1YITZ

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yitZ00
1YJ9Z 1N8R2 3CCM1 1YHQ1 1YJWZ 1VQLZ 3CCUZ 3CCR1 2OTL1 1K8A2 3CCSZ 1VQ7Z 3I56Z 2QA41 3CME1 1N8R1 3I55Z 3CD6Z 1YJ91 1S72Z 1VQ4Z 1YJW1 1K8A1 1VQL1 3G6EZ 1KQSZ 3CCU1 1KQSY 3CCS1 1VQ71 3CXCY 1M1K2 3I551 3CD61 1S721 1VQ41 3G4SZ 2OTJZ 3G6E1 1K732 1M1K1 1VQ81 1W2BZ 3CC7Z 1QVGZ 1W2BY 3G71Z 1Q812 1QVGY 3CCL1 1YIJ1 1QVFZ 1QVFY 1YITZ 2OTJ1 1VQ5Z 1YI2Z 1Q811 1NJI2 1KD12 3CC71 3G711 3I561 1M902 1YIT1 3CC4Z 1VQ51 1YI21 1K9M2 1VQOZ 1KD11 3CMAZ 2QEXZ 1VQNZ 3CC2Z 1VQPZ 3CC41 1K731 1Q862 1VQO1 3CCVZ 1YHQZ 3G4S1 1YJNZ 1Q822 3CCRZ 3CMA1 1VQ9Z 2QEX1 3CCQZ 1VQMZ 1VQKZ 1Q861 1JJ2Z 1JJ2Y 3CC21 1VQP1 1VQ6Z 3CCJZ 3CCV1 1Q821 1NJI1 1YJN1 3CCEZ 1VQ91 3CCQ1 1VQM1 1M901 1VQK1 3OW2Z 3OW2Y 1VQ61 1K9M1 1Q7Y2 3CCJ1 3CCMZ 1KC82 1VQN1 1VQ8Z 3CXCZ 3CCE1 2OTLZ 3CPWZ 1Q7Y1 3CCLZ 3CPWY 1YIJZ 2QA4Z 3CMEZ 1KC81
chains in the Genus database with same CATH superfamily
4RV9A 5IT9f 2LFUA 3GTPI 1YJWZ 4A3CI 4NFRA 3GTKI 4E32A 2V8KA 3CCR1 4A3FI 5LL6f 3CCSZ 5D1OA 2E7ZA 2W03A 5C4JI 5T67A 4E30A 1S72Z 4MD8A 4A3DI 3S1QI 1YJW1 2IV2X 2VUGA 2VPYA 1KQSZ 4HH4A 3CCS1 3S1RI 3CXCY 1S721 3G4SZ 4CL1A 4RVFA 1USPA 1VLAA 4E2WA 1Y8CA 4DQYB 2P28A 2R93I 1Z01A 4MRIA 4NBGA 1QVGZ 1W2BY 1FDOA 1QVFZ 2NVTI 3JAMb 2VUMI 3D2LA 1TWHI 2PM9A 3PO3S 2M6NA 1QYPA 5IT9b 3KIFA 2I3CA 3H3VJ 3NDJA 1M902 2E2II 1WJ2A 2RHBA 2VPWA 3GTMI 3GTGI 2V45A 3VMHA 2R7ZI 2B63I 2YU9I 3CC2Z 3J7A4 3CCVZ 2QRCB 4A3KI 1Q822 1VQMZ 1VQKZ 1RLYA 3CC21 2VPXA 2OZKA 3CCV1 3LUSA 1SFOI 3CCEZ 3CQZI 4DK1A 1VQM1 1M901 1VQK1 3QWUA 1X3WA 5T6BA 1KC82 2YADA 3CCE1 2GTHA 5T64A 2E9HA 3CCLZ 1YIJZ 2GU2A 2JIOA 3CMEZ 4BBRI 3GTMS 2Q4ZA 2R6MA 2AYDA 4X6AI 2DE7A 2JIMA 2RPRA 4RS4A 2JA8I 5C3EI 3I56Z 3NH4A 3CME1 3I55Z 1PFTA 2V3VA 4E2XA 1TWCI 1K8A1 1S7MA 2JA7I 5FLXf 1KQSY 3I4MI 3I551 2J6AA 5AN9F 3HKZA 1M1K1 4NB9A 1RO4A 3BG0B 2JIPA 2IZ4A 1QVGY 2F4OA 4HGYA 4E2ZA 5D1PA 1QVFY 5C4XI 3F3PC 4MD9A 4BY1I 1YUAA 2QLVB 4A3GI 1I3QI 1RNIA 3TDHB 3P5JB 2HF1A 3FQQA 3M4OI 1I6HI 2RIQA 3HOUI 3J80f 1K9M2 1VQOZ 1KD11 1ZH1A 2NVYI 3MZLB 2JS4A 3NH8A 3I07A 1YUKA 4E31A 3GKQA 1VQPZ 