1VQ6Z

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq6Z00
3CD6Z 1K732 1VQ51 3G6E1 2OTJZ 2QEXZ 3CCRZ 1YHQZ 3CCSZ 1VQMZ 1KQSY 1VQN1 3CCQ1 1QVGY 1QVFZ 1NJI1 3CCL1 3CCM1 3CCE1 3CXCY 3CCUZ 3G711 3I551 1YIJZ 1VQOZ 1VQ41 1KC81 2OTL1 2QA41 1N8R2 1Q812 1M901 1S721 1VQ81 3CC21 3CCV1 1Q7Y2 3G4S1 1VQ5Z 1VQ91 3G6EZ 1K731 3I561 3CCJ1 1JJ2Y 1KQSZ 1YJ91 1VQNZ 3CCQZ 1QVGZ 3CCLZ 3CCMZ 1VQL1 1Q821 1YJW1 1W2BY 1VQ61 3CXCZ 3G71Z 1M1K1 3I55Z 3CPWY 1Q861 1VQ4Z 1VQP1 1KD11 2OTLZ 3CC71 1VQK1 1VQ71 3CC41 1K9M1 1S72Z 1VQ8Z 3OW2Y 1YI21 3CC2Z 3CCVZ 3CMA1 1K8A1 1VQ9Z 1N8R1 1Q811 1YIT1 1YJN1 3CME1 1M902 3I56Z 3CCJZ 1JJ2Z 1YJ9Z 3CD61 3CCEZ 2OTJ1 3CCR1 2QEX1 1YHQ1 1VQLZ 3CCS1 1YJWZ 1VQM1 1NJI2 1VQ6Z 1W2BZ 1QVFY 2QA4Z 3CPWZ 1VQPZ 1Q822 3CC7Z 1VQKZ 1VQ7Z 3CC4Z 3G4SZ 1YI2Z 1KC82 1M1K2 3CCU1 3CMAZ 3OW2Z 1Q862 1Q7Y1 1YIJ1 1YITZ 1KD12 1VQO1 1YJNZ 3CMEZ 1K9M2 1K8A2
chains in the Genus database with same CATH superfamily
1K732 1ZB9A 3BG0B 1FDOA 2OTJZ 3HOZI 2B63I 4E2WA 3GTGI 3CCQ1 3CCL1 1TWAI 2W03A 4A3EI 3CXCY 5D1PA 3I551 3IFUA 1YIJZ 4NH1C 2JA6I 1KC81 3VB9A 2OTL1 4NBAA 3MZLB 1M901 3J81f 2GTIA 2NAPA 3G4S1 3GCFA 1VQ91 4XX2A 2HU9A 3KIFA 3GTMI 2NVXI 3CCJ1 3J80b 1KQSZ 3ESWA 3CCQZ 2EGTA 2GU2A 3RZDI 3CCLZ 3FQQA 1VQL1 2NVQI 2VPZA 2JR6A 3EEDA 5LL6f 2E2JI 3MZKB 3I55Z 3GTOI 3P5JB 1TFIA 2OTLZ 2F4OA 1K9M1 3F3FC 3OW2Y 1VQ9Z 1N8R1 3U50C 3CME1 4NBHA 1QF8A 3CCJZ 2IZ4A 4NBDA 2R7ZI 3GTPI 2V3VA 2QEX1 4NB9A 2JIRA 3T4NB 1VQLZ 3IF8A 3D2LA 1K83I 3GKQA 2E7ZA 5IT9f 2DE7A 1RO2A 2NVYI 5T6BA 3TE5B 1WW9A 2JIMA 1RLYA 1RNIA 3CCU1 1KC82 5IP7I 3VMIA 1KD12 3H3VJ 2AKLA 2QRDB 3CMEZ 3H0GI 4DGLA 4MH4A 2JIPA 1YUKA 1ZB8A 3FQMA 5IP9I 5A2Qf 5CM2M 2PMZA 3G6E1 1TWFI 2VPXA 2QEXZ 3J81b 3IR7A 4BY1I 1WIIA 1KQSY 3NH8A 5FLXf 2NVTI 2OZKA 3CCE1 4RVGA 3GTLI 3PO3I 2VPYA 3CCUZ 4A3JI 3MONA 3G711 4NFRA 3S2DI 2JA8I 4RVFA 3VMGA 2QA41 3S1NI 2R93I 3JAMf 1N8R2 2M6NA 2VUMI 1QYPA 2JIQA 1S721 1VQ81 3HOVI 3CCV1 3PO3S 2JA7I 3G6EZ 3NH4A 4A3DI 2DE6A 2JIOA 3FKII 2ZAEB 3I561 3KIHA 1X3ZA 4TNUA 3HKZA 4HGYA 1QVGZ 3F3PC 2YU9I 4BBSI 2JS4A 2QKDA 3NFZA 1Z03A 1VQ61 4A3LI 1X0TA 4E33A 3G71Z 