 1VQ51 2OTJ1 3CMEZ 1VQ71 1YJW1 3OW2Y 3CCV1 3CC4Z 3CD61 3OW2Z 1VQ61 1NJI2 1K8A2 3CCJZ 1VQN1 1Q811 2QEX1 1YJ91 1M901 1N8R1 3CPWY 3I561 1W2BY 1YHQZ 3CMA1 1KD11 1YIT1 3CPWZ 3CC2Z 3G71Z 1VQL1 1W2BZ 1JJ2Y 2OTLZ 1VQMZ 1VQ8Z 1KC81 3G4S1 1JJ2Z 1Q862 1YIJZ 1YJNZ 3CCLZ 1M1K1 3I551 3CCMZ 1YI21 3CCRZ 3G6EZ 1VQPZ 3CCQZ 3CCUZ 3CC71 1NJI1 2QA4Z 1S721 1VQ41 1VQOZ 1Q7Y1 3CCSZ 1VQKZ 3CCM1 3CME1 3CCR1 1VQ9Z 1VQ5Z 3CC41 2OTJZ 1QVFY 1QVGY 3CCEZ 1VQ7Z 1QVFZ 1YJWZ 1QVGZ 1K9M2 1VQO1 3CCJ1 3CD6Z 1VQ6Z 1Q812 1K8A1 1M902 1N8R2 1YHQ1 3CC21 3G711 1VQNZ 2OTL1 2QEXZ 1YJ9Z 1K732 3I56Z 1VQM1 1VQ81 3CMAZ 1YITZ 1YIJ1 1YJN1 1Q822 3CCL1 1M1K2 1Q861 3G4SZ 3G6E1 3CCE1 1VQP1 3CCQ1 3I55Z 3CCU1 1YI2Z 1KQSY 2QA41 1K9M1 3CCVZ 1KQSZ 3CC7Z 3CXCY 1Q7Y2 3CCS1 3CXCZ 1S72Z 1VQ4Z
chains in the Genus database with same CATH superfamily
1KD12 4E32A 4A3EI 1ZB9A 5IP7I 4Y7NI 2EGTA 3VMGA 1VQLZ 2V8IA 2JMOA 3P5JB 3PO2I 3HOZI 2HU9A 4NBHA 3S1QI 4MH4A 3LUSA 1VQ61 3HOWI 4RVHA 1K8A2 2NVTI 2K3RA 2E2JI 1Q811 1KD11 2E9HA 1SFOI 1W2BZ 2E2II 4A3LI 1VQMZ 2VPXA 1VQ8Z 4NH1C 3J80f 2O53A 1YIJZ 1YJNZ 4A3FI 2PM9A 3HOXI 3TE5B 5D1OB 2GTHA 1JWHC 2AYDA 2QREB 5T6BA 2NVYI 3S16I 3HOYI 1Z03A 2QA4Z 3U50C 4BBSI 2QLVB 2OOXB 3NH8A 3J7A4 2JUBA 4MD8A 4E2WA 2O4HA 2F4OA 4HGZA 1X0TA 2JIPA 2P28A 4NBGA 2VPYA 2ZAEB 1R9TI 3KIHA 4NBEA 3IF8A 4RV9A 3J80b 1WJ2A 1QVFY 1WIIA 1QVGY 1VQ7Z 3MZLB 4MD9A 2OOYB 3HOVI 1VQO1 3GTJI 3GTLI 3IX0A 1ZB8A 2RIQA 3EEDA 1USPA 2QEXZ 3D9XA 2GTIA 3Q87A 3I56Z 3GTMS 3GKQA 2V8KA 1VQM1 1VQ81 1YIJ1 1YJN1 1Q822 2DE6A 3CCE1 2V3VA 1ZH1A 3I55Z 3I07A 2QA41 5IT9f 1P9NA 1RO0A 1WZNA 4NBCA 1S72Z 3GTMI 2R6MA 2RT9A 3ESWA 3TDHB 4A3BI 4A3CI 1Q821 1KC82 1Y8CA 2JA6I 4NBDA 3S15I 3CMEZ 4A3KI 2IZ3A 1VQ71 1I6HI 1L1OC 4X6AI 3CC4Z 1FDOA 2OZKA 3OW2Z 4E2XA 2WAQA 2LFUA 2NAPA 4XX2A 2E2HI 3H3VJ 5IT9b 4RVDA 4NOZA 2QEX1 1M901 1N8R1 3I561 5FLMI 3CPWZ 3CC2Z 3G71Z 5D1PA 1TWGI 1KC81 3MZKB 1JJ2Z 1Q862 1M1K1 3I551 3GCFA 2IZ4A 1NUIA 1VQPZ 5CM2M 2M48A 4HH4A 1S721 1VQOZ 2W03A 3MONA 1Q7Y1 3S2DI 2WB1A 3D6WA 3JAMf 2RBLA 4RVGA 3IFUA 1Q16A 1VQKZ 3S14I 3CCM1 2KPIA 2F4MA 3CME1 3H0GI 3QWUA 