4DGLA 1VQO1 1YHQZ 3G4S1 1YJNZ 4NH1C 4AYBA 2PK7A 2OOXB 1WCMI 1VQP1 2IZ3A 3TE5B 3CCJZ 3GTQI 1TWFI 3NDIA 2JA5I 1YJN1 2RBLA 4QTTA 1NUIA 1K9M1 4E2YA 3CCJ1 4NBHA 3CCMZ 3K7AI 1VQ8Z 2VF1A 4NB8A 3CXCZ 2OTLZ 1TWGI 3CPWZ 3S15I 1Q7Y1 3J80b 5FLMI 4RVDA 4QTUA 2QA4Z 1Q16A 4MXUA 4E33A 5C44I 2P3YA 1NP6A 3ESWA 2JNYA 2K3RA 1QXFA 2QREB 3HOYI 3CCM1 1RO0A 3IX0A 3KIHA 4A3JI 1DL6A 2OTL1 1K8A2 2LIYA 2QA41 1N8R1 1JWHC 5CM2M 1VQ4Z 1ML8A 3GTLI 4TNUA 2JR6A 3S17I 1AA6A 2W04A 1M1K2 2HU9A 3GCFA 5D1OB 2KI7B 1VQ41 1RQFA 2QKDA 3PO2I 2OTJZ 2WB1A 4NOZA 2BJOA 3VMIA 3G71Z 3CCL1 3BG1B 1YIJ1 1YITZ 2OTJ1 2AKLA 3IFUA 3S14I 1Q811 3NFZA 1KD12 3S1NI 1USPB 3G711 3I561 3VB9A 1YIT1 3CC4Z 1K83I 5A2Qf 3VMGA 3S1MI 2QEXZ 2O4HA 3D6WA 3RZOI 1VQNZ 3EEDA 2DE5A 2PMZA 3CC41 3HOZI 3S16I 3JAMf 3CCRZ 2JUBA 1VQ9Z 2QEX1 4NBEA 1Q861 1JJ2Z 1ZB8A 1SIWA 1VQ6Z 2JIRA 3M3YI 2DE6A 2QR1B 3I4NI 1I50I 3F3FC 1VQ91 4NBFA 1TFIA 3OW2Z 2E2JI 3IF8A 1ZB9A 1VQ61 1Q7Y2 2R92I 4A3BI 5FLXb 4A3MI 2ZAEB 5IP9I 2V8JA 1RO2A 3Q87A 1Z03A 1WW9A 3CPWY 3D9XA 1Y1VI 5A2Qb 1N2FA 1YJ9Z 2JIQA 1N8R2 1YHQ1 1VQLZ 3S2HI 4A3EI 3CCUZ 1WZNA 1VQ7Z 3VTNA 2JA6I 3HOVI 3CD6Z 2E2HI 1YJ91 4HGZA 4RVGA 1VQL1 4S1TA 2KPIA 3G6EZ 3CCU1 1VQ71 1WIIA 2QRDB 4XX2A 2EGTA 3CD61 1R9TI 1X0TA 3J81f 3G6E1 1K732 2NVXI 1VQ81 3U50C 2V8IA 1W2BZ 3CC7Z 3GTJI 2VPZA 1Q812 4A3LI 1KRLA 3S2DI 1VQ5Z 2NVQI 1TWAI 1YI2Z 2K5RA 1FDIA 4RVHA 3RZDI 4MONA 1NJI2 2NAPA 3CC71 3GTOI 3FQMA 1Y1VS 3HOWI 3T4NB 1VQ51 2G2KA 1YI21 2RT9A 1QF8A 4A3II 3MONA 3HOXI 1X3ZA 2Q51A 4BXXI 3CMAZ 2LEXA 4NBAA 4MD7A 1LQLA 2WAQA 2Y0SA 1Q862 1K731 3FKII 3H0GI 4BBSI 1P9NA 2M48A 3CMA1 3J81b 3CCQZ 1Y1WI 1JJ2Y 1Z02A 1L1OC 1Q821 3NH5A 2GTIA 2H85A 1NJI1 4MH4A 2O53A 4Y52I 2JMOA 4A93I 3IR7A 3CCQ1 2OOYB 3MZKB 4EWCA 3OW2Y 5IP7I 3EERA 4NBBA 4NBCA 4Y7NI 4BY7I 2F4MA 3PO3I 1VQN1 1KC81 4NBDA
chains in the Genus database with same CATH topology
