1YITZ

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yitZ00
2OTJ1 1VQO1 1NJI1 2QA41 1S721 3OW2Y 2OTJZ 1K732 1NJI2 3CCU1 1K9M1 1M902 3CMEZ 1JJ2Z 1VQ71 1YJN1 1Q861 3CCUZ 3CCJ1 1QVFZ 3CC41 3I551 1K9M2 1VQ8Z 1VQ7Z 3CCSZ 1YJNZ 1Q862 3CCJZ 3CC71 1K8A2 3I55Z 3CC2Z 1YHQZ 1KD11 1VQM1 1YI2Z 1Q811 1KQSY 1KD12 3G4S1 1YIT1 1VQMZ 3CCE1 3G4SZ 3CCL1 1YITZ 3CME1 1QVGZ 3CMA1 3CCEZ 1KC81 3CCLZ 1VQ81 3CCS1 3CMAZ 1YJWZ 1KC82 1VQNZ 3CC21 1YHQ1 2OTLZ 1JJ2Y 1YI21 1QVFY 1Q7Y1 1Q812 2QEX1 1VQ51 1Q7Y2 1YJW1 2QEXZ 1VQK1 3CD61 1VQN1 1VQ5Z 1M1K1 1VQKZ 3CD6Z 2OTL1 3CCM1 1QVGY 3G6EZ 3G711 1VQL1 1M1K2 3CCV1 1VQ9Z 1W2BZ 1VQPZ 3CCMZ 3G71Z 3CCQ1 1VQLZ 1YIJ1 3CCVZ 1K731 1VQ61 1N8R1 1YJ91 3CCQZ 1YIJZ 3CCR1 1W2BY 3I561 1M901 1VQ6Z 1VQOZ 2QA4Z 1N8R2 1YJ9Z 1S72Z 3CCRZ 1VQ41 1Q821 3I56Z 1K8A1 1VQ4Z 1Q822 3CPWZ 3CXCZ 3G6E1 1KQSZ 1VQ91 3CC4Z 1VQP1 3CC7Z 3OW2Z 3CPWY 3CXCY
chains in the Genus database with same CATH superfamily
5IP9I 2QRDB 4TNUA 2OTJ1 2E7ZA 2E2II 5IT9b 2KI7B 1ZH1A 1K732 2W04A 2RHBA 3MONA 3VTNA 1M902 1VQ71 5A2Qf 1YJN1 2V3VA 2VPWA 1QVFZ 1K9M2 1VQ8Z 1QF8A 1X3WA 4MONA 3CCJZ 1K8A2 3I4MI 3CC2Z 1NUIA 2R93I 2LEXA 1TFIA 1NP6A 1Q811 2JA8I 1KQSY 3GKQA 5C44I 1YIT1 2H85A 3G4SZ 2JUBA 2Q51A 3CCEZ 1TWCI 3VMIA 1KC81 1VQ81 1K83I 2K5RA 3CMAZ 2R7ZI 1QXFA 2LFUA 2YU9I 3CC21 2DE6A 2E2HI 1RNIA 1I3QI 3VB9A 3LUSA 5C3EI 3I4NI 2NVQI 4RVHA 4A3LI 1Q812 3RZOI 3S17I 1Q7Y2 2YADA 2QEXZ 3KIFA 3IF8A 2GTHA 2P3YA 4DK1A 3CCM1 3MZLB 3JAMb 1WW9A 2HU9A 3G6EZ 1Q16A 1W2BZ 1X3ZA 2OOYB 2QLVB 1VQLZ 3NFZA 2WAQA 1W2BY 1VQ6Z 3BG1B 4E32A 2QA4Z 4QTUA 1P9NA 1YJ9Z 4MXUA 3NH5A 3S1QI 1WCMI 3G6E1 3HOWI 3FQQA 4MD9A 3QWUA 3I07A 5C4XI 1RQFA 1SIWA 2HF1A 2VPZA 4XX2A 4A3CI 4E2WA 3D2LA 1WIIA 2VPYA 5FLXf 3HKZA 4MH4A 2JIRA 2PMZA 2QA41 1USPB 2OTJZ 3NDIA 1NJI2 5LL6f 3CCU1 2JA5I 1K9M1 2W03A 4BY7I 4QTTA 4A3BI 3PO3I 4A93I 1VQ7Z 1YJNZ 1Q862 3GTQI 4Y7NI 2GTIA 2Y0SA 4NFRA 3J7A4 3F3FC 3VMHA 2R6MA 2NAPA 4CL1A 3FQMA 3GTMS 4A3GI 2K3RA 4NBAA 3S14I 2VF1A 2RT9A 5CM2M 3S1NI 1YITZ 4E2YA 1Z02A 4DQYB 3GTPI 1Z03A 2JS4A 4NBCA 2JR6A 3S1MI 5IP7I 1QVFY 3GTMI 5AN9F 1I50I 1SFOI 2P28A 3GTKI 