1VQ5Z 3CC41 4RVFA 3CCEZ 3M4OI 2LIYA 3VMHA 2DE7A 2V45A 1K8A1 3CC21 3G711 2NVXI 1VQNZ 4BBRI 1TWAI 3PO3S 3J81f 4NFRA 2LEXA 2J6AA 1Y1WI 1YITZ 1PFTA 3JAMb 4E31A 3BG1B 1RQFA 1VQP1 2YU9I 3GTKI 1WW9A 2P3YA 1DL6A 1RO4A 1TWHI 3FQQA 3RZDI 2JIRA 1KQSZ 1VLAA 1Z02A 3CXCZ 3BG0B 3GTOI 1VQ4Z 3T4NB 1S7MA 1VQK1 4DGLA 3PO3I 5A2Qf 3KIFA 3J81b 2QR1B 1VQ51 1Y1VS 4MD7A 3NH5A 2E7ZA 2VF1A 3CCV1 4QTTA 5T64A 4E30A 2NVQI 3F3PC 2PK7A 2PMZA 1NJI2 3GTGI 2QKDA 3CCJZ 1VQN1 3CQZI 1LQLA 1W2BY 1YIT1 1KRLA 4NBAA 5A2Qb 2JIOA 1Y1VI 3CCLZ 1TWFI 5AN9F 3CCMZ 2B63I 1X3ZA 3S1RI 1USPB 4NB9A 4A3DI 1YUAA 3NDJA 3F3FC 1NJI1 1TFIA 1VQ41 3FQMA 3K7AI 1QXFA 4TNUA 1I3QI 4MXUA 3CCR1 3S17I 4Y52I 5LL6f 1VQ9Z 2OTJZ 1N2FA 4NBFA 3S1MI 1SIWA 1QVFZ 1YJWZ 2HF1A 3GTPI 1QVGZ 1Z01A 2QRDB 3CCJ1 3CD6Z 1Q812 2H85A 5D1OA 3IR7A 1YJ9Z 1K732 4AYBA 4E2YA 2JA7I 3CMAZ 3VMIA 2RHBA 3CCL1 2KI7B 1Q861 3G4SZ 4RS4A 4A3GI 1YI2Z 2JNYA 3RZOI 3CCVZ 4NB8A 4E33A 1K83I 3CC7Z 3NH4A 3NDIA 4BY7I 5C3EI 4A3JI 3HOUI 2JR6A 1K731 1ML8A 4NBBA 4MRIA 1VQ91 2OTJ1 1RO2A 2YADA 2BJOA 5C44I 1QYPA 4CL1A 1YJW1 3OW2Y 2V8JA 3CD61 3FKII 2R93I 2JS4A 4DK1A 4MONA 1YJ91 3S2HI 3CPWY 4EWCA 1YHQZ 3CMA1 4BY1I 2W04A 1RNIA 1VQL1 2OTLZ 1JJ2Y 3S1NI 5C4XI 5C4JI 3G4S1 1FDIA 2VPZA 1TWCI 3I4NI 4A3II 2Q51A 1I50I 1YI21 3CCRZ 3G6EZ 2R7ZI 4S1TA 2JA8I 5FLXf 1RLYA 3CCQZ 1NP6A 2VPWA 3CCUZ 1AA6A 3CC71 1WCMI 1X3WA 2G2KA 4A3MI 3M3YI 3CCSZ 2JA5I 3D2LA 3VTNA 3GTQI 3VB9A 2Y0SA 3NFZA 2I3CA 2M6NA 4QTUA 4DQYB 1K9M2 1YUKA 1QF8A 5FLXb 2VUGA 1VQ6Z 5T67A 5IP9I 1M902 1N8R2 1YHQ1 2Q4ZA 2OTL1 3HKZA 2QRCB 2GU2A 1M1K2 4E2ZA 4A93I 3G6E1 2JIMA 3CCQ1 2JIQA 3CCU1 2IV2X 2DE5A 1KQSY 2VUMI 1K9M1 3EERA 3CXCY 3I4MI 4HGYA 2RPRA 2R92I 1Q7Y2 2K5RA 3CCS1 4BXXI 2AKLA
chains in the Genus database with same CATH topology
1KD12 4E32A 4A3EI 1ZB9A 5IP7I 4Y7NI 2EGTA 3VMGA 1VQLZ 2V8IA 2JMOA 3P5JB 3PO2I 3HOZI 2HU9A 4NBHA 3S1QI 4MH4A 3LUSA 1VQ61 3HOWI 4RVHA 1K8A2 2NVTI 2K3RA 2E2JI 1Q811 1KD11 2E9HA 1SFOI 1W2BZ 2E2II 4A3LI 1VQMZ 1VQ8Z 4NH1C 3J80f 2O53A 1YIJZ 1YJNZ 4A3FI 2PM9A 3HOXI 3TE5B 5D1OB 2GTHA 1JWHC 5T6BA 2QREB 2NVYI 3S16I 3HOYI 1Z03A 