2JMOA 1Y1VI 2RHBA 5C44I 1KD11 4MRIA 2G2KA 1VQK1 1VQ71 4HGZA 4A3II 1S72Z 5IT9b 1VQ8Z 2R92I 3CCVZ 3CMA1 1USPB 2RBLA 4A3BI 1Q811 2P3YA 1YIT1 4NBBA 3CQZI 3S1MI 1DL6A 3I56Z 2VUGA 4A3GI 3CCR1 1YHQ1 2E2HI 4DK1A 3GTMS 3HOWI 3CCS1 4QTUA 1L1OC 1VQ6Z 3I4MI 1W2BZ 2JA5I 2LFUA 2F4MA 4RVHA 1R9TI 2J6AA 1VQKZ 1VQ7Z 1ML8A 3QWUA 3G4SZ 4A93I 1M1K2 3D9XA 3CMAZ 5FLXb 3S15I 1Q862 5AN9F 2DE5A 4Y7NI 4NBGA 1YITZ 1VQO1 1SIWA 1K8A2 1KRLA 2WAQA 3CCRZ 1YHQZ 3S16I 2Y0SA 3CCSZ 1TWGI 2WB1A 3J7A4 1P9NA 5T67A 4E2ZA 1VQN1 2QREB 1RQFA 1QVGY 2R6MA 5C3EI 2V45A 3BG1B 4NBCA 4AYBA 2V8JA 1VQOZ 1SFOI 1VQ41 2QRCB 1Q812 4X6AI 3CC21 1NUIA 3NDJA 1Y8CA 1PFTA 2K5RA 1YJ91 4MXUA 1VQNZ 1WZNA 2O53A 2Q4ZA 2Q51A 1FDIA 4CL1A 1YJW1 1W2BY 3HOXI 1M1K1 4NOZA 2VPWA 1Q861 1VQ4Z 1VQP1 5D1OB 1N2FA 1LQLA 3CC41 1TWHI 3CC2Z 1K8A1 4BY7I 3NH5A 3Q87A 1S7MA 4NBEA 3D6WA 1JJ2Z 1YJ9Z 1JWHC 2LIYA 3TDHB 3CD61 3CCEZ 1USPA 1YJWZ 1VQM1 1I50I 4BXXI 1I6HI 2QA4Z 3CPWZ 3HOYI 1VQPZ 4Y52I 1Q822 2V8IA 4RVDA 4MD7A 5T64A 4HH4A 3NDIA 3CC4Z 3M3YI 2E9HA 3VMHA 1Y1VS 2I3CA 5C4JI 2BJOA 4E2YA 4DQYB 1VLAA 2IV2X 3CD6Z 2O4HA 1VQ51 2OOXB 1X3WA 5A2Qb 2JUBA 2K3RA 4MONA 2W04A 1VQMZ 3S2HI 3K7AI 4S1TA 1QVFZ 4NB8A 4E32A 1NJI1 3I07A 3CCM1 3PO2I 2H85A 2KPIA 3HOUI 2RPRA 2RT9A 1WJ2A 2E2II 4E31A 1Z01A 3S1QI 2VF1A 4E2XA 4MD9A 1Q16A 2KI7B 3JAMb 3GTJI 4A3KI 1Q7Y2 4RS4A 1VQ5Z 4RV9A 2QR1B 3LUSA 3RZOI 4A3CI 2AYDA 1K731 1RO0A 2QLVB 4A3MI 1JJ2Y 4E30A 2IZ3A 3CCMZ 3GTKI 1Q821 5C4XI 1QXFA 3IX0A 3S17I 3CXCZ 5FLMI 2PK7A 4QTTA 3CPWY 1NP6A 1TWCI 3CC71 3M4OI 1YI21 3EERA 3J80f 2RIQA 4A3FI 1Y1WI 3VTNA 1YJN1 1M902 1RO4A 2JNYA 5D1OA 2LEXA 1WCMI 3S14I 2YADA 1ZH1A 2OTJ1 1Z02A 3GTQI 3S1RI 1AA6A 1NJI2 1QVFY 4EWCA 2OOYB 4MD8A 3CC7Z 3I4NI 1YI2Z 3OW2Z 4NBFA 2P28A 1Q7Y1 1YIJ1 1I3QI 1YJNZ 2V8KA 1K9M2 2HF1A 2M48A 2GTHA 1YUAA 4BBRI 2PM9A
chains in the Genus database with same CATH topology