4RV9A 5IT9f 2LFUA 3GTPI 1YJWZ 4A3CI 4NFRA 3GTKI 4E32A 2V8KA 3CCR1 4A3FI 5LL6f 3CCSZ 5D1OA 2W03A 5C4JI 5T67A 4E30A 1S72Z 4MD8A 4A3DI 3S1QI 1YJW1 2VUGA 1KQSZ 4HH4A 3CCS1 3S1RI 3CXCY 1S721 3G4SZ 4CL1A 4RVFA 1USPA 1VLAA 4E2WA 4DQYB 2P28A 2R93I 1Z01A 4MRIA 4NBGA 1QVGZ 1W2BY 1QVFZ 2NVTI 3JAMb 2VUMI 1TWHI 2PM9A 3PO3S 2M6NA 1QYPA 5IT9b 3KIFA 2I3CA 3H3VJ 3NDJA 1M902 2E2II 2RHBA 3GTMI 3GTGI 3VMHA 2R7ZI 2B63I 2YU9I 3CC2Z 3J7A4 3CCVZ 2QRCB 4A3KI 1Q822 1VQMZ 1VQKZ 1RLYA 3CC21 2OZKA 3CCV1 3LUSA 1SFOI 3CCEZ 3CQZI 4DK1A 1VQM1 1M901 1VQK1 3QWUA 1X3WA 5T6BA 1KC82 2YADA 3CCE1 2GTHA 5T64A 2E9HA 3CCLZ 1YIJZ 2GU2A 3CMEZ 4BBRI 3GTMS 2Q4ZA 2R6MA 4X6AI 2DE7A 2RPRA 4RS4A 2JA8I 5C3EI 3I56Z 3NH4A 3CME1 3I55Z 1PFTA 4E2XA 1TWCI 1K8A1 1S7MA 2JA7I 5FLXf 1KQSY 3I4MI 3I551 2J6AA 5AN9F 3HKZA 1M1K1 4NB9A 1RO4A 3BG0B 2IZ4A 1QVGY 2F4OA 4HGYA 4E2ZA 5D1PA 1QVFY 5C4XI 3F3PC 4MD9A 4BY1I 1YUAA 2QLVB 4A3GI 1I3QI 1RNIA 3TDHB 3P5JB 2HF1A 3FQQA 3M4OI 1I6HI 2RIQA 3HOUI 3J80f 1K9M2 1VQOZ 1KD11 1ZH1A 2NVYI 3MZLB 2JS4A 3NH8A 3I07A 1YUKA 4E31A 3GKQA 1VQPZ 4DGLA 1VQO1 1YHQZ 3G4S1 1YJNZ 4NH1C 4AYBA 2PK7A 2OOXB 1WCMI 1VQP1 2IZ3A 3TE5B 3CCJZ 3GTQI 1TWFI 3NDIA 2JA5I 1YJN1 2RBLA 4QTTA 1NUIA 1K9M1 4E2YA 3CCJ1 4NBHA 3CCMZ 3K7AI 1VQ8Z 2VF1A 4NB8A 3CXCZ 2OTLZ 1TWGI 3CPWZ 3S15I 1Q7Y1 3J80b 5FLMI 4RVDA 4QTUA 2QA4Z 4MXUA 4E33A 5C44I 2P3YA 1NP6A 3ESWA 2JNYA 2K3RA 2QREB 3HOYI 3CCM1 1RO0A 3IX0A 3KIHA 4A3JI 1DL6A 2OTL1 1K8A2 2LIYA 2QA41 1N8R1 1JWHC 5CM2M 1VQ4Z 1ML8A 3GTLI 4TNUA 2JR6A 3S17I 2W04A 1M1K2 2HU9A 3GCFA 5D1OB 2KI7B 1VQ41 1RQFA 2QKDA 3PO2I 2OTJZ 2WB1A 4NOZA 2BJOA 3VMIA 3G71Z 3CCL1 3BG1B 1YIJ1 1YITZ 2OTJ1 2AKLA 3IFUA 3S14I 1Q811 3NFZA 1KD12 3S1NI 1USPB 3G711 3I561 3VB9A 1YIT1 3CC4Z 1K83I 5A2Qf 3VMGA 3S1MI 2QEXZ 2O4HA 3D6WA 3RZOI 1VQNZ 3EEDA 2DE5A 2PMZA 3CC41 3HOZI 3S16I 3JAMf 3CCRZ 2JUBA 1VQ9Z 2QEX1 4NBEA 1Q861 1JJ2Z 1ZB8A 1VQ6Z 3M3YI 2DE6A 2QR1B 3I4NI 1I50I 3F3FC 1VQ91 4NBFA 1TFIA 3OW2Z 2E2JI 3IF8A 1ZB9A 1VQ61 1Q7Y2 2R92I 4A3BI 5FLXb 4A3MI 2ZAEB 5IP9I 2V8JA 1RO2A 3Q87A 1Z03A 1WW9A 3CPWY 3D9XA 1Y1VI 5A2Qb 1N2FA 1YJ9Z 1N8R2 1YHQ1 1VQLZ 3S2HI 4A3EI 3CCUZ 1VQ7Z 3VTNA 2JA6I 3HOVI 3CD6Z 2E2HI 1YJ91 4HGZA 4RVGA 1VQL1 4S1TA 2KPIA 3G6EZ 3CCU1 1VQ71 1WIIA 2QRDB 4XX2A 2EGTA 3CD61 1R9TI 1X0TA 3J81f 3G6E1 1K732 2NVXI 1VQ81 3U50C 2V8IA 1W2BZ 3CC7Z 3GTJI 1Q812 4A3LI 1KRLA 3S2DI 