2E9HA 4NBGA 1Q7Y1 3D9XA 4RVFA 1PFTA 1VQ51 3GTLI 3GCFA 1ZB9A 2I3CA 2IZ4A 2JMOA 2QKDA 3J80f 4E33A 1M1K2 3CCV1 4RS4A 4Y52I 3CCMZ 4NH1C 3MZKB 3CCQ1 5A2Qb 1ZB8A 3NDJA 5FLMI 4E31A 4RVGA 3CCR1 1JWHC 3I561 2QREB 1VQOZ 2R92I 1N8R2 3GTJI 4A3II 4A3KI 1Z01A 3HOXI 3CPWZ 2EGTA 3CC4Z 2AKLA 2V8IA 2VUMI 3NH8A 3CPWY 2LIYA 1TWFI 2JA6I 1Y1VS 2F4MA 4DGLA 4AYBA 3D6WA 1VQO1 1NJI1 1ML8A 4NBFA 1N2FA 3IX0A 1DL6A 4MD7A 3HOZI 2O4HA 3M4OI 1JJ2Z 1Q861 5T6BA 3CCUZ 2M6NA 2JIOA 3CC41 3I551 3CCSZ 3PO3S 3BG0B 3Q87A 4X6AI 2RIQA 2QRCB 2VPXA 3J81f 2BJOA 3U50C 2ZAEB 1VQM1 1Y1VI 4RV9A 1KD12 5D1OA 3CCL1 1QVGZ 3KIHA 4EWCA 3IFUA 3CCS1 3HOYI 1YUAA 1YJWZ 5IT9f 1VQNZ 4NBHA 1I6HI 2IZ3A 2RBLA 2G2KA 2J6AA 4NBEA 2F4OA 2NVYI 2PM9A 4BBSI 4A3FI 1YJW1 1VQK1 3CD61 5FLXb 1VQN1 1VQ5Z 3CQZI 1M1K1 4E2XA 3G711 3HOUI 1VQPZ 2NVXI 4A3MI 1RLYA 3GTGI 1VLAA 2RPRA 3IR7A 3CCVZ 1YIJ1 1N8R1 2AYDA 3HOVI 3CCQZ 1WZNA 1S72Z 4A3DI 3GTOI 2M48A 3CCRZ 4NB9A 1VQ41 3I56Z 3FKII 1Y1WI 4BXXI 3TE5B 1Q822 2PK7A 1AA6A 1KQSZ 2E2JI 5T64A 1VQP1 2B63I 2GU2A 3CC7Z 2DE7A 5C4JI 3OW2Z 1Y8CA 4E2ZA 1S7MA 1S721 1FDIA 3OW2Y 3JAMf 4MRIA 2Q4ZA 2WB1A 3T4NB 2JIMA 1X0TA 2OOXB 3CMEZ 3S2DI 3CCJ1 5D1PA 2V45A 4NBDA 4HH4A 3S1RI 3CC71 1LQLA 2VUGA 3I55Z 1YHQZ 2IV2X 1KD11 1RO4A 1YI2Z 3M3YI 3H0GI 1FDOA 3G4S1 3J80b 3NH4A 1VQMZ 1WJ2A 3CCE1 3K7AI 3P5JB 3CME1 3EEDA 3CMA1 3VMGA 2O53A 3CCLZ 1RO0A 1TWGI 1KC82 1YHQ1 4BY1I 1TWHI 2OTLZ 1L1OC 1JJ2Y 1YI21 3S16I 1QYPA 2JNYA 1YUKA 4E30A 2OZKA 3H3VJ 3PO2I 2QEX1 4S1TA 5D1OB 3S2HI 4A3JI 3ESWA 4NB8A 1VQKZ 3CD6Z 2DE5A 2OTL1 2JA7I 2JIPA 3TDHB 1QVGY 2JIQA 1VQL1 1VQ9Z 1R9TI 1TWAI 2KPIA 3G71Z 1KRLA 4RVDA 1K731 1VQ61 2NVTI 4NOZA 1USPA 1YJ91 1YIJZ 3S15I 4HGZA 1M901 3J81b 2V8JA 3EERA 4BBRI 4MD8A 1Q821 1RO2A 2V8KA 1K8A1 2QR1B 3F3PC 4A3EI 1VQ4Z 4HGYA 3CXCZ 1VQ91 4NBBA 5T67A 3RZDI 3CXCY
chains in the Genus database with same CATH topology