1K732 1ZB9A 3BG0B 2OTJZ 3HOZI 2B63I 4E2WA 3GTGI 3CCQ1 3CCL1 1TWAI 2W03A 4A3EI 3CXCY 5D1PA 3I551 3IFUA 1YIJZ 4NH1C 2JA6I 1KC81 3VB9A 2OTL1 4NBAA 3MZLB 1M901 3J81f 2GTIA 3G4S1 3GCFA 1VQ91 4XX2A 2HU9A 3KIFA 3GTMI 2NVXI 3J80b 3CCJ1 1KQSZ 3ESWA 3CCQZ 2EGTA 2GU2A 3RZDI 3CCLZ 3FQQA 1VQL1 2NVQI 2JR6A 3EEDA 5LL6f 2E2JI 3MZKB 3I55Z 3GTOI 3P5JB 1TFIA 2OTLZ 2F4OA 1K9M1 3F3FC 3OW2Y 1VQ9Z 1N8R1 3U50C 3CME1 4NBHA 1QF8A 3CCJZ 2IZ4A 4NBDA 2R7ZI 3GTPI 2QEX1 4NB9A 3T4NB 1VQLZ 3IF8A 1K83I 3GKQA 5IT9f 2DE7A 1RO2A 2NVYI 5T6BA 3TE5B 1WW9A 1RLYA 1RNIA 3CCU1 1KC82 5IP7I 3VMIA 1KD12 3H3VJ 2AKLA 2QRDB 3CMEZ 3H0GI 4DGLA 4MH4A 1YUKA 1ZB8A 3FQMA 5IP9I 5A2Qf 5CM2M 2PMZA 3G6E1 1TWFI 2QEXZ 3J81b 4BY1I 1WIIA 1KQSY 3NH8A 5FLXf 2NVTI 2OZKA 3CCE1 4RVGA 3GTLI 3PO3I 3CCUZ 4A3JI 3MONA 3G711 4NFRA 3S2DI 2JA8I 4RVFA 3VMGA 2QA41 3S1NI 2R93I 3JAMf 1N8R2 2M6NA 2VUMI 1QYPA 1S721 1VQ81 3HOVI 3CCV1 3PO3S 2JA7I 3G6EZ 3NH4A 4A3DI 2DE6A 3FKII 2ZAEB 3I561 3KIHA 1X3ZA 4TNUA 3HKZA 4HGYA 1QVGZ 3F3PC 2YU9I 4BBSI 2JS4A 2QKDA 3NFZA 1Z03A 1VQ61 4A3LI 1X0TA 4E33A 3G71Z 2JMOA 1Y1VI 2RHBA 5C44I 1KD11 4MRIA 2G2KA 1VQK1 1VQ71 4HGZA 4A3II 1S72Z 5IT9b 1VQ8Z 2R92I 3CCVZ 3CMA1 1USPB 2RBLA 4A3BI 1Q811 2P3YA 1YIT1 4NBBA 3CQZI 3S1MI 1DL6A 3I56Z 2VUGA 4A3GI 3CCR1 1YHQ1 2E2HI 4DK1A 3GTMS 3HOWI 3CCS1 4QTUA 1L1OC 1VQ6Z 3I4MI 1W2BZ 2JA5I 2LFUA 2F4MA 4RVHA 1R9TI 2J6AA 1VQKZ 1VQ7Z 1ML8A 3QWUA 3G4SZ 4A93I 1M1K2 3D9XA 3CMAZ 5FLXb 3S15I 1Q862 5AN9F 2DE5A 4Y7NI 4NBGA 1YITZ 1VQO1 1K8A2 1KRLA 2WAQA 3CCRZ 1YHQZ 3S16I 2Y0SA 3CCSZ 1TWGI 2WB1A 3J7A4 1P9NA 5T67A 4E2ZA 1VQN1 2QREB 1RQFA 1QVGY 2R6MA 5C3EI 3BG1B 4NBCA 4AYBA 2V8JA 1VQOZ 1SFOI 1VQ41 2QRCB 1Q812 4X6AI 3CC21 1NUIA 3NDJA 1PFTA 2K5RA 1YJ91 4MXUA 1VQNZ 2O53A 2Q4ZA 2Q51A 4CL1A 1YJW1 1W2BY 3HOXI 1M1K1 4NOZA 1Q861 1VQ4Z 1VQP1 5D1OB 1N2FA 1LQLA 3CC41 1TWHI 3CC2Z 1K8A1 4BY7I 3NH5A 3Q87A 1S7MA 4NBEA 3D6WA 1JJ2Z 1YJ9Z 1JWHC 2LIYA 3TDHB 3CD61 3CCEZ 1USPA 1YJWZ 1VQM1 1I50I 4BXXI 1I6HI 2QA4Z 3CPWZ 3HOYI 1VQPZ 4Y52I 1Q822 2V8IA 4RVDA 4MD7A 5T64A 4HH4A 3NDIA 3CC4Z 3M3YI 2E9HA 3VMHA 1Y1VS 2I3CA 5C4JI 2BJOA 4E2YA 4DQYB 1VLAA 3CD6Z 2O4HA 1VQ51 2OOXB 1X3WA 5A2Qb 2JUBA 2K3RA 4MONA 2W04A 1VQMZ 3S2HI 3K7AI 4S1TA 1QVFZ 4NB8A 4E32A 1NJI1 3I07A 3CCM1 3PO2I 2H85A 2KPIA 3HOUI 2RPRA 2RT9A 2E2II 4E31A 1Z01A 3S1QI 2VF1A 4E2XA 4MD9A 2KI7B 3JAMb 3GTJI 4A3KI 1Q7Y2 