1VQ5Z 2NVQI 1TWAI 1YI2Z 2K5RA 4RVHA 3RZDI 4MONA 1NJI2 3CC71 3GTOI 3FQMA 1Y1VS 3HOWI 3T4NB 1VQ51 2G2KA 1YI21 2RT9A 1QF8A 4A3II 3MONA 3HOXI 1X3ZA 2Q51A 4BXXI 3CMAZ 4NBAA 4MD7A 1LQLA 2WAQA 2Y0SA 1Q862 1K731 3FKII 3H0GI 4BBSI 1P9NA 2M48A 3CMA1 3J81b 3CCQZ 1Y1WI 1JJ2Y 1Z02A 1L1OC 1Q821 3NH5A 2GTIA 2H85A 1NJI1 4MH4A 2O53A 4Y52I 2JMOA 4A93I 3CCQ1 2OOYB 3MZKB 4EWCA 3OW2Y 5IP7I 3EERA 4NBBA 4NBCA 4Y7NI 4BY7I 2F4MA 3PO3I 1VQN1 1KC81 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  1N8R 2;  3CCM 1;  1YHQ 1;  1YJW Z;  1VQL Z;  3CCU Z;  3CCR 1;  2OTL 1;  1K8A 2;  3CCS Z;  1VQ7 Z;  3I56 Z;  2QA4 1;  3CME 1;  1N8R 1;  3I55 Z;  3CD6 Z;  1YJ9 1;  1S72 Z;  1VQ4 Z;  1YJW 1;  1K8A 1;  1VQL 1;  3G6E Z;  1KQS Z;  3CCU 1;  1KQS Y;  3CCS 1;  1VQ7 1;  3CXC Y;  1M1K 2;  3I55 1;  3CD6 1;  1S72 1;  1VQ4 1;  3G4S Z;  2OTJ Z;  3G6E 1;  1K73 2;  1M1K 1;  1VQ8 1;  1W2B Z;  3CC7 Z;  1QVG Z;  1W2B Y;  3G71 Z;  1Q81 2;  1QVG Y;  3CCL 1;  1YIJ 1;  1QVF Z;  1QVF Y;  1YIT Z;  2OTJ 1;  1VQ5 Z;  1YI2 Z;  1Q81 1;  1NJI 2;  1KD1 2;  3CC7 1;  3G71 1;  3I56 1;  1M90 2;  1YIT 1;  3CC4 Z;  1VQ5 1;  1YI2 1;  1K9M 2;  1VQO Z;  1KD1 1;  3CMA Z;  2QEX Z;  1VQN Z;  3CC2 Z;  1VQP Z;  3CC4 1;  1K73 1;  1Q86 2;  1VQO 1;  3CCV Z;  1YHQ Z;  3G4S 1;  1YJN Z;  1Q82 2;  3CCR Z;  3CMA 1;  1VQ9 Z;  2QEX 1;  3CCQ Z;  1VQM Z;  1VQK Z;  1Q86 1;  1JJ2 Z;  1JJ2 Y;  3CC2 1;  1VQP 1;  1VQ6 Z;  3CCJ Z;  3CCV 1;  1Q82 1;  1NJI 1;  1YJN 1;  3CCE Z;  1VQ9 1;  3CCQ 1;  1VQM 1;  1M90 1;  1VQK 1;  3OW2 Z;  3OW2 Y;  1VQ6 1;  1K9M 1;  1Q7Y 2;  3CCJ 1;  3CCM Z;  1KC8 2;  1VQN 1;  1VQ8 Z;  3CXC Z;  3CCE 1;  2OTL Z;  3CPW Z;  1Q7Y 1;  3CCL Z;  3CPW Y;  1YIJ Z;  2QA4 Z;  3CME Z;  1KC8 1; 
#chains in the Genus database with same CATH topology
 4RV9 A;  5IT9 f;  2LFU A;  3GTP I;  1YJW Z;  4A3C I;  4NFR A;  3GTK I;  4E32 A;  2V8K A;  3CCR 1;  4A3F I;  5LL6 f;  3CCS Z;  5D1O A;  2E7Z A;  2W03 A;  5C4J I;  5T67 A;  4E30 A;  1S72 Z;  4MD8 A;  4A3D I;  3S1Q I;  1YJW 1;  2IV2 X;  2VUG A;  2VPY A;  1KQS Z;  4HH4 A;  3CCS 1;  3S1R I;  3CXC Y;  1S72 1;  3G4S Z;  4CL1 