5IP9I 2QRDB 4TNUA 2OTJ1 2E2II 5IT9b 2KI7B 1ZH1A 1K732 2W04A 2RHBA 3MONA 3VTNA 1M902 1VQ71 5A2Qf 1YJN1 1QVFZ 1K9M2 1VQ8Z 1QF8A 1X3WA 4MONA 3CCJZ 1K8A2 3I4MI 3CC2Z 1NUIA 2R93I 1TFIA 1NP6A 1Q811 2JA8I 1KQSY 3GKQA 5C44I 1YIT1 2H85A 3G4SZ 2JUBA 2Q51A 3CCEZ 1TWCI 3VMIA 1KC81 1VQ81 1K83I 2K5RA 3CMAZ 2R7ZI 2LFUA 2YU9I 3CC21 2DE6A 2E2HI 1RNIA 1I3QI 3VB9A 3LUSA 5C3EI 3I4NI 2NVQI 4RVHA 4A3LI 1Q812 3RZOI 3S17I 1Q7Y2 2YADA 2QEXZ 3KIFA 3IF8A 2GTHA 2P3YA 4DK1A 3CCM1 3MZLB 3JAMb 1WW9A 2HU9A 3G6EZ 1W2BZ 1X3ZA 2OOYB 2QLVB 1VQLZ 3NFZA 2WAQA 1W2BY 1VQ6Z 3BG1B 4E32A 2QA4Z 4QTUA 1P9NA 1YJ9Z 4MXUA 3NH5A 3S1QI 1WCMI 3G6E1 3HOWI 3FQQA 4MD9A 3QWUA 3I07A 5C4XI 1RQFA 2HF1A 4XX2A 4A3CI 4E2WA 1WIIA 5FLXf 3HKZA 4MH4A 2PMZA 2QA41 1USPB 2OTJZ 3NDIA 1NJI2 5LL6f 3CCU1 2JA5I 1K9M1 2W03A 4BY7I 4QTTA 4A3BI 3PO3I 4A93I 1VQ7Z 1YJNZ 1Q862 3GTQI 4Y7NI 2GTIA 2Y0SA 4NFRA 3J7A4 3F3FC 3VMHA 2R6MA 4CL1A 3FQMA 3GTMS 4A3GI 2K3RA 4NBAA 3S14I 2VF1A 2RT9A 5CM2M 3S1NI 1YITZ 4E2YA 1Z02A 4DQYB 3GTPI 1Z03A 2JS4A 4NBCA 2JR6A 3S1MI 5IP7I 1QVFY 3GTMI 5AN9F 1I50I 1SFOI 2P28A 3GTKI 2E9HA 4NBGA 1Q7Y1 3D9XA 4RVFA 1PFTA 1VQ51 3GTLI 3GCFA 1ZB9A 2I3CA 2IZ4A 2JMOA 2QKDA 3J80f 4E33A 1M1K2 3CCV1 4RS4A 4Y52I 3CCMZ 4NH1C 3MZKB 3CCQ1 5A2Qb 1ZB8A 3NDJA 5FLMI 4E31A 4RVGA 3CCR1 1JWHC 3I561 2QREB 1VQOZ 2R92I 1N8R2 3GTJI 4A3II 4A3KI 1Z01A 3HOXI 3CPWZ 2EGTA 3CC4Z 2AKLA 2V8IA 2VUMI 3NH8A 3CPWY 2LIYA 1TWFI 2JA6I 1Y1VS 2F4MA 4DGLA 4AYBA 3D6WA 1VQO1 1NJI1 1ML8A 4NBFA 1N2FA 3IX0A 1DL6A 4MD7A 3HOZI 2O4HA 3M4OI 1JJ2Z 1Q861 5T6BA 3CCUZ 2M6NA 3CC41 3I551 3CCSZ 3PO3S 3BG0B 3Q87A 4X6AI 2RIQA 2QRCB 3J81f 2BJOA 3U50C 2ZAEB 1VQM1 1Y1VI 4RV9A 1KD12 5D1OA 3CCL1 1QVGZ 3KIHA 4EWCA 3IFUA 3CCS1 3HOYI 1YUAA 1YJWZ 5IT9f 1VQNZ 4NBHA 1I6HI 2IZ3A 2RBLA 2G2KA 2J6AA 4NBEA 2F4OA 2NVYI 2PM9A 4BBSI 4A3FI 1YJW1 1VQK1 3CD61 5FLXb 1VQN1 1VQ5Z 3CQZI 1M1K1 4E2XA 3G711 3HOUI 1VQPZ 2NVXI 4A3MI 1RLYA 3GTGI 1VLAA 2RPRA 1YIJ1 3CCVZ 1N8R1 3HOVI 3CCQZ 1S72Z 4A3DI 3GTOI 2M48A 3CCRZ 4NB9A 1VQ41 3I56Z 3FKII 1Y1WI 4BXXI 3TE5B 1Q822 2PK7A 1KQSZ 2E2JI 5T64A 1VQP1 2B63I 2GU2A 3CC7Z 2DE7A 5C4JI 3OW2Z 4E2ZA 1S7MA 1S721 3OW2Y 3JAMf 4MRIA 2Q4ZA 2WB1A 3T4NB 1X0TA 2OOXB 3CMEZ 3S2DI 3CCJ1 5D1PA 4NBDA 4HH4A 3S1RI 3CC71 1LQLA 2VUGA 1YHQZ 3I55Z 1KD11 1RO4A 1YI2Z 3M3YI 3H0GI 3G4S1 3J80b 3NH4A 1VQMZ 3CCE1 3K7AI 3P5JB 3CME1 3EEDA 3CMA1 3VMGA 