4RS4A 1VQ5Z 4RV9A 2QR1B 3LUSA 3RZOI 4A3CI 1K731 1RO0A 2QLVB 4A3MI 1JJ2Y 4E30A 2IZ3A 3CCMZ 3GTKI 1Q821 5C4XI 3IX0A 3S17I 3CXCZ 5FLMI 2PK7A 4QTTA 3CPWY 1NP6A 1TWCI 3CC71 3M4OI 1YI21 3EERA 3J80f 2RIQA 4A3FI 1Y1WI 3VTNA 1YJN1 1M902 1RO4A 2JNYA 5D1OA 1WCMI 3S14I 2YADA 1ZH1A 2OTJ1 1Z02A 3GTQI 3S1RI 1NJI2 1QVFY 4EWCA 2OOYB 4MD8A 3CC7Z 3I4NI 1YI2Z 3OW2Z 4NBFA 2P28A 1Q7Y1 1YIJ1 1I3QI 1YJNZ 2V8KA 1K9M2 2HF1A 2M48A 2GTHA 1YUAA 4BBRI 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  1K73 2;  1VQ5 1;  3G6E 1;  2OTJ Z;  2QEX Z;  3CCR Z;  1YHQ Z;  3CCS Z;  1VQM Z;  1KQS Y;  1VQN 1;  3CCQ 1;  1QVG Y;  1QVF Z;  1NJI 1;  3CCL 1;  3CCM 1;  3CCE 1;  3CXC Y;  3CCU Z;  3G71 1;  3I55 1;  1YIJ Z;  1VQO Z;  1VQ4 1;  1KC8 1;  2OTL 1;  2QA4 1;  1N8R 2;  1Q81 2;  1M90 1;  1S72 1;  1VQ8 1;  3CC2 1;  3CCV 1;  1Q7Y 2;  3G4S 1;  1VQ5 Z;  1VQ9 1;  3G6E Z;  1K73 1;  3I56 1;  3CCJ 1;  1JJ2 Y;  1KQS Z;  1YJ9 1;  1VQN Z;  3CCQ Z;  1QVG Z;  3CCL Z;  3CCM Z;  1VQL 1;  1Q82 1;  1YJW 1;  1W2B Y;  1VQ6 1;  3CXC Z;  3G71 Z;  1M1K 1;  3I55 Z;  3CPW Y;  1Q86 1;  1VQ4 Z;  1VQP 1;  1KD1 1;  2OTL Z;  3CC7 1;  1VQK 1;  1VQ7 1;  3CC4 1;  1K9M 1;  1S72 Z;  1VQ8 Z;  3OW2 Y;  1YI2 1;  3CC2 Z;  3CCV Z;  3CMA 1;  1K8A 1;  1VQ9 Z;  1N8R 1;  1Q81 1;  1YIT 1;  1YJN 1;  3CME 1;  1M90 2;  3I56 Z;  3CCJ Z;  1JJ2 Z;  1YJ9 Z;  3CD6 1;  3CCE Z;  2OTJ 1;  3CCR 1;  2QEX 1;  1YHQ 1;  1VQL Z;  3CCS 1;  1YJW Z;  1VQM 1;  1NJI 2;  1VQ6 Z;  1W2B Z;  1QVF Y;  2QA4 Z;  3CPW Z;  1VQP Z;  1Q82 2;  3CC7 Z;  1VQK Z;  1VQ7 Z;  3CC4 Z;  3G4S Z;  1YI2 Z;  1KC8 2;  1M1K 2;  3CCU 1;  3CMA Z;  3OW2 Z;  1Q86 2;  1Q7Y 1;  1YIJ 1;  1YIT Z;  1KD1 2;  1VQO 1;  1YJN Z;  3CME Z;  1K9M 2;  1K8A 2; 
#chains in the Genus database with same CATH topology
 1K73 2;  1ZB9 A;  3BG0 B;  1FDO A;  2OTJ Z;  3HOZ I;  2B63 I;  4E2W A;  3GTG I;  3CCQ 1;  3CCL 1;  1TWA I;  2W03 A;  4A3E I;  3CXC Y;  5D1P A;  3I55 1;  3IFU A;  1YIJ Z;  4NH1 C;  2JA6 I;  1KC8 1;  3VB9 A;  2OTL 1;  4NBA A;  3MZL B;  1M90 1;  3J81 f;  2GTI A;  2NAP A;  3G4S 1;  3GCF A;  1VQ9 1;  4XX2 A;  2HU9 A;  3KIF