1YITZ

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yitZ00
1VQ8Z 1YJW1 1KC82 1VQNZ 3G711 1M1K1 3G4SZ 1VQMZ 1M902 1VQL1 1VQ81 2OTL1 1YJN1 1YHQZ 1QVGY 3CCQZ 1QVGZ 1VQN1 1K8A2 3I55Z 3CCSZ 1VQ41 1KD11 1Q7Y1 1VQM1 3CC7Z 3CCS1 1NJI1 1Q822 3CCUZ 1VQ91 1YITZ 1K731 3CCRZ 3CPWZ 3CPWY 1VQK1 1K9M1 3CCMZ 1YIT1 1JJ2Y 1JJ2Z 1N8R1 3CCE1 2QA4Z 3CMAZ 3I56Z 1VQ5Z 1K9M2 3G4S1 1M1K2 3CC2Z 2QA41 3OW2Z 3OW2Y 1YI2Z 1N8R2 1VQPZ 1YHQ1 3CCQ1 1S72Z 3I551 1KD12 3CC21 1Q7Y2 1YI21 1VQP1 3CC71 2QEXZ 1NJI2 1YJ9Z 3CCU1 1W2BZ 3CCR1 1YIJZ 1K732 3CCVZ 1VQ7Z 2QEX1 1Q811 1VQOZ 3CMEZ 3CD6Z 3CCM1 1Q861 1KQSZ 1KQSY 3G6EZ 2OTLZ 1YIJ1 1VQ71 1VQO1 1KC81 1YJWZ 3CC4Z 3CMA1 3I561 3CME1 1VQ51 3CD61 3G71Z 3CCJZ 1M901 2OTJZ 1VQLZ 1YJNZ 3CCLZ 3CC41 1K8A1 3CCJ1 1S721 1VQ4Z 2OTJ1 3CCL1 1W2BY 1QVFZ 1YJ91 1VQ9Z 1VQ6Z 1Q821 1VQKZ 3CCV1 1Q812 3CXCY 3CXCZ 1Q862 3G6E1 1VQ61 1QVFY 3CCEZ
chains in the Genus database with same CATH superfamily
2E2HI 1YUAA 5FLXb 1Y1VI 3HKZA 2ZAEB 3NDJA 3NFZA 2H85A 1PFTA 1R9TI 1TWGI 3H3VJ 4E2ZA 3EERA 1VQN1 2E9HA 2JNYA 4A3JI 1VQM1 2VPWA 2LEXA 2JUBA 4RS4A 2R6MA 1X3ZA 1S7MA 1ZB8A 1K731 2Q51A 5CM2M 2YU9I 1P9NA 1Z03A 2M6NA 1N8R1 4A3KI 4NB8A 1SFOI 2QA41 1Z01A 1YHQ1 3NH4A 3P5JB 3TE5B 4MD9A 2JIPA 3CC21 1VQP1 2DE5A 1JWHC 3CC71 1WCMI 4RVDA 2JA6I 1RO0A 2JA7I 2W04A 3GTOI 1W2BZ 2LFUA 3CCR1 1K732 1Q811 4NBDA 4HH4A 3K7AI 4MONA 2VUGA 1TWCI 3CCM1 4NBGA 1YIJ1 2RIQA 3CC4Z 5C3EI 5D1OA 3CME1 3T4NB 1VQ51 2IZ3A 1M901 4RVFA 3VMHA 1YJNZ 5T6BA 2PM9A 1Z02A 2B63I 2QR1B 2RBLA 4NBBA 1S721 1VQ4Z 4BY7I 3GTMI 4NH1C 2OTJ1 2JS4A 3J7A4 3CCL1 4DK1A 4A3II 3MZLB 2OOXB 1TWAI 2Y0SA 3BG0B 3U50C 1I3QI 1VQ6Z 1VQKZ 1Q812 2NVQI 3JAMf 4MD7A 4DQYB 2OTL1 4A3LI 1QVFY 1QVFZ 1VQ8Z 1LQLA 3HOUI 3D9XA 3F3PC 1AA6A 1NUIA 4NBCA 1VLAA 1M902 1VQL1 2QRCB 1TFIA 1QVGY 1QVGZ 3CCSZ 3PO3S 2PMZA 3LUSA 3BG1B 3NH8A 5IT9f 1USPA 1USPB 5C44I 3CCUZ 1VQ91 1YITZ 1TWFI 3NH5A 1X3WA 1RO4A 2JA5I 3S15I 3CPWZ 3CPWY 2R7ZI 4BBSI 3FQQA 1JJ2Y 1JJ2Z 3CQZI 1L1OC 2RHBA 1K9M2 2F4OA 2P28A 1N2FA 2OOYB 3S1NI 3G4S1 3S2HI 1YI2Z 3GCFA 3CCQ1 3I551 2WAQA 4MXUA 2KPIA 2DE7A 1YJ9Z 2VPYA 3CCVZ 1VQ7Z 