A;  4RVF A;  1USP A;  1VLA A;  4E2W A;  1Y8C A;  4DQY B;  2P28 A;  2R93 I;  1Z01 A;  4MRI A;  4NBG A;  1QVG Z;  1W2B Y;  1FDO A;  1QVF Z;  2NVT I;  3JAM b;  2VUM I;  3D2L A;  1TWH I;  2PM9 A;  3PO3 S;  2M6N A;  1QYP A;  5IT9 b;  3KIF A;  2I3C A;  3H3V J;  3NDJ A;  1M90 2;  2E2I I;  1WJ2 A;  2RHB A;  2VPW A;  3GTM I;  3GTG I;  2V45 A;  3VMH A;  2R7Z I;  2B63 I;  2YU9 I;  3CC2 Z;  3J7A 4;  3CCV Z;  2QRC B;  4A3K I;  1Q82 2;  1VQM Z;  1VQK Z;  1RLY A;  3CC2 1;  2VPX A;  2OZK A;  3CCV 1;  3LUS A;  1SFO I;  3CCE Z;  3CQZ I;  4DK1 A;  1VQM 1;  1M90 1;  1VQK 1;  3QWU A;  1X3W A;  5T6B A;  1KC8 2;  2YAD A;  3CCE 1;  2GTH A;  5T64 A;  2E9H A;  3CCL Z;  1YIJ Z;  2GU2 A;  2JIO A;  3CME Z;  4BBR I;  3GTM S;  2Q4Z A;  2R6M A;  2AYD A;  4X6A I;  2DE7 A;  2JIM A;  2RPR A;  4RS4 A;  2JA8 I;  5C3E I;  3I56 Z;  3NH4 A;  3CME 1;  3I55 Z;  1PFT A;  2V3V A;  4E2X A;  1TWC I;  1K8A 1;  1S7M A;  2JA7 I;  5FLX f;  1KQS Y;  3I4M I;  3I55 1;  2J6A A;  5AN9 F;  3HKZ A;  1M1K 1;  4NB9 A;  1RO4 A;  3BG0 B;  2JIP A;  2IZ4 A;  1QVG Y;  2F4O A;  4HGY A;  4E2Z A;  5D1P A;  1QVF Y;  5C4X I;  3F3P C;  4MD9 A;  4BY1 I;  1YUA A;  2QLV B;  4A3G I;  1I3Q I;  1RNI A;  3TDH B;  3P5J B;  2HF1 A;  3FQQ A;  3M4O I;  1I6H I;  2RIQ A;  3HOU I;  3J80 f;  1K9M 2;  1VQO Z;  1KD1 1;  1ZH1 A;  2NVY I;  3MZL B;  2JS4 A;  3NH8 A;  3I07 A;  1YUK A;  4E31 A;  3GKQ A;  1VQP Z;  4DGL A;  1VQO 1;  1YHQ Z;  3G4S 1;  1YJN Z;  4NH1 C;  4AYB A;  2PK7 A;  2OOX B;  1WCM I;  1VQP 1;  2IZ3 A;  3TE5 B;  3CCJ Z;  3GTQ I;  1TWF I;  3NDI A;  2JA5 I;  1YJN 1;  2RBL A;  4QTT A;  1NUI A;  1K9M 1;  4E2Y A;  3CCJ 1;  4NBH A;  3CCM Z;  3K7A I;  1VQ8 Z;  2VF1 A;  4NB8 A;  3CXC Z;  2OTL Z;  1TWG I;  3CPW Z;  3S15 I;  1Q7Y 1;  3J80 b;  5FLM I;  4RVD A;  4QTU A;  2QA4 Z;  1Q16 A;  4MXU A;  4E33 A;  5C44 I;  2P3Y A;  1NP6 A;  3ESW A;  2JNY A;  2K3R A;  1QXF A;  2QRE B;  3HOY I;  3CCM 1;  1RO0 A;  3IX0 A;  3KIH A;  4A3J I;  1DL6 A;  2OTL 1;  1K8A 2;  2LIY A;  2QA4 1;  1N8R 1;  1JWH C;  5CM2 M;  1VQ4 Z;  1ML8 A;  3GTL I;  4TNU A;  2JR6 A;  3S17 I;  1AA6 A;  