A;  3GTM I;  2NVX I;  3CCJ 1;  3J80 b;  1KQS Z;  3ESW A;  3CCQ Z;  2EGT A;  2GU2 A;  3RZD I;  3CCL Z;  3FQQ A;  1VQL 1;  2NVQ I;  2VPZ A;  2JR6 A;  3EED A;  5LL6 f;  2E2J I;  3MZK B;  3I55 Z;  3GTO I;  3P5J B;  1TFI A;  2OTL Z;  2F4O A;  1K9M 1;  3F3F C;  3OW2 Y;  1VQ9 Z;  1N8R 1;  3U50 C;  3CME 1;  4NBH A;  1QF8 A;  3CCJ Z;  2IZ4 A;  4NBD A;  2R7Z I;  3GTP I;  2V3V A;  2QEX 1;  4NB9 A;  2JIR A;  3T4N B;  1VQL Z;  3IF8 A;  3D2L A;  1K83 I;  3GKQ A;  2E7Z A;  5IT9 f;  2DE7 A;  1RO2 A;  2NVY I;  5T6B A;  3TE5 B;  1WW9 A;  2JIM A;  1RLY A;  1RNI A;  3CCU 1;  1KC8 2;  5IP7 I;  3VMI A;  1KD1 2;  3H3V J;  2AKL A;  2QRD B;  3CME Z;  3H0G I;  4DGL A;  4MH4 A;  2JIP A;  1YUK A;  1ZB8 A;  3FQM A;  5IP9 I;  5A2Q f;  5CM2 M;  2PMZ A;  3G6E 1;  1TWF I;  2VPX A;  2QEX Z;  3J81 b;  3IR7 A;  4BY1 I;  1WII A;  1KQS Y;  3NH8 A;  5FLX f;  2NVT I;  2OZK A;  3CCE 1;  4RVG A;  3GTL I;  3PO3 I;  2VPY A;  3CCU Z;  4A3J I;  3MON A;  3G71 1;  4NFR A;  3S2D I;  2JA8 I;  4RVF A;  3VMG A;  2QA4 1;  3S1N I;  2R93 I;  3JAM f;  1N8R 2;  2M6N A;  2VUM I;  1QYP A;  2JIQ A;  1S72 1;  1VQ8 1;  3HOV I;  3CCV 1;  3PO3 S;  2JA7 I;  3G6E Z;  3NH4 A;  4A3D I;  2DE6 A;  2JIO A;  3FKI I;  2ZAE B;  3I56 1;  3KIH A;  1X3Z A;  4TNU A;  3HKZ A;  4HGY A;  1QVG Z;  3F3P C;  2YU9 I;  4BBS I;  2JS4 A;  2QKD A;  3NFZ A;  1Z03 A;  1VQ6 1;  4A3L I;  1X0T A;  4E33 A;  3G71 Z;  2JMO A;  1Y1V I;  2RHB A;  5C44 I;  1KD1 1;  4MRI A;  2G2K A;  1VQK 1;  1VQ7 1;  4HGZ A;  4A3I I;  1S72 Z;  5IT9 b;  1VQ8 Z;  2R92 I;  3CCV Z;  3CMA 1;  1USP B;  2RBL A;  4A3B I;  1Q81 1;  2P3Y A;  1YIT 1;  4NBB A;  3CQZ I;  3S1M I;  1DL6 A;  3I56 Z;  2VUG A;  4A3G I;  3CCR 1;  1YHQ 1;  2E2H I;  4DK1 A;  3GTM S;  3HOW I;  3CCS 1;  4QTU A;  1L1O C;  1VQ6 Z;  3I4M I;  1W2B Z;  2JA5 I;  2LFU A;  2F4M A;  4RVH A;  1R9T I;  2J6A A;  1VQK Z;  1VQ7 Z;  1ML8 A;  3QWU A;  3G4S Z;  4A93 I;  1M1K 2;  3D9X A;  3CMA Z;  5FLX b;  3S15 I;  1Q86 2;  5AN9 F;  2DE5 A;  4Y7N I;  4NBG A;  1YIT Z;  1VQO 1;  1SIW A;  1K8A 2;  1KRL A;  2WAQ A;  3CCR Z;  1YHQ Z;  3S16 I;  2Y0S A;  