2QA4Z 3U50C 4BBSI 2QLVB 2OOXB 3NH8A 3J7A4 2JUBA 4MD8A 4E2WA 2O4HA 2F4OA 4HGZA 1X0TA 2P28A 4NBGA 2ZAEB 1R9TI 3KIHA 4NBEA 3IF8A 4RV9A 3J80b 1QVFY 1WIIA 1QVGY 1VQ7Z 3MZLB 4MD9A 2OOYB 3HOVI 1VQO1 3GTJI 3GTLI 3IX0A 1ZB8A 2RIQA 3EEDA 1USPA 3D9XA 2QEXZ 2GTIA 3Q87A 3I56Z 3GTMS 3GKQA 2V8KA 1VQM1 1VQ81 1YIJ1 1YJN1 1Q822 2DE6A 3CCE1 1ZH1A 3I55Z 3I07A 2QA41 5IT9f 1P9NA 1RO0A 4NBCA 1S72Z 3GTMI 2R6MA 2RT9A 3ESWA 3TDHB 4A3BI 4A3CI 1Q821 1KC82 2JA6I 4NBDA 3S15I 3CMEZ 4A3KI 2IZ3A 1VQ71 1I6HI 1L1OC 4X6AI 3CC4Z 2OZKA 3OW2Z 4E2XA 2WAQA 2LFUA 4XX2A 2E2HI 3H3VJ 5IT9b 4RVDA 4NOZA 2QEX1 1M901 1N8R1 3I561 5FLMI 3CPWZ 3CC2Z 3G71Z 5D1PA 1TWGI 1KC81 3MZKB 1JJ2Z 1Q862 1M1K1 3I551 3GCFA 2IZ4A 1NUIA 1VQPZ 5CM2M 2M48A 4HH4A 1S721 1VQOZ 2W03A 3MONA 1Q7Y1 3S2DI 2WB1A 3D6WA 3JAMf 2RBLA 4RVGA 3IFUA 1VQKZ 3S14I 3CCM1 2KPIA 2F4MA 3CME1 3H0GI 3QWUA 1VQ5Z 3CC41 4RVFA 3CCEZ 3M4OI 2LIYA 3VMHA 2DE7A 1K8A1 3CC21 3G711 2NVXI 1VQNZ 4BBRI 1TWAI 3PO3S 3J81f 4NFRA 2J6AA 1Y1WI 1YITZ 1PFTA 3JAMb 4E31A 3BG1B 1RQFA 1VQP1 2YU9I 3GTKI 1WW9A 2P3YA 1DL6A 1RO4A 1TWHI 3FQQA 3RZDI 1KQSZ 1VLAA 1Z02A 3CXCZ 3BG0B 3GTOI 1VQ4Z 3T4NB 1S7MA 1VQK1 4DGLA 3PO3I 5A2Qf 3KIFA 3J81b 2QR1B 1VQ51 1Y1VS 4MD7A 3NH5A 2VF1A 3CCV1 4QTTA 5T64A 4E30A 2NVQI 3F3PC 2PK7A 2PMZA 1NJI2 3GTGI 2QKDA 3CCJZ 1VQN1 3CQZI 1LQLA 1W2BY 1YIT1 1KRLA 4NBAA 5A2Qb 1Y1VI 3CCLZ 1TWFI 5AN9F 3CCMZ 2B63I 1X3ZA 3S1RI 1USPB 4NB9A 4A3DI 1YUAA 3NDJA 3F3FC 1NJI1 1TFIA 1VQ41 3FQMA 3K7AI 4TNUA 1I3QI 4MXUA 3CCR1 3S17I 4Y52I 5LL6f 1VQ9Z 2OTJZ 1N2FA 4NBFA 3S1MI 1QVFZ 1YJWZ 2HF1A 3GTPI 1QVGZ 1Z01A 2QRDB 3CCJ1 3CD6Z 1Q812 2H85A 5D1OA 1YJ9Z 1K732 4AYBA 4E2YA 2JA7I 3CMAZ 3VMIA 2RHBA 3CCL1 2KI7B 1Q861 3G4SZ 4RS4A 4A3GI 1YI2Z 2JNYA 3RZOI 3CCVZ 4NB8A 4E33A 1K83I 3CC7Z 3NH4A 3NDIA 4BY7I 5C3EI 4A3JI 3HOUI 2JR6A 1K731 1ML8A 4NBBA 4MRIA 1VQ91 2OTJ1 1RO2A 2YADA 2BJOA 5C44I 1QYPA 4CL1A 1YJW1 3OW2Y 2V8JA 3CD61 3FKII 2R93I 2JS4A 4DK1A 4MONA 1YJ91 3S2HI 3CPWY 4EWCA 1YHQZ 3CMA1 4BY1I 2W04A 1RNIA 1VQL1 2OTLZ 1JJ2Y 3S1NI 5C4XI 5C4JI 3G4S1 1TWCI 3I4NI 4A3II 2Q51A 1I50I 1YI21 3CCRZ 3G6EZ 2R7ZI 4S1TA 