4A3GI 2GTIA 1WW9A 1VQOZ 3RZOI 3S1QI 4S1TA 3CD6Z 4BBRI 3VMGA 1KQSZ 1KQSY 3G6EZ 5IP7I 2F4MA 2I3CA 3CMA1 3Q87A 3I561 4E2YA 4A3CI 2QRDB 4E2XA 4NBAA 5FLXf 4A3EI 3S16I 5FLMI 4MD8A 3IF8A 3CC41 4NOZA 1WZNA 3VB9A 1W2BY 3S17I 5AN9F 3GKQA 3J80b 2P3YA 2V3VA 1RLYA 4AYBA 2VPXA 4BY1I 2V8KA 4A3BI 1Y1VS 2OZKA 1ZB9A 2NVYI 3CXCY 4CL1A 3CXCZ 2HF1A 1VQ61 3KIHA 2IZ4A 1YJW1 4HGYA 4QTUA 2JIQA 4Y7NI 5A2Qb 3G711 2O4HA 2JMOA 4E32A 2E2JI 1VQ81 1YHQZ 4E31A 2HU9A 1I50I 1KRLA 1ML8A 1WIIA 3J81b 3CC7Z 2YADA 3CCS1 1NJI1 2QKDA 2R93I 3CCRZ 4DGLA 5T67A 1K9M1 1SIWA 3CCMZ 1YIT1 5LL6f 3CCE1 3M4OI 1QYPA 3EEDA 1VQ5Z 3HOWI 2NAPA 3HOYI 2M48A 3OW2Z 2PK7A 3OW2Y 2JIOA 2KI7B 3GTKI 4E2WA 4HGZA 3D6WA 1S72Z 2JR6A 3M3YI 1YI21 2QEXZ 2AKLA 5D1PA 1NJI2 4NBEA 3HOZI 2JIRA 3QWUA 2RT9A 4XX2A 3RZDI 3S1MI 1Q861 2V45A 2OTLZ 4Y52I 1VQ71 1VQO1 1KC81 2NVTI 3CD61 3KIFA 3MONA 2Q4ZA 3CCJZ 3FKII 3I07A 1VQLZ 3HOVI 1K8A1 1NP6A 2QLVB 5C4XI 2E2II 1ZH1A 2O53A 2K5RA 1VQ9Z 2K3RA 3D2LA 4E30A 3GTGI 3S1RI 3F3FC 2BJOA 1Q862 1QF8A 1Y1WI 1Q822 3MZKB 1KC82 3S2DI 1FDOA 4NFRA 1VQNZ 1M1K1 3VMIA 3G4SZ 4MRIA 1VQMZ 4MH4A 3I4NI 1YJN1 4TNUA 2NVXI 3CCQZ 1K8A2 3I55Z 4QTTA 1VQ41 1KD11 2AYDA 2LIYA 1Q7Y1 1DL6A 4EWCA 1RO2A 5C4JI 2W03A 2VPZA 3H0GI 1K83I 3PO3I 1X0TA 2GTHA 1TWHI 3JAMb 1VQK1 4A93I 2QREB 2V8JA 2G2KA 2WB1A 2QA4Z 3CMAZ 3I56Z 1M1K2 3NDIA 1QXFA 3CC2Z 5D1OB 1N8R2 1VQPZ 3GTQI 3HOXI 1YUKA 3VTNA 1KD12 1Y8CA 1Q7Y2 2IV2X 5IT9b 5T64A 2R92I 3J80f 3GTJI 3CCU1 2DE6A 1YIJZ 4NBFA 2QEX1 3ESWA 3TDHB 3CMEZ 2VF1A 1YJWZ 1Q16A 5IP9I 3PO2I 3G71Z 3IFUA 4A3FI 1RQFA 2OTJZ 4X6AI 3IR7A 5A2Qf 2E7ZA 3CCLZ 4RV9A 3IX0A 4NB9A 3CCJ1 2JA8I 1FDIA 3I4MI 1I6HI 2RPRA 2V8IA 4A3MI 3J81f 4RVHA 2GU2A 1YJ91 2VUMI 4RVGA 3GTPI 4NBHA 2EGTA 2J6AA 1Q821 3CCV1 3GTLI 4A3DI 3FQMA 4BXXI 1RNIA 3S14I 4E33A 3GTMS 1WJ2A 3G6E1 2JIMA 3CCEZ
chains in the Genus database with same CATH topology