3CCS Z;  1TWG I;  2WB1 A;  3J7A 4;  1P9N A;  5T67 A;  4E2Z A;  1VQN 1;  2QRE B;  1RQF A;  1QVG Y;  2R6M A;  5C3E I;  2V45 A;  3BG1 B;  4NBC A;  4AYB A;  2V8J A;  1VQO Z;  1SFO I;  1VQ4 1;  2QRC B;  1Q81 2;  4X6A I;  3CC2 1;  1NUI A;  3NDJ A;  1Y8C A;  1PFT A;  2K5R A;  1YJ9 1;  4MXU A;  1VQN Z;  1WZN A;  2O53 A;  2Q4Z A;  2Q51 A;  1FDI A;  4CL1 A;  1YJW 1;  1W2B Y;  3HOX I;  1M1K 1;  4NOZ A;  2VPW A;  1Q86 1;  1VQ4 Z;  1VQP 1;  5D1O B;  1N2F A;  1LQL A;  3CC4 1;  1TWH I;  3CC2 Z;  1K8A 1;  4BY7 I;  3NH5 A;  3Q87 A;  1S7M A;  4NBE A;  3D6W A;  1JJ2 Z;  1YJ9 Z;  1JWH C;  2LIY A;  3TDH B;  3CD6 1;  3CCE Z;  1USP A;  1YJW Z;  1VQM 1;  1I50 I;  4BXX I;  1I6H I;  2QA4 Z;  3CPW Z;  3HOY I;  1VQP Z;  4Y52 I;  1Q82 2;  2V8I A;  4RVD A;  4MD7 A;  5T64 A;  4HH4 A;  3NDI A;  3CC4 Z;  3M3Y I;  2E9H A;  3VMH A;  1Y1V S;  2I3C A;  5C4J I;  2BJO A;  4E2Y A;  4DQY B;  1VLA A;  2IV2 X;  3CD6 Z;  2O4H A;  1VQ5 1;  2OOX B;  1X3W A;  5A2Q b;  2JUB A;  2K3R A;  4MON A;  2W04 A;  1VQM Z;  3S2H I;  3K7A I;  4S1T A;  1QVF Z;  4NB8 A;  4E32 A;  1NJI 1;  3I07 A;  3CCM 1;  3PO2 I;  2H85 A;  2KPI A;  3HOU I;  2RPR A;  2RT9 A;  1WJ2 A;  2E2I I;  4E31 A;  1Z01 A;  3S1Q I;  2VF1 A;  4E2X A;  4MD9 A;  1Q16 A;  2KI7 B;  3JAM b;  3GTJ I;  4A3K I;  1Q7Y 2;  4RS4 A;  1VQ5 Z;  4RV9 A;  2QR1 B;  3LUS A;  3RZO I;  4A3C I;  2AYD A;  1K73 1;  1RO0 A;  2QLV B;  4A3M I;  1JJ2 Y;  4E30 A;  2IZ3 A;  3CCM Z;  3GTK I;  1Q82 1;  5C4X I;  1QXF A;  3IX0 A;  3S17 I;  3CXC Z;  5FLM I;  2PK7 A;  4QTT A;  3CPW Y;  1NP6 A;  1TWC I;  3CC7 1;  3M4O I;  1YI2 1;  3EER A;  3J80 f;  2RIQ A;  4A3F I;  1Y1W I;  3VTN A;  1YJN 1;  1M90 2;  1RO4 A;  2JNY A;  5D1O A;  2LEX A;  1WCM I;  3S14 I;  2YAD A;  1ZH1 A;  2OTJ 1;  1Z02 A;  3GTQ I;  3S1R I;  1AA6 A;  1NJI 2;  1QVF Y;  4EWC A;  2OOY B;  4MD8 A;  3CC7 Z;  3I4N I;  1YI2 Z;  3OW2 Z;  4NBF A;  2P28 A;  1Q7Y 1;  1YIJ 1;  1I3Q I;  1YJN Z;  2V8K A;  1K9M 2;  2HF1 A;  2M48 A;  2GTH A;  1YUA A;  4BBR I;  2PM9 A; 
#chains in the Genus database with same CATH homology
