3GTOI

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI02
1R9TI 3M3YI 1Y1VI 3I4MI 3VMHA 2NVXI 1PFTA 4NB9A 4A3FI 5IP9I 3EERA 3GTQI 1I3QI 3S1NI 3GTMI 3VMIA 1QYPA 2DE6A 3VMGA 1Y1WI 2F4MA 1K83I 2YU9I 3M4OI 3S17I 3S1QI 4X6AI 3RZDI 4NBHA 4NBDA 2DE7A 2DE5A 3CQZI 4A3CI 4NBGA 4A3MI 1TWCI 3GTKI 3I4NI 4A3JI 3S1MI 1N2FA 3GKQA 2E2II 5C4JI 2F4OA 4BBRI 2J6AA 3VB9A 1USPA 5IP7I 4MH4A 2JA5I 3S16I 1ZB8A 3K7AI 1TWFI 1SFOI 3LUSA 4NBCA 4QTUA 1L1OC 2R7ZI 2JS4A 4A3KI 3FKII 5C44I 2JR6A 3GTLI 2JA8I 1TWGI 3ESWA 5CM2M 4A93I 2E2HI 3HOUI 1WCMI 2KPIA 2K5RA 4NBEA 2JA7I 3HOWI 3H0GI 3GTPI 1ZB9A 3S1RI 3HOZI 2P3YA 1TFIA 2AKLA 2R92I 2B63I 4A3II 2JNYA 1DL6A 4BBSI 2PK7A 3RZOI 4A3LI 1VLAA 3D6WA 4NOZA 4NB8A 4BY1I 3PO2I 3S14I 4QTTA 1TWAI 4A3GI 3HOXI 1RO4A 1LQLA 1ML8A 2NVYI 3Q87A 4NBBA 4BY7I 1X3ZA 2JA6I 1WW9A 1X3WA 3PO3S 3HOVI 4Y7NI 4A3BI 3GCFA 1NUIA 3S2DI 2NVTI 2R93I 1I6HI 5C3EI 3S15I 2NVQI 3I07A 1USPB 5C4XI 2VUMI 3S2HI 4BXXI 1Y1VS 4A3EI 3H3VJ 4A3DI 3PO3I 2RBLA 2E2JI 1RLYA 3U50C 1I50I 2HF1A 3GTMS 2BJOA 4NBAA 5FLMI 3GTGI 3GTJI 4Y52I 1TWHI 1YUAA 4NBFA 4XX2A 3GTOI 3HOYI
chains in the Genus database with same CATH superfamily
3M3YI 3NH8A 1Y1VI 2EGTA 3VMHA 1NJI2 3I4MI 1KC82 1PFTA 2IV2X 1Y8CA 3GTQI 3S1NI 3GTMI 3I56Z 1QYPA 1NP6A 2OTLZ 2VPZA 1K83I 3M4OI 2DE5A 4E31A 4NBGA 3GTKI 2P28A 4A3JI 4HGYA 3KIHA 4BBRI 5T67A 1USPA 2W04A 4MH4A 5D1OB 1VQM1 4MONA 4E2ZA 4QTUA 1NJI1 1KC81 1VQPZ 3G4SZ 2KI7B 1K9M2 1VQNZ 3CC7Z 3FKII 3GTLI 4E2WA 3G6EZ 1WZNA 5CM2M 5FLXf 1KD11 1QVFY 4A93I 2E2HI 5IT9f 2RPRA 4NBEA 1YJW1 4E2YA 3NH5A 4RVFA 3MZKB 1ZB9A 3NFZA 1YIT1 1Z01A 2QEX1 1M902 1FDIA 3CCL1 1VQ41 2JIOA 2RHBA 1YJNZ 3RZOI 4A3LI 3D6WA 4NOZA 1FDOA 1RO2A 3FQQA 1TWAI 1AA6A 1RO4A 1VQ9Z 3CCU1 4NBBA 4BY7I 2JA6I 4Y7NI 3CCEZ 1VQ6Z 3CC2Z 2YADA 3S2DI 2QA41 3CMA1 1YIJZ 3CCRZ 1USPB 2G2KA 5C4XI 1M901 3IFUA 1YJ91 1Y1VS 2RBLA 5D1OA 2Q4ZA 2HF1A 3GTMS 3GTGI 4HGZA 1TWHI 4NBFA 