2JA8I 5FLXf 1RLYA 3CCQZ 1NP6A 3CCUZ 3CC71 1WCMI 1X3WA 2G2KA 4A3MI 3M3YI 3CCSZ 2JA5I 3VTNA 3GTQI 3VB9A 2Y0SA 3NFZA 2I3CA 2M6NA 4QTUA 4DQYB 1K9M2 1YUKA 1QF8A 5FLXb 2VUGA 1VQ6Z 5T67A 5IP9I 1M902 1N8R2 1YHQ1 2Q4ZA 2OTL1 3HKZA 2QRCB 2GU2A 1M1K2 4E2ZA 4A93I 3G6E1 3CCQ1 3CCU1 2DE5A 1KQSY 2VUMI 1K9M1 3EERA 3CXCY 3I4MI 4HGYA 2RPRA 2R92I 1Q7Y2 2K5RA 3CCS1 4BXXI 2AKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 2;  1VQK 1;  1K73 1;  1Q82 1;  1KC8 2;  1VQL Z;  1VQ9 1;  1VQ5 1;  2OTJ 1;  3CME Z;  1VQ7 1;  1YJW 1;  3OW2 Y;  3CCV 1;  3CC4 Z;  3CD6 1;  3OW2 Z;  1VQ6 1;  1NJI 2;  1K8A 2;  3CCJ Z;  1VQN 1;  1Q81 1;  2QEX 1;  1YJ9 1;  1M90 1;  1N8R 1;  3CPW Y;  3I56 1;  1W2B Y;  1YHQ Z;  3CMA 1;  1KD1 1;  1YIT 1;  3CPW Z;  3CC2 Z;  3G71 Z;  1VQL 1;  1W2B Z;  1JJ2 Y;  2OTL Z;  1VQM Z;  1VQ8 Z;  1KC8 1;  3G4S 1;  1JJ2 Z;  1Q86 2;  1YIJ Z;  1YJN Z;  3CCL Z;  1M1K 1;  3I55 1;  3CCM Z;  1YI2 1;  3CCR Z;  3G6E Z;  1VQP Z;  3CCQ Z;  3CCU Z;  3CC7 1;  1NJI 1;  2QA4 Z;  1S72 1;  1VQ4 1;  1VQO Z;  1Q7Y 1;  3CCS Z;  1VQK Z;  3CCM 1;  3CME 1;  3CCR 1;  1VQ9 Z;  1VQ5 Z;  3CC4 1;  2OTJ Z;  1QVF Y;  1QVG Y;  3CCE Z;  1VQ7 Z;  1QVF Z;  1YJW Z;  1QVG Z;  1K9M 2;  1VQO 1;  3CCJ 1;  3CD6 Z;  1VQ6 Z;  1Q81 2;  1K8A 1;  1M90 2;  1N8R 2;  1YHQ 1;  3CC2 1;  3G71 1;  1VQN Z;  2OTL 1;  2QEX Z;  1YJ9 Z;  1K73 2;  3I56 Z;  1VQM 1;  1VQ8 1;  3CMA Z;  1YIT Z;  1YIJ 1;  1YJN 1;  1Q82 2;  3CCL 1;  1M1K 2;  1Q86 1;  3G4S Z;  3G6E 1;  3CCE 1;  1VQP 1;  3CCQ 1;  3I55 Z;  3CCU 1;  1YI2 Z;  1KQS Y;  2QA4 1;  1K9M 1;  3CCV Z;  1KQS Z;  3CC7 Z;  3CXC Y;  1Q7Y 2;  3CCS 1;  3CXC Z;  1S72 Z;  1VQ4 Z; 
#chains in the Genus database with same CATH topology
 1KD1 2;  4E32 A;  4A3E I;  1ZB9 A;  5IP7 I;  4Y7N I;  2EGT A;  3VMG A;  1VQL Z;  2V8I A;  2JMO A;  3P5J B;  3PO2 I;  3HOZ I;  2HU9 A;  4NBH A;  3S1Q I;  4MH4 A;  3LUS A;  1VQ6 1;  3HOW I;  4RVH A;  1K8A 2;  2NVT I;  2K3R A;  2E2J I;  1Q81 1;  1KD1 1;  2E9H A;  1SFO I;  1W2B Z;  2E2I I;  4A3L I;  1VQM Z;  2VPX A;  1VQ8 Z;  4NH1 C;  3J80 f;  2O53 A;  1YIJ Z;  1YJN Z;  