2E2HI 1YUAA 5FLXb 1Y1VI 3HKZA 2ZAEB 3NDJA 3NFZA 2H85A 1PFTA 1R9TI 1TWGI 3H3VJ 4E2ZA 3EERA 1VQN1 2E9HA 2JNYA 4A3JI 1VQM1 2JUBA 4RS4A 2R6MA 1X3ZA 1S7MA 1ZB8A 1K731 2Q51A 5CM2M 2YU9I 1P9NA 1Z03A 2M6NA 1N8R1 4A3KI 4NB8A 1SFOI 2QA41 1Z01A 1YHQ1 3NH4A 3P5JB 3TE5B 4MD9A 3CC21 1VQP1 2DE5A 1JWHC 3CC71 1WCMI 4RVDA 2JA6I 1RO0A 2JA7I 2W04A 3GTOI 1W2BZ 2LFUA 3CCR1 1K732 1Q811 4NBDA 4HH4A 3K7AI 4MONA 2VUGA 1TWCI 3CCM1 4NBGA 1YIJ1 2RIQA 3CC4Z 5C3EI 5D1OA 3CME1 3T4NB 1VQ51 2IZ3A 1M901 4RVFA 3VMHA 1YJNZ 5T6BA 2PM9A 1Z02A 2B63I 2QR1B 2RBLA 4NBBA 1S721 1VQ4Z 4BY7I 3GTMI 4NH1C 2OTJ1 2JS4A 3J7A4 3CCL1 4DK1A 4A3II 3MZLB 2OOXB 1TWAI 2Y0SA 3BG0B 3U50C 1I3QI 1VQ6Z 1VQKZ 1Q812 2NVQI 3JAMf 4MD7A 4DQYB 2OTL1 4A3LI 1QVFY 1QVFZ 1VQ8Z 1LQLA 3HOUI 3D9XA 3F3PC 1NUIA 4NBCA 1VLAA 1M902 1VQL1 2QRCB 1TFIA 1QVGY 1QVGZ 3CCSZ 3PO3S 2PMZA 3LUSA 3BG1B 3NH8A 5IT9f 1USPA 1USPB 5C44I 3CCUZ 1VQ91 1YITZ 1TWFI 3NH5A 1X3WA 1RO4A 2JA5I 3S15I 3CPWZ 3CPWY 2R7ZI 4BBSI 3FQQA 1JJ2Y 1JJ2Z 3CQZI 1L1OC 2RHBA 1K9M2 2F4OA 2P28A 1N2FA 2OOYB 3S1NI 3G4S1 3S2HI 1YI2Z 3GCFA 3CCQ1 3I551 2WAQA 4MXUA 2KPIA 2DE7A 1YJ9Z 3CCVZ 1VQ7Z 4A3GI 2GTIA 1WW9A 1VQOZ 3RZOI 3S1QI 4S1TA 3CD6Z 4BBRI 3VMGA 1KQSZ 1KQSY 3G6EZ 5IP7I 2F4MA 2I3CA 3CMA1 3Q87A 3I561 4E2YA 4A3CI 2QRDB 4E2XA 4NBAA 5FLXf 4A3EI 3S16I 5FLMI 4MD8A 3IF8A 3CC41 4NOZA 3VB9A 1W2BY 3S17I 5AN9F 3GKQA 3J80b 2P3YA 1RLYA 4AYBA 4BY1I 2V8KA 4A3BI 1Y1VS 2OZKA 1ZB9A 2NVYI 3CXCY 4CL1A 3CXCZ 2HF1A 1VQ61 3KIHA 2IZ4A 1YJW1 4HGYA 4QTUA 4Y7NI 5A2Qb 3G711 2O4HA 2JMOA 4E32A 2E2JI 1VQ81 1YHQZ 4E31A 2HU9A 1I50I 1KRLA 1ML8A 1WIIA 3J81b 3CC7Z 2YADA 3CCS1 1NJI1 2QKDA 2R93I 3CCRZ 4DGLA 5T67A 1K9M1 3CCMZ 1YIT1 5LL6f 3CCE1 3M4OI 1QYPA 3EEDA 1VQ5Z 3HOWI 3HOYI 2M48A 3OW2Z 2PK7A 3OW2Y 2KI7B 3GTKI 4E2WA 4HGZA 3D6WA 1S72Z 2JR6A 3M3YI 1YI21 2QEXZ 2AKLA 5D1PA 1NJI2 4NBEA 3HOZI 3QWUA 2RT9A 4XX2A 3RZDI 3S1MI 1Q861 2OTLZ 4Y52I 1VQ71 1VQO1 1KC81 2NVTI 3CD61 3KIFA 3MONA 2Q4ZA 3CCJZ 3FKII 3I07A 1VQLZ 3HOVI 1K8A1 1NP6A 2QLVB 5C4XI 2E2II 1ZH1A 2O53A 2K5RA 1VQ9Z 2K3RA 4E30A 3GTGI 3S1RI 3F3FC 2BJOA 1Q862 1QF8A 1Y1WI 1Q822 3MZKB 1KC82 3S2DI 4NFRA 1VQNZ 1M1K1 3VMIA 3G4SZ 4MRIA 1VQMZ 4MH4A 3I4NI 1YJN1 4TNUA 2NVXI 3CCQZ 1K8A2 3I55Z 4QTTA 1VQ41 1KD11 1Q7Y1 2LIYA 1DL6A 4EWCA 1RO2A 5C4JI 2W03A 3H0GI 1K83I 3PO3I 1X0TA 2GTHA 1TWHI 3JAMb 1VQK1 4A93I 2QREB 2V8JA 2G2KA 2WB1A 2QA4Z 