2W04 A;  1M1K 2;  2HU9 A;  3GCF A;  5D1O B;  2KI7 B;  1VQ4 1;  1RQF A;  2QKD A;  3PO2 I;  2OTJ Z;  2WB1 A;  4NOZ A;  2BJO A;  3VMI A;  3G71 Z;  3CCL 1;  3BG1 B;  1YIJ 1;  1YIT Z;  2OTJ 1;  2AKL A;  3IFU A;  3S14 I;  1Q81 1;  3NFZ A;  1KD1 2;  3S1N I;  1USP B;  3G71 1;  3I56 1;  3VB9 A;  1YIT 1;  3CC4 Z;  1K83 I;  5A2Q f;  3VMG A;  3S1M I;  2QEX Z;  2O4H A;  3D6W A;  3RZO I;  1VQN Z;  3EED A;  2DE5 A;  2PMZ A;  3CC4 1;  3HOZ I;  3S16 I;  3JAM f;  3CCR Z;  2JUB A;  1VQ9 Z;  2QEX 1;  4NBE A;  1Q86 1;  1JJ2 Z;  1ZB8 A;  1SIW A;  1VQ6 Z;  2JIR A;  3M3Y I;  2DE6 A;  2QR1 B;  3I4N I;  1I50 I;  3F3F C;  1VQ9 1;  4NBF A;  1TFI A;  3OW2 Z;  2E2J I;  3IF8 A;  1ZB9 A;  1VQ6 1;  1Q7Y 2;  2R92 I;  4A3B I;  5FLX b;  4A3M I;  2ZAE B;  5IP9 I;  2V8J A;  1RO2 A;  3Q87 A;  1Z03 A;  1WW9 A;  3CPW Y;  3D9X A;  1Y1V I;  5A2Q b;  1N2F A;  1YJ9 Z;  2JIQ A;  1N8R 2;  1YHQ 1;  1VQL Z;  3S2H I;  4A3E I;  3CCU Z;  1WZN A;  1VQ7 Z;  3VTN A;  2JA6 I;  3HOV I;  3CD6 Z;  2E2H I;  1YJ9 1;  4HGZ A;  4RVG A;  1VQL 1;  4S1T A;  2KPI A;  3G6E Z;  3CCU 1;  1VQ7 1;  1WII A;  2QRD B;  4XX2 A;  2EGT A;  3CD6 1;  1R9T I;  1X0T A;  3J81 f;  3G6E 1;  1K73 2;  2NVX I;  1VQ8 1;  3U50 C;  2V8I A;  1W2B Z;  3CC7 Z;  3GTJ I;  2VPZ A;  1Q81 2;  4A3L I;  1KRL A;  3S2D I;  1VQ5 Z;  2NVQ I;  1TWA I;  1YI2 Z;  2K5R A;  1FDI A;  4RVH A;  3RZD I;  4MON A;  1NJI 2;  2NAP A;  3CC7 1;  3GTO I;  3FQM A;  1Y1V S;  3HOW I;  3T4N B;  1VQ5 1;  2G2K A;  1YI2 1;  2RT9 A;  1QF8 A;  4A3I I;  3MON A;  3HOX I;  1X3Z A;  2Q51 A;  4BXX I;  3CMA Z;  2LEX A;  4NBA A;  4MD7 A;  1LQL A;  2WAQ A;  2Y0S A;  1Q86 2;  1K73 1;  3FKI I;  3H0G I;  4BBS I;  1P9N A;  2M48 A;  3CMA 1;  3J81 b;  3CCQ Z;  1Y1W I;  1JJ2 Y;  1Z02 A;  1L1O C;  1Q82 1;  3NH5 A;  2GTI A;  2H85 A;  1NJI 1;  4MH4 A;  2O53 A;  4Y52 I;  2JMO A;  4A93 I;  3IR7 A;  3CCQ 1;  2OOY B;  3MZK B;  4EWC A;  3OW2 Y;  5IP7 I;  3EER A;  4NBB A;  4NBC A;  4Y7N I;  4BY7 I;  2F4M A;  3PO3 I;  1VQN 1;  1KC8 1;  4NBD A; 
#chains in the Genus database with same CATH homology