4A3F I;  2PM9 A;  3HOX I;  3TE5 B;  5D1O B;  2GTH A;  1JWH C;  2AYD A;  2QRE B;  5T6B A;  2NVY I;  3S16 I;  3HOY I;  1Z03 A;  2QA4 Z;  3U50 C;  4BBS I;  2QLV B;  2OOX B;  3NH8 A;  3J7A 4;  2JUB A;  4MD8 A;  4E2W A;  2O4H A;  2F4O A;  4HGZ A;  1X0T A;  2JIP A;  2P28 A;  4NBG A;  2VPY A;  2ZAE B;  1R9T I;  3KIH A;  4NBE A;  3IF8 A;  4RV9 A;  3J80 b;  1WJ2 A;  1QVF Y;  1WII A;  1QVG Y;  1VQ7 Z;  3MZL B;  4MD9 A;  2OOY B;  3HOV I;  1VQO 1;  3GTJ I;  3GTL I;  3IX0 A;  1ZB8 A;  2RIQ A;  3EED A;  1USP A;  2QEX Z;  3D9X A;  2GTI A;  3Q87 A;  3I56 Z;  3GTM S;  3GKQ A;  2V8K A;  1VQM 1;  1VQ8 1;  1YIJ 1;  1YJN 1;  1Q82 2;  2DE6 A;  3CCE 1;  2V3V A;  1ZH1 A;  3I55 Z;  3I07 A;  2QA4 1;  5IT9 f;  1P9N A;  1RO0 A;  1WZN A;  4NBC A;  1S72 Z;  3GTM I;  2R6M A;  2RT9 A;  3ESW A;  3TDH B;  4A3B I;  4A3C I;  1Q82 1;  1KC8 2;  1Y8C A;  2JA6 I;  4NBD A;  3S15 I;  3CME Z;  4A3K I;  2IZ3 A;  1VQ7 1;  1I6H I;  1L1O C;  4X6A I;  3CC4 Z;  1FDO A;  2OZK A;  3OW2 Z;  4E2X A;  2WAQ A;  2LFU A;  2NAP A;  4XX2 A;  2E2H I;  3H3V J;  5IT9 b;  4RVD A;  4NOZ A;  2QEX 1;  1M90 1;  1N8R 1;  3I56 1;  5FLM I;  3CPW Z;  3CC2 Z;  3G71 Z;  5D1P A;  1TWG I;  1KC8 1;  3MZK B;  1JJ2 Z;  1Q86 2;  1M1K 1;  3I55 1;  3GCF A;  2IZ4 A;  1NUI A;  1VQP Z;  5CM2 M;  2M48 A;  4HH4 A;  1S72 1;  1VQO Z;  2W03 A;  3MON A;  1Q7Y 1;  3S2D I;  2WB1 A;  3D6W A;  3JAM f;  2RBL A;  4RVG A;  3IFU A;  1Q16 A;  1VQK Z;  3S14 I;  3CCM 1;  2KPI A;  2F4M A;  3CME 1;  3H0G I;  3QWU A;  1VQ5 Z;  3CC4 1;  4RVF A;  3CCE Z;  3M4O I;  2LIY A;  3VMH A;  2DE7 A;  2V45 A;  1K8A 1;  3CC2 1;  3G71 1;  2NVX I;  1VQN Z;  4BBR I;  1TWA I;  3PO3 S;  3J81 f;  4NFR A;  2LEX A;  2J6A A;  1Y1W I;  1YIT Z;  1PFT A;  3JAM b;  4E31 A;  3BG1 B;  1RQF A;  1VQP 1;  2YU9 I;  3GTK I;  1WW9 A;  2P3Y A;  1DL6 A;  1RO4 A;  1TWH I;  3FQQ A;  3RZD I;  2JIR A;  1KQS Z;  1VLA A;  1Z02 A;  3CXC Z;  3BG0 B;  3GTO I;  1VQ4 Z;  3T4N B;  1S7M A;  1VQK 1;  4DGL A;  3PO3 I;  5A2Q f;  3KIF A;  3J81 b;  2QR1 B;  1VQ5 1;  1Y1V S;  4MD7 A;  3NH5 A;  2E7Z A;  2VF1 A;  3CCV 1;  4QTT