3CMAZ 3I56Z 1M1K2 3NDIA 3CC2Z 5D1OB 1N8R2 1VQPZ 3GTQI 3HOXI 1YUKA 3VTNA 1KD12 1Q7Y2 5IT9b 5T64A 2R92I 3J80f 3GTJI 3CCU1 2DE6A 1YIJZ 4NBFA 2QEX1 3ESWA 3TDHB 3CMEZ 2VF1A 1YJWZ 5IP9I 3PO2I 3G71Z 4A3FI 3IFUA 1RQFA 2OTJZ 4X6AI 5A2Qf 3CCLZ 4RV9A 3IX0A 4NB9A 3CCJ1 2JA8I 3I4MI 1I6HI 2RPRA 2V8IA 4A3MI 3J81f 4RVHA 2GU2A 1YJ91 2VUMI 4RVGA 3GTPI 4NBHA 2EGTA 2J6AA 1Q821 3CCV1 3GTLI 4A3DI 3FQMA 4BXXI 1RNIA 3S14I 4E33A 3GTMS 3G6E1 3CCEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 Z;  1YJW 1;  1KC8 2;  1VQN Z;  3G71 1;  1M1K 1;  3G4S Z;  1VQM Z;  1M90 2;  1VQL 1;  1VQ8 1;  2OTL 1;  1YJN 1;  1YHQ Z;  1QVG Y;  3CCQ Z;  1QVG Z;  1VQN 1;  1K8A 2;  3I55 Z;  3CCS Z;  1VQ4 1;  1KD1 1;  1Q7Y 1;  1VQM 1;  3CC7 Z;  3CCS 1;  1NJI 1;  1Q82 2;  3CCU Z;  1VQ9 1;  1YIT Z;  1K73 1;  3CCR Z;  3CPW Z;  3CPW Y;  1VQK 1;  1K9M 1;  3CCM Z;  1YIT 1;  1JJ2 Y;  1JJ2 Z;  1N8R 1;  3CCE 1;  2QA4 Z;  3CMA Z;  3I56 Z;  1VQ5 Z;  1K9M 2;  3G4S 1;  1M1K 2;  3CC2 Z;  2QA4 1;  3OW2 Z;  3OW2 Y;  1YI2 Z;  1N8R 2;  1VQP Z;  1YHQ 1;  3CCQ 1;  1S72 Z;  3I55 1;  1KD1 2;  3CC2 1;  1Q7Y 2;  1YI2 1;  1VQP 1;  3CC7 1;  2QEX Z;  1NJI 2;  1YJ9 Z;  3CCU 1;  1W2B Z;  3CCR 1;  1YIJ Z;  1K73 2;  3CCV Z;  1VQ7 Z;  2QEX 1;  1Q81 1;  1VQO Z;  3CME Z;  3CD6 Z;  3CCM 1;  1Q86 1;  1KQS Z;  1KQS Y;  3G6E Z;  2OTL Z;  1YIJ 1;  1VQ7 1;  1VQO 1;  1KC8 1;  1YJW Z;  3CC4 Z;  3CMA 1;  3I56 1;  3CME 1;  1VQ5 1;  3CD6 1;  3G71 Z;  3CCJ Z;  1M90 1;  2OTJ Z;  1VQL Z;  1YJN Z;  3CCL Z;  3CC4 1;  1K8A 1;  3CCJ 1;  1S72 1;  1VQ4 Z;  2OTJ 1;  3CCL 1;  1W2B Y;  1QVF Z;  1YJ9 1;  1VQ9 Z;  1VQ6 Z;  1Q82 1;  1VQK Z;  3CCV 1;  1Q81 2;  3CXC Y;  3CXC Z;  1Q86 2;  3G6E 1;  1VQ6 1;  1QVF Y;  3CCE Z; 
#chains in the Genus database with same CATH topology
 2E2H I;  1YUA A;  5FLX b;  1Y1V I;  3HKZ A;  2ZAE B;  3NDJ A;  3NFZ A;  2H85 A;  1PFT A;  1R9T I;  1TWG I;  3H3V J;  4E2Z A;  3EER A;  1VQN 1;  2E9H A;  2JNY A;  4A3J I;  1VQM 1;  2VPW A;  2LEX A;  2JUB A;  4RS4 A;  2R6M A;  1X3Z A;  1S7M A;  1ZB8 A;  1K73 1;  2Q51 A;  5CM2 M;  2YU9 I;  1P9N A;  1Z03 A;  2M6N A;  