3CC4Z 2QRDB 2E2II 2HU9A 4S1TA 2NVXI 2VUGA 4A3FI 1YHQ1 3CCS1 3JAMf 3BG0B 3EEDA 1S72Z 1QVFZ 3FQMA 2YU9I 5LL6f 3S17I 4NBHA 3CCJZ 4A3MI 1JWHC 4TNUA 3S1MI 3I561 2W03A 2OTL1 3VB9A 2QKDA 2ZAEB 2O53A 3TE5B 3S16I 1Q7Y2 3K7AI 1TWFI 1VQOZ 1S7MA 3NDJA 3JAMb 1JJ2Y 2QRCB 2LEXA 1Z03A 2AYDA 3BG1B 2QLVB 2JR6A 2E9HA 4MD8A 2Y0SA 1TWGI 3OW2Y 1Q812 3ESWA 1M1K1 3CCQZ 2KPIA 1VQP1 3G4S1 1QVGY 1VQN1 2V3VA 3CC71 2QR1B 3H0GI 2JUBA 1VQLZ 2QREB 3G6E1 2AKLA 1Q7Y1 2B63I 3J80b 4RVGA 1K8A2 3TDHB 2PK7A 5AN9F 3NDIA 1ZH1A 1WJ2A 4A3GI 4HH4A 1Q811 2LIYA 2WB1A 1Z02A 1RNIA 2PMZA 1X3ZA 1YJN1 1WW9A 1X3WA 3HOVI 4A3BI 3GCFA 2IZ3A 1NUIA 3CD6Z 3F3FC 2OTJZ 2R93I 1VQ91 2LFUA 2OZKA 2O4HA 3CMEZ 3H3VJ 1K9M1 3PO3I 1VQ61 2BJOA 3CC21 3GTJI 2M6NA 1JJ2Z 4Y52I 1KRLA 1VQ5Z 1X0TA 1YIJ1 3IX0A 3CCR1 2JIQA 1KQSY 1R9TI 4MD9A 1Q862 3EERA 3J7A4 3VMIA 3OW2Z 3I55Z 3VMGA 1Y1WI 3CC41 1YITZ 1QVGZ 3S1QI 4X6AI 1Q822 3CQZI 1TWCI 3I4NI 1N2FA 1QF8A 3GKQA 1YI21 2JIPA 5C4JI 2F4OA 4NH1C 1W2BY 1S721 3D9XA 2WAQA 5IP7I 3P5JB 1VQ8Z 3CCV1 1SFOI 1VQKZ 3LUSA 2OOYB 4RVDA 3CCJ1 1L1OC 1Q861 2R7ZI 2JS4A 4E2XA 2Q51A 1VQ7Z 2VPYA 1Q16A 5C44I 1RO0A 4E32A 1VQO1 2QA4Z 1Q821 3HOUI 1WCMI 3CCMZ 3G71Z 2K5RA 3GTPI 4MD7A 4AYBA 3HOZI 2P3YA 1TFIA 2R92I 2V8KA 4A3II 2JNYA 3VTNA 3CCQ1 3J80f 4CL1A 4BBSI 4E30A 1VLAA 4NB8A 4BY1I 1VQL1 3PO2I 3S14I 1K732 4QTTA 1KQSZ 3HOXI 3IR7A 1ML8A 3CXCY 3MONA 3PO3S 2PM9A 3HKZA 2I3CA 2K3RA 5A2Qb 2NVTI 5C3EI 2M48A 2VUMI 3S2HI 4NFRA 4DK1A 1KD12 4BXXI 1W2BZ 1RLYA 2V8JA 4NBAA 5FLMI 1K731 3CD61 1N8R2 2OTJ1 1YUAA 1SIWA 4XX2A 4EWCA 3GTOI 3HOYI 2R6MA 3CME1 4NB9A 5IP9I 1I3QI 2DE6A 1P9NA 2F4MA 2GTHA 1VQ51 2VPXA 1VQMZ 2IZ4A 3RZDI 1K8A1 4NBDA 2DE7A 3CCE1 4A3CI 2JIRA 3I551 3QWUA 2J6AA 1N8R1 2OOXB 2JA5I 1ZB8A 3CPWY 4NBCA 2NAPA 3D2LA 2RIQA 3KIFA 1YJWZ 4A3KI 5FLXb 4DGLA 2JA8I 5D1PA 3CXCZ 5IT9b 1VQ81 1VQK1 2QEXZ 5T6BA 4RS4A 3CCLZ 1VQ4Z 2VF1A 2JA7I 1VQ71 3HOWI 4DQYB 3T4NB 3S1RI 