A;  5T64 A;  4E30 A;  2NVQ I;  3F3P C;  2PK7 A;  2PMZ A;  1NJI 2;  3GTG I;  2QKD A;  3CCJ Z;  1VQN 1;  3CQZ I;  1LQL A;  1W2B Y;  1YIT 1;  1KRL A;  4NBA A;  5A2Q b;  2JIO A;  1Y1V I;  3CCL Z;  1TWF I;  5AN9 F;  3CCM Z;  2B63 I;  1X3Z A;  3S1R I;  1USP B;  4NB9 A;  4A3D I;  1YUA A;  3NDJ A;  3F3F C;  1NJI 1;  1TFI A;  1VQ4 1;  3FQM A;  3K7A I;  1QXF A;  4TNU A;  1I3Q I;  4MXU A;  3CCR 1;  3S17 I;  4Y52 I;  5LL6 f;  1VQ9 Z;  2OTJ Z;  1N2F A;  4NBF A;  3S1M I;  1SIW A;  1QVF Z;  1YJW Z;  2HF1 A;  3GTP I;  1QVG Z;  1Z01 A;  2QRD B;  3CCJ 1;  3CD6 Z;  1Q81 2;  2H85 A;  5D1O A;  3IR7 A;  1YJ9 Z;  1K73 2;  4AYB A;  4E2Y A;  2JA7 I;  3CMA Z;  3VMI A;  2RHB A;  3CCL 1;  2KI7 B;  1Q86 1;  3G4S Z;  4RS4 A;  4A3G I;  1YI2 Z;  2JNY A;  3RZO I;  3CCV Z;  4NB8 A;  4E33 A;  1K83 I;  3CC7 Z;  3NH4 A;  3NDI A;  4BY7 I;  5C3E I;  4A3J I;  3HOU I;  2JR6 A;  1K73 1;  1ML8 A;  4NBB A;  4MRI A;  1VQ9 1;  2OTJ 1;  1RO2 A;  2YAD A;  2BJO A;  5C44 I;  1QYP A;  4CL1 A;  1YJW 1;  3OW2 Y;  2V8J A;  3CD6 1;  3FKI I;  2R93 I;  2JS4 A;  4DK1 A;  4MON A;  1YJ9 1;  3S2H I;  3CPW Y;  4EWC A;  1YHQ Z;  3CMA 1;  4BY1 I;  2W04 A;  1RNI A;  1VQL 1;  2OTL Z;  1JJ2 Y;  3S1N I;  5C4X I;  5C4J I;  3G4S 1;  1FDI A;  2VPZ A;  1TWC I;  3I4N I;  4A3I I;  2Q51 A;  1I50 I;  1YI2 1;  3CCR Z;  3G6E Z;  2R7Z I;  4S1T A;  2JA8 I;  5FLX f;  1RLY A;  3CCQ Z;  1NP6 A;  2VPW A;  3CCU Z;  1AA6 A;  3CC7 1;  1WCM I;  1X3W A;  2G2K A;  4A3M I;  3M3Y I;  3CCS Z;  2JA5 I;  3D2L A;  3VTN A;  3GTQ I;  3VB9 A;  2Y0S A;  3NFZ A;  2I3C A;  2M6N A;  4QTU A;  4DQY B;  1K9M 2;  1YUK A;  1QF8 A;  5FLX b;  2VUG A;  1VQ6 Z;  5T67 A;  5IP9 I;  1M90 2;  1N8R 2;  1YHQ 1;  2Q4Z A;  2OTL 1;  3HKZ A;  2QRC B;  2GU2 A;  1M1K 2;  4E2Z A;  4A93 I;  3G6E 1;  2JIM A;  3CCQ 1;  2JIQ A;  3CCU 1;  2IV2 X;  2DE5 A;  1KQS Y;  2VUM I;  1K9M 1;  3EER A;  3CXC Y;  3I4M I;  4HGY A;  2RPR A;  2R92 I;  1Q7Y 2;  2K5R A;  3CCS 1;  4BXX I;  2AKL A; 
#chains in the Genus database with same CATH homology