1N8R 1;  4A3K I;  4NB8 A;  1SFO I;  2QA4 1;  1Z01 A;  1YHQ 1;  3NH4 A;  3P5J B;  3TE5 B;  4MD9 A;  2JIP A;  3CC2 1;  1VQP 1;  2DE5 A;  1JWH C;  3CC7 1;  1WCM I;  4RVD A;  2JA6 I;  1RO0 A;  2JA7 I;  2W04 A;  3GTO I;  1W2B Z;  2LFU A;  3CCR 1;  1K73 2;  1Q81 1;  4NBD A;  4HH4 A;  3K7A I;  4MON A;  2VUG A;  1TWC I;  3CCM 1;  4NBG A;  1YIJ 1;  2RIQ A;  3CC4 Z;  5C3E I;  5D1O A;  3CME 1;  3T4N B;  1VQ5 1;  2IZ3 A;  1M90 1;  4RVF A;  3VMH A;  1YJN Z;  5T6B A;  2PM9 A;  1Z02 A;  2B63 I;  2QR1 B;  2RBL A;  4NBB A;  1S72 1;  1VQ4 Z;  4BY7 I;  3GTM I;  4NH1 C;  2OTJ 1;  2JS4 A;  3J7A 4;  3CCL 1;  4DK1 A;  4A3I I;  3MZL B;  2OOX B;  1TWA I;  2Y0S A;  3BG0 B;  3U50 C;  1I3Q I;  1VQ6 Z;  1VQK Z;  1Q81 2;  2NVQ I;  3JAM f;  4MD7 A;  4DQY B;  2OTL 1;  4A3L I;  1QVF Y;  1QVF Z;  1VQ8 Z;  1LQL A;  3HOU I;  3D9X A;  3F3P C;  1AA6 A;  1NUI A;  4NBC A;  1VLA A;  1M90 2;  1VQL 1;  2QRC B;  1TFI A;  1QVG Y;  1QVG Z;  3CCS Z;  3PO3 S;  2PMZ A;  3LUS A;  3BG1 B;  3NH8 A;  5IT9 f;  1USP A;  1USP B;  5C44 I;  3CCU Z;  1VQ9 1;  1YIT Z;  1TWF I;  3NH5 A;  1X3W A;  1RO4 A;  2JA5 I;  3S15 I;  3CPW Z;  3CPW Y;  2R7Z I;  4BBS I;  3FQQ A;  1JJ2 Y;  1JJ2 Z;  3CQZ I;  1L1O C;  2RHB A;  1K9M 2;  2F4O A;  2P28 A;  1N2F A;  2OOY B;  3S1N I;  3G4S 1;  3S2H I;  1YI2 Z;  3GCF A;  3CCQ 1;  3I55 1;  2WAQ A;  4MXU A;  2KPI A;  2DE7 A;  1YJ9 Z;  2VPY A;  3CCV Z;  1VQ7 Z;  4A3G I;  2GTI A;  1WW9 A;  1VQO Z;  3RZO I;  3S1Q I;  4S1T A;  3CD6 Z;  4BBR I;  3VMG A;  1KQS Z;  1KQS Y;  3G6E Z;  5IP7 I;  2F4M A;  2I3C A;  3CMA 1;  3Q87 A;  3I56 1;  4E2Y A;  4A3C I;  2QRD B;  4E2X A;  4NBA A;  5FLX f;  4A3E I;  3S16 I;  5FLM I;  4MD8 A;  3IF8 A;  3CC4 1;  4NOZ A;  1WZN A;  3VB9 A;  1W2B Y;  3S17 I;  5AN9 F;  3GKQ A;  3J80 b;  2P3Y A;  2V3V A;  1RLY A;  4AYB A;  2VPX A;  4BY1 I;  2V8K A;  4A3B I;  1Y1V S;  2OZK A;  1ZB9 A;  2NVY I;  3CXC Y;  4CL1 A;  3CXC Z;  2HF1 A;  1VQ6 1;  3KIH A;  2IZ4 A;  1YJW 1;  4HGY A;  4QTU A;  2JIQ A;  4Y7N I;  5A2Q b;  3G71 1;  2O4H A;  2JMO A;  4E32 A;  2E2J I;  1VQ8 1;  1YHQ Z;  4E31 A;  2HU9 A;  1I50 I;  