2O53A 3CCLZ 1RO0A 1TWGI 1KC82 1YHQ1 4BY1I 1TWHI 2OTLZ 1L1OC 1JJ2Y 1YI21 3S16I 2JNYA 1QYPA 1YUKA 4E30A 2OZKA 3H3VJ 3PO2I 2QEX1 4S1TA 5D1OB 3S2HI 4A3JI 3ESWA 4NB8A 1VQKZ 3CD6Z 2DE5A 2OTL1 2JA7I 3TDHB 1QVGY 1VQL1 1VQ9Z 1R9TI 1TWAI 2KPIA 3G71Z 1KRLA 4RVDA 1K731 1VQ61 2NVTI 4NOZA 1USPA 1YJ91 1YIJZ 3S15I 4HGZA 1M901 3J81b 2V8JA 3EERA 4BBRI 4MD8A 1Q821 1RO2A 2V8KA 1K8A1 2QR1B 3F3PC 4A3EI 1VQ4Z 4HGYA 3CXCZ 1VQ91 4NBBA 5T67A 3RZDI 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 1;  1VQO 1;  1NJI 1;  2QA4 1;  1S72 1;  3OW2 Y;  2OTJ Z;  1K73 2;  1NJI 2;  3CCU 1;  1K9M 1;  1M90 2;  3CME Z;  1JJ2 Z;  1VQ7 1;  1YJN 1;  1Q86 1;  3CCU Z;  3CCJ 1;  1QVF Z;  3CC4 1;  3I55 1;  1K9M 2;  1VQ8 Z;  1VQ7 Z;  3CCS Z;  1YJN Z;  1Q86 2;  3CCJ Z;  3CC7 1;  1K8A 2;  3I55 Z;  3CC2 Z;  1YHQ Z;  1KD1 1;  1VQM 1;  1YI2 Z;  1Q81 1;  1KQS Y;  1KD1 2;  3G4S 1;  1YIT 1;  1VQM Z;  3CCE 1;  3G4S Z;  3CCL 1;  1YIT Z;  3CME 1;  1QVG Z;  3CMA 1;  3CCE Z;  1KC8 1;  3CCL Z;  1VQ8 1;  3CCS 1;  3CMA Z;  1YJW Z;  1KC8 2;  1VQN Z;  3CC2 1;  1YHQ 1;  2OTL Z;  1JJ2 Y;  1YI2 1;  1QVF Y;  1Q7Y 1;  1Q81 2;  2QEX 1;  1VQ5 1;  1Q7Y 2;  1YJW 1;  2QEX Z;  1VQK 1;  3CD6 1;  1VQN 1;  1VQ5 Z;  1M1K 1;  1VQK Z;  3CD6 Z;  2OTL 1;  3CCM 1;  1QVG Y;  3G6E Z;  3G71 1;  1VQL 1;  1M1K 2;  3CCV 1;  1VQ9 Z;  1W2B Z;  1VQP Z;  3CCM Z;  3G71 Z;  3CCQ 1;  1VQL Z;  1YIJ 1;  3CCV Z;  1K73 1;  1VQ6 1;  1N8R 1;  1YJ9 1;  3CCQ Z;  1YIJ Z;  3CCR 1;  1W2B Y;  3I56 1;  1M90 1;  1VQ6 Z;  1VQO Z;  2QA4 Z;  1N8R 2;  1YJ9 Z;  1S72 Z;  3CCR Z;  1VQ4 1;  1Q82 1;  3I56 Z;  1K8A 1;  1VQ4 Z;  1Q82 2;  3CPW Z;  3CXC Z;  3G6E 1;  1KQS Z;  1VQ9 1;  3CC4 Z;  1VQP 1;  3CC7 Z;  3OW2 Z;  3CPW Y;  3CXC Y; 
#chains in the Genus database with same CATH topology
 5IP9 I;  2QRD B;  4TNU A;  2OTJ 1;  2E7Z A;  2E2I I;  5IT9 b;  2KI7 B;  1ZH1 A;  1K73 2;  2W04 A;  2RHB A;  3MON A;  3VTN A;  1M90 2;  1VQ7 1;  5A2Q f;  1YJN 1;  2V3V A;  2VPW A;  1QVF Z;  1K9M 2;  1VQ8 Z;  1QF8 A;  1X3W A;  4MON A;  3CCJ Z;  1K8A 2;  3I4M I;  3CC2 Z;  1NUI A;  2R93 I;  2LEX A;  1TFI A;  1NP6 A;  