 1KD1 2;  4E32 A;  4A3E I;  1ZB9 A;  5IP7 I;  4Y7N I;  2EGT A;  3VMG A;  1VQL Z;  2V8I A;  2JMO A;  3P5J B;  3PO2 I;  3HOZ I;  2HU9 A;  4NBH A;  3S1Q I;  4MH4 A;  3LUS A;  1VQ6 1;  3HOW I;  4RVH A;  1K8A 2;  2NVT I;  2K3R A;  2E2J I;  1Q81 1;  1KD1 1;  2E9H A;  1SFO I;  1W2B Z;  2E2I I;  4A3L I;  1VQM Z;  1VQ8 Z;  4NH1 C;  3J80 f;  2O53 A;  1YIJ Z;  1YJN Z;  4A3F I;  2PM9 A;  3HOX I;  3TE5 B;  5D1O B;  2GTH A;  1JWH C;  5T6B A;  2QRE B;  2NVY I;  3S16 I;  3HOY I;  1Z03 A;  2QA4 Z;  3U50 C;  4BBS I;  2QLV B;  2OOX B;  3NH8 A;  3J7A 4;  2JUB A;  4MD8 A;  4E2W A;  2O4H A;  2F4O A;  4HGZ A;  1X0T A;  2P28 A;  4NBG A;  2ZAE B;  1R9T I;  3KIH A;  4NBE A;  3IF8 A;  4RV9 A;  3J80 b;  1QVF Y;  1WII A;  1QVG Y;  1VQ7 Z;  3MZL B;  4MD9 A;  2OOY B;  3HOV I;  1VQO 1;  3GTJ I;  3GTL I;  3IX0 A;  1ZB8 A;  2RIQ A;  3EED A;  1USP A;  3D9X A;  2QEX Z;  2GTI A;  3Q87 A;  3I56 Z;  3GTM S;  3GKQ A;  2V8K A;  1VQM 1;  1VQ8 1;  1YIJ 1;  1YJN 1;  1Q82 2;  2DE6 A;  3CCE 1;  1ZH1 A;  3I55 Z;  3I07 A;  2QA4 1;  5IT9 f;  1P9N A;  1RO0 A;  4NBC A;  1S72 Z;  3GTM I;  2R6M A;  2RT9 A;  3ESW A;  3TDH B;  4A3B I;  4A3C I;  1Q82 1;  1KC8 2;  2JA6 I;  4NBD A;  3S15 I;  3CME Z;  4A3K I;  2IZ3 A;  1VQ7 1;  1I6H I;  1L1O C;  4X6A I;  3CC4 Z;  2OZK A;  3OW2 Z;  4E2X A;  2WAQ A;  2LFU A;  4XX2 A;  2E2H I;  3H3V J;  5IT9 b;  4RVD A;  4NOZ A;  2QEX 1;  1M90 1;  1N8R 1;  3I56 1;  5FLM I;  3CPW Z;  3CC2 Z;  3G71 Z;  5D1P A;  1TWG I;  1KC8 1;  3MZK B;  1JJ2 Z;  1Q86 2;  1M1K 1;  3I55 1;  3GCF A;  2IZ4 A;  1NUI A;  1VQP Z;  5CM2 M;  2M48 A;  4HH4 A;  1S72 1;  1VQO Z;  2W03 A;  3MON A;  1Q7Y 1;  3S2D I;  2WB1 A;  3D6W A;  3JAM f;  2RBL A;  4RVG A;  3IFU A;  1VQK Z;  3S14 I;  3CCM 1;  2KPI A;  2F4M A;  3CME 1;  3H0G I;  3QWU A;  1VQ5 Z;  3CC4 1;  4RVF A;  3CCE Z;  3M4O I;  2LIY A;  3VMH A;  2DE7 A;  1K8A 1;  3CC2 1;  3G71 1;  2NVX I;  1VQN Z;  4BBR I;  1TWA I;  3PO3 S;  3J81 f;  4NFR A;  2J6A A;  1Y1W I;  1YIT Z;  1PFT A;  3JAM b;  4E31 A;  3BG1 B;  1RQF A;  1VQP 1;  2YU9 I;  3GTK I;  1WW9 A;  2P3Y A;  1DL6 A;  1RO4 A;  1TWH I;  3FQQ A;  3RZD I;  1KQS Z;  1VLA A;  1Z02 A;  