 1K73 2;  1ZB9 A;  3BG0 B;  2OTJ Z;  3HOZ I;  2B63 I;  4E2W A;  3GTG I;  3CCQ 1;  3CCL 1;  1TWA I;  2W03 A;  4A3E I;  3CXC Y;  5D1P A;  3I55 1;  3IFU A;  1YIJ Z;  4NH1 C;  2JA6 I;  1KC8 1;  3VB9 A;  2OTL 1;  4NBA A;  3MZL B;  1M90 1;  3J81 f;  2GTI A;  3G4S 1;  3GCF A;  1VQ9 1;  4XX2 A;  2HU9 A;  3KIF A;  3GTM I;  2NVX I;  3J80 b;  3CCJ 1;  1KQS Z;  3ESW A;  3CCQ Z;  2EGT A;  2GU2 A;  3RZD I;  3CCL Z;  3FQQ A;  1VQL 1;  2NVQ I;  2JR6 A;  3EED A;  5LL6 f;  2E2J I;  3MZK B;  3I55 Z;  3GTO I;  3P5J B;  1TFI A;  2OTL Z;  2F4O A;  1K9M 1;  3F3F C;  3OW2 Y;  1VQ9 Z;  1N8R 1;  3U50 C;  3CME 1;  4NBH A;  1QF8 A;  3CCJ Z;  2IZ4 A;  4NBD A;  2R7Z I;  3GTP I;  2QEX 1;  4NB9 A;  3T4N B;  1VQL Z;  3IF8 A;  1K83 I;  3GKQ A;  5IT9 f;  2DE7 A;  1RO2 A;  2NVY I;  5T6B A;  3TE5 B;  1WW9 A;  1RLY A;  1RNI A;  3CCU 1;  1KC8 2;  5IP7 I;  3VMI A;  1KD1 2;  3H3V J;  2AKL A;  2QRD B;  3CME Z;  3H0G I;  4DGL A;  4MH4 A;  1YUK A;  1ZB8 A;  3FQM A;  5IP9 I;  5A2Q f;  5CM2 M;  2PMZ A;  3G6E 1;  1TWF I;  2QEX Z;  3J81 b;  4BY1 I;  1WII A;  1KQS Y;  3NH8 A;  5FLX f;  2NVT I;  2OZK A;  3CCE 1;  4RVG A;  3GTL I;  3PO3 I;  3CCU Z;  4A3J I;  3MON A;  3G71 1;  4NFR A;  3S2D I;  2JA8 I;  4RVF A;  3VMG A;  2QA4 1;  3S1N I;  2R93 I;  3JAM f;  1N8R 2;  2M6N A;  2VUM I;  1QYP A;  1S72 1;  1VQ8 1;  3HOV I;  3CCV 1;  3PO3 S;  2JA7 I;  3G6E Z;  3NH4 A;  4A3D I;  2DE6 A;  3FKI I;  2ZAE B;  3I56 1;  3KIH A;  1X3Z A;  4TNU A;  3HKZ A;  4HGY A;  1QVG Z;  3F3P C;  2YU9 I;  4BBS I;  2JS4 A;  2QKD A;  3NFZ A;  1Z03 A;  1VQ6 1;  4A3L I;  1X0T A;  4E33 A;  3G71 Z;  2JMO A;  1Y1V I;  2RHB A;  5C44 I;  1KD1 1;  4MRI A;  2G2K A;  1VQK 1;  1VQ7 1;  4HGZ A;  4A3I I;  1S72 Z;  5IT9 b;  1VQ8 Z;  2R92 I;  3CCV Z;  3CMA 1;  1USP B;  2RBL A;  4A3B I;  1Q81 1;  2P3Y A;  1YIT 1;  4NBB A;  3CQZ I;  3S1M I;  1DL6 A;  3I56 Z;  2VUG A;  4A3G I;  3CCR 1;  1YHQ 1;  2E2H I;  4DK1 A;  3GTM S;  3HOW I;  3CCS 1;  4QTU A;  1L1O C;  1VQ6 Z;  3I4M I;  1W2B Z;  2JA5 I;  2LFU A;  2F4M A;  4RVH A;  1R9T I;  2J6A A;  1VQK Z;  1VQ7 Z;  1ML8 A;  3QWU A;  3G4S Z;  4A93 I;  1M1K 2;  3D9X A;  3CMA