1YUKA 2JIMA 3CCUZ 1DL6A 2JMOA 3CCM1 3G711 3F3PC 1QXFA 2VPWA 3NH4A 2GU2A 4RV9A 3CMAZ 1LQLA 2NVYI 3Q87A 1YJ9Z 2H85A 3J81f 4RVHA 5T64A 2GTIA 1YI2Z 2E7ZA 1RQFA 1I6HI 1WIIA 3S15I 2NVQI 3I07A 2RT9A 5A2Qf 3CCVZ 4A3EI 4A3DI 1M1K2 2E2JI 1YHQZ 3IF8A 3CCSZ 3U50C 1I50I 3CPWZ 4E33A 2V8IA 2V45A 3J81b 4MRIA 3MZLB 4MXUA
chains in the Genus database with same CATH topology
3M3YI 3NH8A 1Y1VI 2EGTA 3VMHA 1NJI2 3I4MI 1KC82 1PFTA 3GTQI 3S1NI 3GTMI 3I56Z 1QYPA 1NP6A 2OTLZ 1K83I 3M4OI 2DE5A 4E31A 4NBGA 3GTKI 2P28A 4A3JI 4HGYA 3KIHA 4BBRI 5T67A 1USPA 2W04A 4MH4A 5D1OB 1VQM1 4MONA 4E2ZA 4QTUA 1NJI1 1KC81 1VQPZ 3G4SZ 2KI7B 1K9M2 1VQNZ 3CC7Z 3FKII 3GTLI 4E2WA 3G6EZ 5CM2M 5FLXf 1KD11 1QVFY 4A93I 2E2HI 5IT9f 2RPRA 4NBEA 1YJW1 4E2YA 3NH5A 4RVFA 3MZKB 1ZB9A 3NFZA 1YIT1 1Z01A 2QEX1 1M902 3CCL1 1VQ41 2RHBA 1YJNZ 3RZOI 4A3LI 3D6WA 4NOZA 1RO2A 3FQQA 1TWAI 1RO4A 1VQ9Z 3CCU1 4NBBA 4BY7I 2JA6I 4Y7NI 3CCEZ 1VQ6Z 3CC2Z 2YADA 3S2DI 2QA41 3CMA1 1YIJZ 3CCRZ 1USPB 2G2KA 5C4XI 1M901 3IFUA 1YJ91 1Y1VS 2RBLA 5D1OA 2Q4ZA 2HF1A 3GTMS 3GTGI 4HGZA 1TWHI 4NBFA 3CC4Z 2QRDB 2E2II 2HU9A 4S1TA 2NVXI 2VUGA 4A3FI 1YHQ1 3CCS1 3JAMf 3BG0B 3EEDA 1S72Z 1QVFZ 3FQMA 2YU9I 5LL6f 3S17I 4NBHA 3CCJZ 4A3MI 1JWHC 4TNUA 3S1MI 3I561 2W03A 2OTL1 3VB9A 2QKDA 2ZAEB 2O53A 3TE5B 3S16I 1Q7Y2 3K7AI 1TWFI 1VQOZ 1S7MA 3NDJA 3JAMb 1JJ2Y 2QRCB 1Z03A 3BG1B 2QLVB 2JR6A 2E9HA 4MD8A 2Y0SA 1TWGI 3OW2Y 1Q812 3ESWA 1M1K1 3CCQZ 2KPIA 1VQP1 3G4S1 1QVGY 1VQN1 3CC71 2QR1B 3H0GI 2JUBA 1VQLZ 2QREB 3G6E1 2AKLA 1Q7Y1 2B63I 3J80b 4RVGA 1K8A2 3TDHB 2PK7A 5AN9F 3NDIA 1ZH1A 4A3GI 4HH4A 1Q811 2LIYA 2WB1A 1Z02A 1RNIA 2PMZA 1X3ZA 1YJN1 1WW9A 1X3WA 3HOVI 4A3BI 3GCFA 2IZ3A 1NUIA 3CD6Z 3F3FC 2OTJZ 2R93I 1VQ91 2LFUA 2OZKA 2O4HA 3CMEZ 3H3VJ 1K9M1 3PO3I 1VQ61 2BJOA 3CC21 3GTJI 2M6NA 1JJ2Z 4Y52I 1KRLA 1VQ5Z 1X0TA 1YIJ1 3IX0A 3CCR1 1KQSY 1R9TI 4MD9A 1Q862 3EERA 3J7A4 3VMIA 3OW2Z 3I55Z 3VMGA 