 4RV9 A;  5IT9 f;  2LFU A;  3GTP I;  1YJW Z;  4A3C I;  4NFR A;  3GTK I;  4E32 A;  2V8K A;  3CCR 1;  4A3F I;  5LL6 f;  3CCS Z;  5D1O A;  2W03 A;  5C4J I;  5T67 A;  4E30 A;  1S72 Z;  4MD8 A;  4A3D I;  3S1Q I;  1YJW 1;  2VUG A;  1KQS Z;  4HH4 A;  3CCS 1;  3S1R I;  3CXC Y;  1S72 1;  3G4S Z;  4CL1 A;  4RVF A;  1USP A;  1VLA A;  4E2W A;  4DQY B;  2P28 A;  2R93 I;  1Z01 A;  4MRI A;  4NBG A;  1QVG Z;  1W2B Y;  1QVF Z;  2NVT I;  3JAM b;  2VUM I;  1TWH I;  2PM9 A;  3PO3 S;  2M6N A;  1QYP A;  5IT9 b;  3KIF A;  2I3C A;  3H3V J;  3NDJ A;  1M90 2;  2E2I I;  2RHB A;  3GTM I;  3GTG I;  3VMH A;  2R7Z I;  2B63 I;  2YU9 I;  3CC2 Z;  3J7A 4;  3CCV Z;  2QRC B;  4A3K I;  1Q82 2;  1VQM Z;  1VQK Z;  1RLY A;  3CC2 1;  2OZK A;  3CCV 1;  3LUS A;  1SFO I;  3CCE Z;  3CQZ I;  4DK1 A;  1VQM 1;  1M90 1;  1VQK 1;  3QWU A;  1X3W A;  5T6B A;  1KC8 2;  2YAD A;  3CCE 1;  2GTH A;  5T64 A;  2E9H A;  3CCL Z;  1YIJ Z;  2GU2 A;  3CME Z;  4BBR I;  3GTM S;  2Q4Z A;  2R6M A;  4X6A I;  2DE7 A;  2RPR A;  4RS4 A;  2JA8 I;  5C3E I;  3I56 Z;  3NH4 A;  3CME 1;  3I55 Z;  1PFT A;  4E2X A;  1TWC I;  1K8A 1;  1S7M A;  2JA7 I;  5FLX f;  1KQS Y;  3I4M I;  3I55 1;  2J6A A;  5AN9 F;  3HKZ A;  1M1K 1;  4NB9 A;  1RO4 A;  3BG0 B;  2IZ4 A;  1QVG Y;  2F4O A;  4HGY A;  4E2Z A;  5D1P A;  1QVF Y;  5C4X I;  3F3P C;  4MD9 A;  4BY1 I;  1YUA A;  2QLV B;  4A3G I;  1I3Q I;  1RNI A;  3TDH B;  3P5J B;  2HF1 A;  3FQQ A;  3M4O I;  1I6H I;  2RIQ A;  3HOU I;  3J80 f;  1K9M 2;  1VQO Z;  1KD1 1;  1ZH1 A;  2NVY I;  3MZL B;  2JS4 A;  3NH8 A;  3I07 A;  1YUK A;  4E31 A;  3GKQ A;  1VQP Z;  4DGL A;  1VQO 1;  1YHQ Z;  3G4S 1;  1YJN Z;  4NH1 C;  4AYB A;  2PK7 A;  2OOX B;  1WCM I;  1VQP 1;  2IZ3 A;  3TE5 B;  3CCJ Z;  3GTQ I;  1TWF I;  3NDI A;  2JA5 I;  1YJN 1;  2RBL A;  4QTT A;  1NUI A;  1K9M 1;  4E2Y A;  3CCJ 1;  4NBH A;  3CCM Z;  3K7A I;  1VQ8 Z;  2VF1 A;  4NB8 A;  3CXC Z;  2OTL Z;  1TWG I;  3CPW Z;  3S15 I;  1Q7Y 1;  3J80 b;  5FLM I;  4RVD A;  4QTU A;  2QA4 Z;  4MXU A;  4E33 A;  5C44 I;  2P3Y A;  1NP6 A;  3ESW A;  2JNY A;  2K3R A;  2QRE B;  3HOY I;  3CCM 1;  1RO0 A;  3IX0 A;  3KIH A;  4A3J I;  1DL6 