1KRL A;  1ML8 A;  1WII A;  3J81 b;  3CC7 Z;  2YAD A;  3CCS 1;  1NJI 1;  2QKD A;  2R93 I;  3CCR Z;  4DGL A;  5T67 A;  1K9M 1;  1SIW A;  3CCM Z;  1YIT 1;  5LL6 f;  3CCE 1;  3M4O I;  1QYP A;  3EED A;  1VQ5 Z;  3HOW I;  2NAP A;  3HOY I;  2M48 A;  3OW2 Z;  2PK7 A;  3OW2 Y;  2JIO A;  2KI7 B;  3GTK I;  4E2W A;  4HGZ A;  3D6W A;  1S72 Z;  2JR6 A;  3M3Y I;  1YI2 1;  2QEX Z;  2AKL A;  5D1P A;  1NJI 2;  4NBE A;  3HOZ I;  2JIR A;  3QWU A;  2RT9 A;  4XX2 A;  3RZD I;  3S1M I;  1Q86 1;  2V45 A;  2OTL Z;  4Y52 I;  1VQ7 1;  1VQO 1;  1KC8 1;  2NVT I;  3CD6 1;  3KIF A;  3MON A;  2Q4Z A;  3CCJ Z;  3FKI I;  3I07 A;  1VQL Z;  3HOV I;  1K8A 1;  1NP6 A;  2QLV B;  5C4X I;  2E2I I;  1ZH1 A;  2O53 A;  2K5R A;  1VQ9 Z;  2K3R A;  3D2L A;  4E30 A;  3GTG I;  3S1R I;  3F3F C;  2BJO A;  1Q86 2;  1QF8 A;  1Y1W I;  1Q82 2;  3MZK B;  1KC8 2;  3S2D I;  1FDO A;  4NFR A;  1VQN Z;  1M1K 1;  3VMI A;  3G4S Z;  4MRI A;  1VQM Z;  4MH4 A;  3I4N I;  1YJN 1;  4TNU A;  2NVX I;  3CCQ Z;  1K8A 2;  3I55 Z;  4QTT A;  1VQ4 1;  1KD1 1;  2AYD A;  2LIY A;  1Q7Y 1;  1DL6 A;  4EWC A;  1RO2 A;  5C4J I;  2W03 A;  2VPZ A;  3H0G I;  1K83 I;  3PO3 I;  1X0T A;  2GTH A;  1TWH I;  3JAM b;  1VQK 1;  4A93 I;  2QRE B;  2V8J A;  2G2K A;  2WB1 A;  2QA4 Z;  3CMA Z;  3I56 Z;  1M1K 2;  3NDI A;  1QXF A;  3CC2 Z;  5D1O B;  1N8R 2;  1VQP Z;  3GTQ I;  3HOX I;  1YUK A;  3VTN A;  1KD1 2;  1Y8C A;  1Q7Y 2;  2IV2 X;  5IT9 b;  5T64 A;  2R92 I;  3J80 f;  3GTJ I;  3CCU 1;  2DE6 A;  1YIJ Z;  4NBF A;  2QEX 1;  3ESW A;  3TDH B;  3CME Z;  2VF1 A;  1YJW Z;  1Q16 A;  5IP9 I;  3PO2 I;  3G71 Z;  3IFU A;  4A3F I;  1RQF A;  2OTJ Z;  4X6A I;  3IR7 A;  5A2Q f;  2E7Z A;  3CCL Z;  4RV9 A;  3IX0 A;  4NB9 A;  3CCJ 1;  2JA8 I;  1FDI A;  3I4M I;  1I6H I;  2RPR A;  2V8I A;  4A3M I;  3J81 f;  4RVH A;  2GU2 A;  1YJ9 1;  2VUM I;  4RVG A;  3GTP I;  4NBH A;  2EGT A;  2J6A A;  1Q82 1;  3CCV 1;  3GTL I;  4A3D I;  3FQM A;  4BXX I;  1RNI A;  3S14 I;  4E33 A;  3GTM S;  1WJ2 A;  3G6E 1;  2JIM A;  3CCE Z; 
#chains in the Genus database with same CATH homology