1Y1WI 3CC41 1YITZ 1QVGZ 3S1QI 4X6AI 1Q822 3CQZI 1TWCI 3I4NI 1N2FA 1QF8A 3GKQA 1YI21 5C4JI 2F4OA 4NH1C 1W2BY 1S721 3D9XA 2WAQA 5IP7I 3P5JB 1VQ8Z 3CCV1 1SFOI 1VQKZ 3LUSA 2OOYB 4RVDA 3CCJ1 1L1OC 1Q861 2R7ZI 2JS4A 4E2XA 2Q51A 1VQ7Z 5C44I 1RO0A 4E32A 1VQO1 2QA4Z 1Q821 3HOUI 1WCMI 3CCMZ 3G71Z 2K5RA 3GTPI 4MD7A 4AYBA 3HOZI 2P3YA 1TFIA 2R92I 2V8KA 4A3II 2JNYA 3VTNA 3CCQ1 3J80f 4CL1A 4BBSI 4E30A 1VLAA 4NB8A 4BY1I 1VQL1 3PO2I 3S14I 1K732 4QTTA 1KQSZ 3HOXI 1ML8A 3CXCY 3MONA 3PO3S 2PM9A 3HKZA 2I3CA 2K3RA 5A2Qb 2NVTI 5C3EI 2M48A 2VUMI 3S2HI 4NFRA 4DK1A 1KD12 4BXXI 1W2BZ 1RLYA 2V8JA 4NBAA 5FLMI 1K731 3CD61 1N8R2 2OTJ1 1YUAA 4XX2A 4EWCA 3GTOI 3HOYI 2R6MA 3CME1 4NB9A 5IP9I 1I3QI 2DE6A 1P9NA 2F4MA 2GTHA 1VQ51 1VQMZ 2IZ4A 3RZDI 1K8A1 4NBDA 2DE7A 3CCE1 4A3CI 3I551 3QWUA 2J6AA 1N8R1 2OOXB 2JA5I 1ZB8A 3CPWY 4NBCA 2RIQA 3KIFA 1YJWZ 4A3KI 5FLXb 4DGLA 2JA8I 5D1PA 3CXCZ 5IT9b 1VQ81 1VQK1 2QEXZ 5T6BA 4RS4A 3CCLZ 1VQ4Z 2VF1A 2JA7I 1VQ71 3HOWI 4DQYB 3T4NB 3S1RI 1YUKA 3CCUZ 1DL6A 2JMOA 3CCM1 3G711 3F3PC 3NH4A 2GU2A 4RV9A 3CMAZ 1LQLA 2NVYI 3Q87A 1YJ9Z 2H85A 3J81f 4RVHA 5T64A 2GTIA 1YI2Z 1RQFA 1I6HI 1WIIA 3S15I 2NVQI 3I07A 2RT9A 5A2Qf 3CCVZ 4A3EI 4A3DI 1M1K2 2E2JI 1YHQZ 3IF8A 3CCSZ 3U50C 1I50I 3CPWZ 4E33A 2V8IA 3J81b 4MRIA 3MZLB 4MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T I;  3M3Y I;  1Y1V I;  3I4M I;  3VMH A;  2NVX I;  1PFT A;  4NB9 A;  4A3F I;  5IP9 I;  3EER A;  3GTQ I;  1I3Q I;  3S1N I;  3GTM I;  3VMI A;  1QYP A;  2DE6 A;  3VMG A;  1Y1W I;  2F4M A;  1K83 I;  2YU9 I;  3M4O I;  3S17 I;  3S1Q I;  4X6A I;  3RZD I;  4NBH A;  4NBD A;  2DE7 A;  2DE5 A;  3CQZ I;  4A3C I;  4NBG A;  4A3M I;  1TWC I;  3GTK I;  3I4N I;  4A3J I;  3S1M I;  1N2F A;  3GKQ A;  2E2I I;  5C4J I;  2F4O A;  4BBR I;  2J6A A;  3VB9 A;  1USP A;  5IP7 I;  4MH4 A;  2JA5 I;  3S16 I;  1ZB8 A;  3K7A I;  1TWF I;  1SFO I;  3LUS A;  4NBC A;  4QTU A;  