1Q81 1;  2JA8 I;  1KQS Y;  3GKQ A;  5C44 I;  1YIT 1;  2H85 A;  3G4S Z;  2JUB A;  2Q51 A;  3CCE Z;  1TWC I;  3VMI A;  1KC8 1;  1VQ8 1;  1K83 I;  2K5R A;  3CMA Z;  2R7Z I;  1QXF A;  2LFU A;  2YU9 I;  3CC2 1;  2DE6 A;  2E2H I;  1RNI A;  1I3Q I;  3VB9 A;  3LUS A;  5C3E I;  3I4N I;  2NVQ I;  4RVH A;  4A3L I;  1Q81 2;  3RZO I;  3S17 I;  1Q7Y 2;  2YAD A;  2QEX Z;  3KIF A;  3IF8 A;  2GTH A;  2P3Y A;  4DK1 A;  3CCM 1;  3MZL B;  3JAM b;  1WW9 A;  2HU9 A;  3G6E Z;  1Q16 A;  1W2B Z;  1X3Z A;  2OOY B;  2QLV B;  1VQL Z;  3NFZ A;  2WAQ A;  1W2B Y;  1VQ6 Z;  3BG1 B;  4E32 A;  2QA4 Z;  4QTU A;  1P9N A;  1YJ9 Z;  4MXU A;  3NH5 A;  3S1Q I;  1WCM I;  3G6E 1;  3HOW I;  3FQQ A;  4MD9 A;  3QWU A;  3I07 A;  5C4X I;  1RQF A;  1SIW A;  2HF1 A;  2VPZ A;  4XX2 A;  4A3C I;  4E2W A;  3D2L A;  1WII A;  2VPY A;  5FLX f;  3HKZ A;  4MH4 A;  2JIR A;  2PMZ A;  2QA4 1;  1USP B;  2OTJ Z;  3NDI A;  1NJI 2;  5LL6 f;  3CCU 1;  2JA5 I;  1K9M 1;  2W03 A;  4BY7 I;  4QTT A;  4A3B I;  3PO3 I;  4A93 I;  1VQ7 Z;  1YJN Z;  1Q86 2;  3GTQ I;  4Y7N I;  2GTI A;  2Y0S A;  4NFR A;  3J7A 4;  3F3F C;  3VMH A;  2R6M A;  2NAP A;  4CL1 A;  3FQM A;  3GTM S;  4A3G I;  2K3R A;  4NBA A;  3S14 I;  2VF1 A;  2RT9 A;  5CM2 M;  3S1N I;  1YIT Z;  4E2Y A;  1Z02 A;  4DQY B;  3GTP I;  1Z03 A;  2JS4 A;  4NBC A;  2JR6 A;  3S1M I;  5IP7 I;  1QVF Y;  3GTM I;  5AN9 F;  1I50 I;  1SFO I;  2P28 A;  3GTK I;  2E9H A;  4NBG A;  1Q7Y 1;  3D9X A;  4RVF A;  1PFT A;  1VQ5 1;  3GTL I;  3GCF A;  1ZB9 A;  2I3C A;  2IZ4 A;  2JMO A;  2QKD A;  3J80 f;  4E33 A;  1M1K 2;  3CCV 1;  4RS4 A;  4Y52 I;  3CCM Z;  4NH1 C;  3MZK B;  3CCQ 1;  5A2Q b;  1ZB8 A;  3NDJ A;  5FLM I;  4E31 A;  4RVG A;  3CCR 1;  1JWH C;  3I56 1;  2QRE B;  1VQO Z;  2R92 I;  1N8R 2;  3GTJ I;  4A3I I;  4A3K I;  1Z01 A;  3HOX I;  3CPW Z;  2EGT A;  3CC4 Z;  2AKL A;  2V8I A;  2VUM I;  3NH8 A;  3CPW Y;  2LIY A;  1TWF I;  2JA6 I;  1Y1V S;  2F4M A;  4DGL A;  4AYB A;  3D6W A;  1VQO 1;  1NJI 1;  1ML8 A;  4NBF A;  1N2F A;  3IX0 A;  1DL6 A;  4MD7 A;  3HOZ I;  2O4H A;  3M4O I;  1JJ2 Z;  1Q86 1;  5T6B A;  3CCU Z;  2M6N A;  