 2E2H I;  1YUA A;  5FLX b;  1Y1V I;  3HKZ A;  2ZAE B;  3NDJ A;  3NFZ A;  2H85 A;  1PFT A;  1R9T I;  1TWG I;  3H3V J;  4E2Z A;  3EER A;  1VQN 1;  2E9H A;  2JNY A;  4A3J I;  1VQM 1;  2JUB A;  4RS4 A;  2R6M A;  1X3Z A;  1S7M A;  1ZB8 A;  1K73 1;  2Q51 A;  5CM2 M;  2YU9 I;  1P9N A;  1Z03 A;  2M6N A;  1N8R 1;  4A3K I;  4NB8 A;  1SFO I;  2QA4 1;  1Z01 A;  1YHQ 1;  3NH4 A;  3P5J B;  3TE5 B;  4MD9 A;  3CC2 1;  1VQP 1;  2DE5 A;  1JWH C;  3CC7 1;  1WCM I;  4RVD A;  2JA6 I;  1RO0 A;  2JA7 I;  2W04 A;  3GTO I;  1W2B Z;  2LFU A;  3CCR 1;  1K73 2;  1Q81 1;  4NBD A;  4HH4 A;  3K7A I;  4MON A;  2VUG A;  1TWC I;  3CCM 1;  4NBG A;  1YIJ 1;  2RIQ A;  3CC4 Z;  5C3E I;  5D1O A;  3CME 1;  3T4N B;  1VQ5 1;  2IZ3 A;  1M90 1;  4RVF A;  3VMH A;  1YJN Z;  5T6B A;  2PM9 A;  1Z02 A;  2B63 I;  2QR1 B;  2RBL A;  4NBB A;  1S72 1;  1VQ4 Z;  4BY7 I;  3GTM I;  4NH1 C;  2OTJ 1;  2JS4 A;  3J7A 4;  3CCL 1;  4DK1 A;  4A3I I;  3MZL B;  2OOX B;  1TWA I;  2Y0S A;  3BG0 B;  3U50 C;  1I3Q I;  1VQ6 Z;  1VQK Z;  1Q81 2;  2NVQ I;  3JAM f;  4MD7 A;  4DQY B;  2OTL 1;  4A3L I;  1QVF Y;  1QVF Z;  1VQ8 Z;  1LQL A;  3HOU I;  3D9X A;  3F3P C;  1NUI A;  4NBC A;  1VLA A;  1M90 2;  1VQL 1;  2QRC B;  1TFI A;  1QVG Y;  1QVG Z;  3CCS Z;  3PO3 S;  2PMZ A;  3LUS A;  3BG1 B;  3NH8 A;  5IT9 f;  1USP A;  1USP B;  5C44 I;  3CCU Z;  1VQ9 1;  1YIT Z;  1TWF I;  3NH5 A;  1X3W A;  1RO4 A;  2JA5 I;  3S15 I;  3CPW Z;  3CPW Y;  2R7Z I;  4BBS I;  3FQQ A;  1JJ2 Y;  1JJ2 Z;  3CQZ I;  1L1O C;  2RHB A;  1K9M 2;  2F4O A;  2P28 A;  1N2F A;  2OOY B;  3S1N I;  3G4S 1;  3S2H I;  1YI2 Z;  3GCF A;  3CCQ 1;  3I55 1;  2WAQ A;  4MXU A;  2KPI A;  2DE7 A;  1YJ9 Z;  3CCV Z;  1VQ7 Z;  4A3G I;  2GTI A;  1WW9 A;  1VQO Z;  3RZO I;  3S1Q I;  4S1T A;  3CD6 Z;  4BBR I;  3VMG A;  1KQS Z;  1KQS Y;  3G6E Z;  5IP7 I;  2F4M A;  2I3C A;  3CMA 1;  3Q87 A;  3I56 1;  4E2Y A;  4A3C I;  2QRD B;  4E2X A;  4NBA A;  5FLX f;  4A3E I;  3S16 I;  5FLM I;  4MD8 A;  3IF8 A;  3CC4 1;  4NOZ A;  3VB9 A;  1W2B Y;  3S17 I;  5AN9 F;  3GKQ A;  3J80 b;  2P3Y A;  1RLY A;  4AYB A;  4BY1 I;  2V8K A;  4A3B I;  1Y1V S;  2OZK A;  1ZB9 A;  2NVY I;  