A;  2OTL 1;  1K8A 2;  2LIY A;  2QA4 1;  1N8R 1;  1JWH C;  5CM2 M;  1VQ4 Z;  1ML8 A;  3GTL I;  4TNU A;  2JR6 A;  3S17 I;  2W04 A;  1M1K 2;  2HU9 A;  3GCF A;  5D1O B;  2KI7 B;  1VQ4 1;  1RQF A;  2QKD A;  3PO2 I;  2OTJ Z;  2WB1 A;  4NOZ A;  2BJO A;  3VMI A;  3G71 Z;  3CCL 1;  3BG1 B;  1YIJ 1;  1YIT Z;  2OTJ 1;  2AKL A;  3IFU A;  3S14 I;  1Q81 1;  3NFZ A;  1KD1 2;  3S1N I;  1USP B;  3G71 1;  3I56 1;  3VB9 A;  1YIT 1;  3CC4 Z;  1K83 I;  5A2Q f;  3VMG A;  3S1M I;  2QEX Z;  2O4H A;  3D6W A;  3RZO I;  1VQN Z;  3EED A;  2DE5 A;  2PMZ A;  3CC4 1;  3HOZ I;  3S16 I;  3JAM f;  3CCR Z;  2JUB A;  1VQ9 Z;  2QEX 1;  4NBE A;  1Q86 1;  1JJ2 Z;  1ZB8 A;  1VQ6 Z;  3M3Y I;  2DE6 A;  2QR1 B;  3I4N I;  1I50 I;  3F3F C;  1VQ9 1;  4NBF A;  1TFI A;  3OW2 Z;  2E2J I;  3IF8 A;  1ZB9 A;  1VQ6 1;  1Q7Y 2;  2R92 I;  4A3B I;  5FLX b;  4A3M I;  2ZAE B;  5IP9 I;  2V8J A;  1RO2 A;  3Q87 A;  1Z03 A;  1WW9 A;  3CPW Y;  3D9X A;  1Y1V I;  5A2Q b;  1N2F A;  1YJ9 Z;  1N8R 2;  1YHQ 1;  1VQL Z;  3S2H I;  4A3E I;  3CCU Z;  1VQ7 Z;  3VTN A;  2JA6 I;  3HOV I;  3CD6 Z;  2E2H I;  1YJ9 1;  4HGZ A;  4RVG A;  1VQL 1;  4S1T A;  2KPI A;  3G6E Z;  3CCU 1;  1VQ7 1;  1WII A;  2QRD B;  4XX2 A;  2EGT A;  3CD6 1;  1R9T I;  1X0T A;  3J81 f;  3G6E 1;  1K73 2;  2NVX I;  1VQ8 1;  3U50 C;  2V8I A;  1W2B Z;  3CC7 Z;  3GTJ I;  1Q81 2;  4A3L I;  1KRL A;  3S2D I;  1VQ5 Z;  2NVQ I;  1TWA I;  1YI2 Z;  2K5R A;  4RVH A;  3RZD I;  4MON A;  1NJI 2;  3CC7 1;  3GTO I;  3FQM A;  1Y1V S;  3HOW I;  3T4N B;  1VQ5 1;  2G2K A;  1YI2 1;  2RT9 A;  1QF8 A;  4A3I I;  3MON A;  3HOX I;  1X3Z A;  2Q51 A;  4BXX I;  3CMA Z;  4NBA A;  4MD7 A;  1LQL A;  2WAQ A;  2Y0S A;  1Q86 2;  1K73 1;  3FKI I;  3H0G I;  4BBS I;  1P9N A;  2M48 A;  3CMA 1;  3J81 b;  3CCQ Z;  1Y1W I;  1JJ2 Y;  1Z02 A;  1L1O C;  1Q82 1;  3NH5 A;  2GTI A;  2H85 A;  1NJI 1;  4MH4 A;  2O53 A;  4Y52 I;  2JMO A;  4A93 I;  3CCQ 1;  2OOY B;  3MZK B;  4EWC A;  3OW2 Y;  5IP7 I;  3EER A;  4NBB A;  4NBC A;  4Y7N I;  4BY7 I;  2F4M A;  3PO3 I;  1VQN 1;  1KC8 1;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...