2JIO A;  3CC4 1;  3I55 1;  3CCS Z;  3PO3 S;  3BG0 B;  3Q87 A;  4X6A I;  2RIQ A;  2QRC B;  2VPX A;  3J81 f;  2BJO A;  3U50 C;  2ZAE B;  1VQM 1;  1Y1V I;  4RV9 A;  1KD1 2;  5D1O A;  3CCL 1;  1QVG Z;  3KIH A;  4EWC A;  3IFU A;  3CCS 1;  3HOY I;  1YUA A;  1YJW Z;  5IT9 f;  1VQN Z;  4NBH A;  1I6H I;  2IZ3 A;  2RBL A;  2G2K A;  2J6A A;  4NBE A;  2F4O A;  2NVY I;  2PM9 A;  4BBS I;  4A3F I;  1YJW 1;  1VQK 1;  3CD6 1;  5FLX b;  1VQN 1;  1VQ5 Z;  3CQZ I;  1M1K 1;  4E2X A;  3G71 1;  3HOU I;  1VQP Z;  2NVX I;  4A3M I;  1RLY A;  3GTG I;  1VLA A;  2RPR A;  3IR7 A;  3CCV Z;  1YIJ 1;  1N8R 1;  2AYD A;  3HOV I;  3CCQ Z;  1WZN A;  1S72 Z;  4A3D I;  3GTO I;  2M48 A;  3CCR Z;  4NB9 A;  1VQ4 1;  3I56 Z;  3FKI I;  1Y1W I;  4BXX I;  3TE5 B;  1Q82 2;  2PK7 A;  1AA6 A;  1KQS Z;  2E2J I;  5T64 A;  1VQP 1;  2B63 I;  2GU2 A;  3CC7 Z;  2DE7 A;  5C4J I;  3OW2 Z;  1Y8C A;  4E2Z A;  1S7M A;  1S72 1;  1FDI A;  3OW2 Y;  3JAM f;  4MRI A;  2Q4Z A;  2WB1 A;  3T4N B;  2JIM A;  1X0T A;  2OOX B;  3CME Z;  3S2D I;  3CCJ 1;  5D1P A;  2V45 A;  4NBD A;  4HH4 A;  3S1R I;  3CC7 1;  1LQL A;  2VUG A;  3I55 Z;  1YHQ Z;  2IV2 X;  1KD1 1;  1RO4 A;  1YI2 Z;  3M3Y I;  3H0G I;  1FDO A;  3G4S 1;  3J80 b;  3NH4 A;  1VQM Z;  1WJ2 A;  3CCE 1;  3K7A I;  3P5J B;  3CME 1;  3EED A;  3CMA 1;  3VMG A;  2O53 A;  3CCL Z;  1RO0 A;  1TWG I;  1KC8 2;  1YHQ 1;  4BY1 I;  1TWH I;  2OTL Z;  1L1O C;  1JJ2 Y;  1YI2 1;  3S16 I;  1QYP A;  2JNY A;  1YUK A;  4E30 A;  2OZK A;  3H3V J;  3PO2 I;  2QEX 1;  4S1T A;  5D1O B;  3S2H I;  4A3J I;  3ESW A;  4NB8 A;  1VQK Z;  3CD6 Z;  2DE5 A;  2OTL 1;  2JA7 I;  2JIP A;  3TDH B;  1QVG Y;  2JIQ A;  1VQL 1;  1VQ9 Z;  1R9T I;  1TWA I;  2KPI A;  3G71 Z;  1KRL A;  4RVD A;  1K73 1;  1VQ6 1;  2NVT I;  4NOZ A;  1USP A;  1YJ9 1;  1YIJ Z;  3S15 I;  4HGZ A;  1M90 1;  3J81 b;  2V8J A;  3EER A;  4BBR I;  4MD8 A;  1Q82 1;  1RO2 A;  2V8K A;  1K8A 1;  2QR1 B;  3F3P C;  4A3E I;  1VQ4 Z;  4HGY A;  3CXC Z;  1VQ9 1;  4NBB A;  5T67 A;  3RZD I;  3CXC Y; 
#chains in the Genus database with same CATH homology