3CXC Y;  4CL1 A;  3CXC Z;  2HF1 A;  1VQ6 1;  3KIH A;  2IZ4 A;  1YJW 1;  4HGY A;  4QTU A;  4Y7N I;  5A2Q b;  3G71 1;  2O4H A;  2JMO A;  4E32 A;  2E2J I;  1VQ8 1;  1YHQ Z;  4E31 A;  2HU9 A;  1I50 I;  1KRL A;  1ML8 A;  1WII A;  3J81 b;  3CC7 Z;  2YAD A;  3CCS 1;  1NJI 1;  2QKD A;  2R93 I;  3CCR Z;  4DGL A;  5T67 A;  1K9M 1;  3CCM Z;  1YIT 1;  5LL6 f;  3CCE 1;  3M4O I;  1QYP A;  3EED A;  1VQ5 Z;  3HOW I;  3HOY I;  2M48 A;  3OW2 Z;  2PK7 A;  3OW2 Y;  2KI7 B;  3GTK I;  4E2W A;  4HGZ A;  3D6W A;  1S72 Z;  2JR6 A;  3M3Y I;  1YI2 1;  2QEX Z;  2AKL A;  5D1P A;  1NJI 2;  4NBE A;  3HOZ I;  3QWU A;  2RT9 A;  4XX2 A;  3RZD I;  3S1M I;  1Q86 1;  2OTL Z;  4Y52 I;  1VQ7 1;  1VQO 1;  1KC8 1;  2NVT I;  3CD6 1;  3KIF A;  3MON A;  2Q4Z A;  3CCJ Z;  3FKI I;  3I07 A;  1VQL Z;  3HOV I;  1K8A 1;  1NP6 A;  2QLV B;  5C4X I;  2E2I I;  1ZH1 A;  2O53 A;  2K5R A;  1VQ9 Z;  2K3R A;  4E30 A;  3GTG I;  3S1R I;  3F3F C;  2BJO A;  1Q86 2;  1QF8 A;  1Y1W I;  1Q82 2;  3MZK B;  1KC8 2;  3S2D I;  4NFR A;  1VQN Z;  1M1K 1;  3VMI A;  3G4S Z;  4MRI A;  1VQM Z;  4MH4 A;  3I4N I;  1YJN 1;  4TNU A;  2NVX I;  3CCQ Z;  1K8A 2;  3I55 Z;  4QTT A;  1VQ4 1;  1KD1 1;  1Q7Y 1;  2LIY A;  1DL6 A;  4EWC A;  1RO2 A;  5C4J I;  2W03 A;  3H0G I;  1K83 I;  3PO3 I;  1X0T A;  2GTH A;  1TWH I;  3JAM b;  1VQK 1;  4A93 I;  2QRE B;  2V8J A;  2G2K A;  2WB1 A;  2QA4 Z;  3CMA Z;  3I56 Z;  1M1K 2;  3NDI A;  3CC2 Z;  5D1O B;  1N8R 2;  1VQP Z;  3GTQ I;  3HOX I;  1YUK A;  3VTN A;  1KD1 2;  1Q7Y 2;  5IT9 b;  5T64 A;  2R92 I;  3J80 f;  3GTJ I;  3CCU 1;  2DE6 A;  1YIJ Z;  4NBF A;  2QEX 1;  3ESW A;  3TDH B;  3CME Z;  2VF1 A;  1YJW Z;  5IP9 I;  3PO2 I;  3G71 Z;  4A3F I;  3IFU A;  1RQF A;  2OTJ Z;  4X6A I;  5A2Q f;  3CCL Z;  4RV9 A;  3IX0 A;  4NB9 A;  3CCJ 1;  2JA8 I;  3I4M I;  1I6H I;  2RPR A;  2V8I A;  4A3M I;  3J81 f;  4RVH A;  2GU2 A;  1YJ9 1;  2VUM I;  4RVG A;  3GTP I;  4NBH A;  2EGT A;  2J6A A;  1Q82 1;  3CCV 1;  3GTL I;  4A3D I;  3FQM A;  4BXX I;  1RNI A;  3S14 I;  4E33 A;  3GTM S;  3G6E 1;  3CCE Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...