Z;  5FLX b;  3S15 I;  1Q86 2;  5AN9 F;  2DE5 A;  4Y7N I;  4NBG A;  1YIT Z;  1VQO 1;  1K8A 2;  1KRL A;  2WAQ A;  3CCR Z;  1YHQ Z;  3S16 I;  2Y0S A;  3CCS Z;  1TWG I;  2WB1 A;  3J7A 4;  1P9N A;  5T67 A;  4E2Z A;  1VQN 1;  2QRE B;  1RQF A;  1QVG Y;  2R6M A;  5C3E I;  3BG1 B;  4NBC A;  4AYB A;  2V8J A;  1VQO Z;  1SFO I;  1VQ4 1;  2QRC B;  1Q81 2;  4X6A I;  3CC2 1;  1NUI A;  3NDJ A;  1PFT A;  2K5R A;  1YJ9 1;  4MXU A;  1VQN Z;  2O53 A;  2Q4Z A;  2Q51 A;  4CL1 A;  1YJW 1;  1W2B Y;  3HOX I;  1M1K 1;  4NOZ A;  1Q86 1;  1VQ4 Z;  1VQP 1;  5D1O B;  1N2F A;  1LQL A;  3CC4 1;  1TWH I;  3CC2 Z;  1K8A 1;  4BY7 I;  3NH5 A;  3Q87 A;  1S7M A;  4NBE A;  3D6W A;  1JJ2 Z;  1YJ9 Z;  1JWH C;  2LIY A;  3TDH B;  3CD6 1;  3CCE Z;  1USP A;  1YJW Z;  1VQM 1;  1I50 I;  4BXX I;  1I6H I;  2QA4 Z;  3CPW Z;  3HOY I;  1VQP Z;  4Y52 I;  1Q82 2;  2V8I A;  4RVD A;  4MD7 A;  5T64 A;  4HH4 A;  3NDI A;  3CC4 Z;  3M3Y I;  2E9H A;  3VMH A;  1Y1V S;  2I3C A;  5C4J I;  2BJO A;  4E2Y A;  4DQY B;  1VLA A;  3CD6 Z;  2O4H A;  1VQ5 1;  2OOX B;  1X3W A;  5A2Q b;  2JUB A;  2K3R A;  4MON A;  2W04 A;  1VQM Z;  3S2H I;  3K7A I;  4S1T A;  1QVF Z;  4NB8 A;  4E32 A;  1NJI 1;  3I07 A;  3CCM 1;  3PO2 I;  2H85 A;  2KPI A;  3HOU I;  2RPR A;  2RT9 A;  2E2I I;  4E31 A;  1Z01 A;  3S1Q I;  2VF1 A;  4E2X A;  4MD9 A;  2KI7 B;  3JAM b;  3GTJ I;  4A3K I;  1Q7Y 2;  4RS4 A;  1VQ5 Z;  4RV9 A;  2QR1 B;  3LUS A;  3RZO I;  4A3C I;  1K73 1;  1RO0 A;  2QLV B;  4A3M I;  1JJ2 Y;  4E30 A;  2IZ3 A;  3CCM Z;  3GTK I;  1Q82 1;  5C4X I;  3IX0 A;  3S17 I;  3CXC Z;  5FLM I;  2PK7 A;  4QTT A;  3CPW Y;  1NP6 A;  1TWC I;  3CC7 1;  3M4O I;  1YI2 1;  3EER A;  3J80 f;  2RIQ A;  4A3F I;  1Y1W I;  3VTN A;  1YJN 1;  1M90 2;  1RO4 A;  2JNY A;  5D1O A;  1WCM I;  3S14 I;  2YAD A;  1ZH1 A;  2OTJ 1;  1Z02 A;  3GTQ I;  3S1R I;  1NJI 2;  1QVF Y;  4EWC A;  2OOY B;  4MD8 A;  3CC7 Z;  3I4N I;  1YI2 Z;  3OW2 Z;  4NBF A;  2P28 A;  1Q7Y 1;  1YIJ 1;  1I3Q I;  1YJN Z;  2V8K A;  1K9M 2;  2HF1 A;  2M48 A;  2GTH A;  1YUA A;  4BBR I;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...