 5IP9 I;  2QRD B;  4TNU A;  2OTJ 1;  2E2I I;  5IT9 b;  2KI7 B;  1ZH1 A;  1K73 2;  2W04 A;  2RHB A;  3MON A;  3VTN A;  1M90 2;  1VQ7 1;  5A2Q f;  1YJN 1;  1QVF Z;  1K9M 2;  1VQ8 Z;  1QF8 A;  1X3W A;  4MON A;  3CCJ Z;  1K8A 2;  3I4M I;  3CC2 Z;  1NUI A;  2R93 I;  1TFI A;  1NP6 A;  1Q81 1;  2JA8 I;  1KQS Y;  3GKQ A;  5C44 I;  1YIT 1;  2H85 A;  3G4S Z;  2JUB A;  2Q51 A;  3CCE Z;  1TWC I;  3VMI A;  1KC8 1;  1VQ8 1;  1K83 I;  2K5R A;  3CMA Z;  2R7Z I;  2LFU A;  2YU9 I;  3CC2 1;  2DE6 A;  2E2H I;  1RNI A;  1I3Q I;  3VB9 A;  3LUS A;  5C3E I;  3I4N I;  2NVQ I;  4RVH A;  4A3L I;  1Q81 2;  3RZO I;  3S17 I;  1Q7Y 2;  2YAD A;  2QEX Z;  3KIF A;  3IF8 A;  2GTH A;  2P3Y A;  4DK1 A;  3CCM 1;  3MZL B;  3JAM b;  1WW9 A;  2HU9 A;  3G6E Z;  1W2B Z;  1X3Z A;  2OOY B;  2QLV B;  1VQL Z;  3NFZ A;  2WAQ A;  1W2B Y;  1VQ6 Z;  3BG1 B;  4E32 A;  2QA4 Z;  4QTU A;  1P9N A;  1YJ9 Z;  4MXU A;  3NH5 A;  3S1Q I;  1WCM I;  3G6E 1;  3HOW I;  3FQQ A;  4MD9 A;  3QWU A;  3I07 A;  5C4X I;  1RQF A;  2HF1 A;  4XX2 A;  4A3C I;  4E2W A;  1WII A;  5FLX f;  3HKZ A;  4MH4 A;  2PMZ A;  2QA4 1;  1USP B;  2OTJ Z;  3NDI A;  1NJI 2;  5LL6 f;  3CCU 1;  2JA5 I;  1K9M 1;  2W03 A;  4BY7 I;  4QTT A;  4A3B I;  3PO3 I;  4A93 I;  1VQ7 Z;  1YJN Z;  1Q86 2;  3GTQ I;  4Y7N I;  2GTI A;  2Y0S A;  4NFR A;  3J7A 4;  3F3F C;  3VMH A;  2R6M A;  4CL1 A;  3FQM A;  3GTM S;  4A3G I;  2K3R A;  4NBA A;  3S14 I;  2VF1 A;  2RT9 A;  5CM2 M;  3S1N I;  1YIT Z;  4E2Y A;  1Z02 A;  4DQY B;  3GTP I;  1Z03 A;  2JS4 A;  4NBC A;  2JR6 A;  3S1M I;  5IP7 I;  1QVF Y;  3GTM I;  5AN9 F;  1I50 I;  1SFO I;  2P28 A;  3GTK I;  2E9H A;  4NBG A;  1Q7Y 1;  3D9X A;  4RVF A;  1PFT A;  1VQ5 1;  3GTL I;  3GCF A;  1ZB9 A;  2I3C A;  2IZ4 A;  2JMO A;  2QKD A;  3J80 f;  4E33 A;  1M1K 2;  3CCV 1;  4RS4 A;  4Y52 I;  3CCM Z;  4NH1 C;  3MZK B;  3CCQ 1;  5A2Q b;  1ZB8 A;  3NDJ A;  5FLM I;  4E31 A;  4RVG A;  3CCR 1;  1JWH C;  3I56 1;  2QRE B;  1VQO Z;  2R92 I;  1N8R 2;  3GTJ I;  4A3I I;  4A3K I;  1Z01 A;  3HOX I;  3CPW Z;  2EGT A;  3CC4 Z;  2AKL A;  2V8I A;  2VUM I;  3NH8 A;  3CPW Y;  2LIY A;  1TWF I;  2JA6 I;  1Y1V S;  