3CXC Z;  3BG0 B;  3GTO I;  1VQ4 Z;  3T4N B;  1S7M A;  1VQK 1;  4DGL A;  3PO3 I;  5A2Q f;  3KIF A;  3J81 b;  2QR1 B;  1VQ5 1;  1Y1V S;  4MD7 A;  3NH5 A;  2VF1 A;  3CCV 1;  4QTT A;  5T64 A;  4E30 A;  2NVQ I;  3F3P C;  2PK7 A;  2PMZ A;  1NJI 2;  3GTG I;  2QKD A;  3CCJ Z;  1VQN 1;  3CQZ I;  1LQL A;  1W2B Y;  1YIT 1;  1KRL A;  4NBA A;  5A2Q b;  1Y1V I;  3CCL Z;  1TWF I;  5AN9 F;  3CCM Z;  2B63 I;  1X3Z A;  3S1R I;  1USP B;  4NB9 A;  4A3D I;  1YUA A;  3NDJ A;  3F3F C;  1NJI 1;  1TFI A;  1VQ4 1;  3FQM A;  3K7A I;  4TNU A;  1I3Q I;  4MXU A;  3CCR 1;  3S17 I;  4Y52 I;  5LL6 f;  1VQ9 Z;  2OTJ Z;  1N2F A;  4NBF A;  3S1M I;  1QVF Z;  1YJW Z;  2HF1 A;  3GTP I;  1QVG Z;  1Z01 A;  2QRD B;  3CCJ 1;  3CD6 Z;  1Q81 2;  2H85 A;  5D1O A;  1YJ9 Z;  1K73 2;  4AYB A;  4E2Y A;  2JA7 I;  3CMA Z;  3VMI A;  2RHB A;  3CCL 1;  2KI7 B;  1Q86 1;  3G4S Z;  4RS4 A;  4A3G I;  1YI2 Z;  2JNY A;  3RZO I;  3CCV Z;  4NB8 A;  4E33 A;  1K83 I;  3CC7 Z;  3NH4 A;  3NDI A;  4BY7 I;  5C3E I;  4A3J I;  3HOU I;  2JR6 A;  1K73 1;  1ML8 A;  4NBB A;  4MRI A;  1VQ9 1;  2OTJ 1;  1RO2 A;  2YAD A;  2BJO A;  5C44 I;  1QYP A;  4CL1 A;  1YJW 1;  3OW2 Y;  2V8J A;  3CD6 1;  3FKI I;  2R93 I;  2JS4 A;  4DK1 A;  4MON A;  1YJ9 1;  3S2H I;  3CPW Y;  4EWC A;  1YHQ Z;  3CMA 1;  4BY1 I;  2W04 A;  1RNI A;  1VQL 1;  2OTL Z;  1JJ2 Y;  3S1N I;  5C4X I;  5C4J I;  3G4S 1;  1TWC I;  3I4N I;  4A3I I;  2Q51 A;  1I50 I;  1YI2 1;  3CCR Z;  3G6E Z;  2R7Z I;  4S1T A;  2JA8 I;  5FLX f;  1RLY A;  3CCQ Z;  1NP6 A;  3CCU Z;  3CC7 1;  1WCM I;  1X3W A;  2G2K A;  4A3M I;  3M3Y I;  3CCS Z;  2JA5 I;  3VTN A;  3GTQ I;  3VB9 A;  2Y0S A;  3NFZ A;  2I3C A;  2M6N A;  4QTU A;  4DQY B;  1K9M 2;  1YUK A;  1QF8 A;  5FLX b;  2VUG A;  1VQ6 Z;  5T67 A;  5IP9 I;  1M90 2;  1N8R 2;  1YHQ 1;  2Q4Z A;  2OTL 1;  3HKZ A;  2QRC B;  2GU2 A;  1M1K 2;  4E2Z A;  4A93 I;  3G6E 1;  3CCQ 1;  3CCU 1;  2DE5 A;  1KQS Y;  2VUM I;  1K9M 1;  3EER A;  3CXC Y;  3I4M I;  4HGY A;  2RPR A;  2R92 I;  1Q7Y 2;  2K5R A;  3CCS 1;  4BXX I;  2AKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...