2F4M A;  4DGL A;  4AYB A;  3D6W A;  1VQO 1;  1NJI 1;  1ML8 A;  4NBF A;  1N2F A;  3IX0 A;  1DL6 A;  4MD7 A;  3HOZ I;  2O4H A;  3M4O I;  1JJ2 Z;  1Q86 1;  5T6B A;  3CCU Z;  2M6N A;  3CC4 1;  3I55 1;  3CCS Z;  3PO3 S;  3BG0 B;  3Q87 A;  4X6A I;  2RIQ A;  2QRC B;  3J81 f;  2BJO A;  3U50 C;  2ZAE B;  1VQM 1;  1Y1V I;  4RV9 A;  1KD1 2;  5D1O A;  3CCL 1;  1QVG Z;  3KIH A;  4EWC A;  3IFU A;  3CCS 1;  3HOY I;  1YUA A;  1YJW Z;  5IT9 f;  1VQN Z;  4NBH A;  1I6H I;  2IZ3 A;  2RBL A;  2G2K A;  2J6A A;  4NBE A;  2F4O A;  2NVY I;  2PM9 A;  4BBS I;  4A3F I;  1YJW 1;  1VQK 1;  3CD6 1;  5FLX b;  1VQN 1;  1VQ5 Z;  3CQZ I;  1M1K 1;  4E2X A;  3G71 1;  3HOU I;  1VQP Z;  2NVX I;  4A3M I;  1RLY A;  3GTG I;  1VLA A;  2RPR A;  1YIJ 1;  3CCV Z;  1N8R 1;  3HOV I;  3CCQ Z;  1S72 Z;  4A3D I;  3GTO I;  2M48 A;  3CCR Z;  4NB9 A;  1VQ4 1;  3I56 Z;  3FKI I;  1Y1W I;  4BXX I;  3TE5 B;  1Q82 2;  2PK7 A;  1KQS Z;  2E2J I;  5T64 A;  1VQP 1;  2B63 I;  2GU2 A;  3CC7 Z;  2DE7 A;  5C4J I;  3OW2 Z;  4E2Z A;  1S7M A;  1S72 1;  3OW2 Y;  3JAM f;  4MRI A;  2Q4Z A;  2WB1 A;  3T4N B;  1X0T A;  2OOX B;  3CME Z;  3S2D I;  3CCJ 1;  5D1P A;  4NBD A;  4HH4 A;  3S1R I;  3CC7 1;  1LQL A;  2VUG A;  1YHQ Z;  3I55 Z;  1KD1 1;  1RO4 A;  1YI2 Z;  3M3Y I;  3H0G I;  3G4S 1;  3J80 b;  3NH4 A;  1VQM Z;  3CCE 1;  3K7A I;  3P5J B;  3CME 1;  3EED A;  3CMA 1;  3VMG A;  2O53 A;  3CCL Z;  1RO0 A;  1TWG I;  1KC8 2;  1YHQ 1;  4BY1 I;  1TWH I;  2OTL Z;  1L1O C;  1JJ2 Y;  1YI2 1;  3S16 I;  2JNY A;  1QYP A;  1YUK A;  4E30 A;  2OZK A;  3H3V J;  3PO2 I;  2QEX 1;  4S1T A;  5D1O B;  3S2H I;  4A3J I;  3ESW A;  4NB8 A;  1VQK Z;  3CD6 Z;  2DE5 A;  2OTL 1;  2JA7 I;  3TDH B;  1QVG Y;  1VQL 1;  1VQ9 Z;  1R9T I;  1TWA I;  2KPI A;  3G71 Z;  1KRL A;  4RVD A;  1K73 1;  1VQ6 1;  2NVT I;  4NOZ A;  1USP A;  1YJ9 1;  1YIJ Z;  3S15 I;  4HGZ A;  1M90 1;  3J81 b;  2V8J A;  3EER A;  4BBR I;  4MD8 A;  1Q82 1;  1RO2 A;  2V8K A;  1K8A 1;  2QR1 B;  3F3P C;  4A3E I;  1VQ4 Z;  4HGY A;  3CXC Z;  1VQ9 1;  4NBB A;  5T67 A;  3RZD I;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...