1L1O C;  2R7Z I;  2JS4 A;  4A3K I;  3FKI I;  5C44 I;  2JR6 A;  3GTL I;  2JA8 I;  1TWG I;  3ESW A;  5CM2 M;  4A93 I;  2E2H I;  3HOU I;  1WCM I;  2KPI A;  2K5R A;  4NBE A;  2JA7 I;  3HOW I;  3H0G I;  3GTP I;  1ZB9 A;  3S1R I;  3HOZ I;  2P3Y A;  1TFI A;  2AKL A;  2R92 I;  2B63 I;  4A3I I;  2JNY A;  1DL6 A;  4BBS I;  2PK7 A;  3RZO I;  4A3L I;  1VLA A;  3D6W A;  4NOZ A;  4NB8 A;  4BY1 I;  3PO2 I;  3S14 I;  4QTT A;  1TWA I;  4A3G I;  3HOX I;  1RO4 A;  1LQL A;  1ML8 A;  2NVY I;  3Q87 A;  4NBB A;  4BY7 I;  1X3Z A;  2JA6 I;  1WW9 A;  1X3W A;  3PO3 S;  3HOV I;  4Y7N I;  4A3B I;  3GCF A;  1NUI A;  3S2D I;  2NVT I;  2R93 I;  1I6H I;  5C3E I;  3S15 I;  2NVQ I;  3I07 A;  1USP B;  5C4X I;  2VUM I;  3S2H I;  4BXX I;  1Y1V S;  4A3E I;  3H3V J;  4A3D I;  3PO3 I;  2RBL A;  2E2J I;  1RLY A;  3U50 C;  1I50 I;  2HF1 A;  3GTM S;  2BJO A;  4NBA A;  5FLM I;  3GTG I;  3GTJ I;  4Y52 I;  1TWH I;  1YUA A;  4NBF A;  4XX2 A;  3GTO I;  3HOY I; 
#chains in the Genus database with same CATH topology
 3M3Y I;  3NH8 A;  1Y1V I;  2EGT A;  3VMH A;  1NJI 2;  3I4M I;  1KC8 2;  1PFT A;  2IV2 X;  1Y8C A;  3GTQ I;  3S1N I;  3GTM I;  3I56 Z;  1QYP A;  1NP6 A;  2OTL Z;  2VPZ A;  1K83 I;  3M4O I;  2DE5 A;  4E31 A;  4NBG A;  3GTK I;  2P28 A;  4A3J I;  4HGY A;  3KIH A;  4BBR I;  5T67 A;  1USP A;  2W04 A;  4MH4 A;  5D1O B;  1VQM 1;  4MON A;  4E2Z A;  4QTU A;  1NJI 1;  1KC8 1;  1VQP Z;  3G4S Z;  2KI7 B;  1K9M 2;  1VQN Z;  3CC7 Z;  3FKI I;  3GTL I;  4E2W A;  3G6E Z;  1WZN A;  5CM2 M;  5FLX f;  1KD1 1;  1QVF Y;  4A93 I;  2E2H I;  5IT9 f;  2RPR A;  4NBE A;  1YJW 1;  4E2Y A;  3NH5 A;  4RVF A;  3MZK B;  1ZB9 A;  3NFZ A;  1YIT 1;  1Z01 A;  2QEX 1;  1M90 2;  1FDI A;  3CCL 1;  1VQ4 1;  2JIO A;  2RHB A;  1YJN Z;  3RZO I;  4A3L I;  3D6W A;  4NOZ A;  1FDO A;  1RO2 A;  3FQQ A;  1TWA I;  1AA6 A;  1RO4 A;  1VQ9 Z;  3CCU 1;  4NBB A;  4BY7 I;  2JA6 I;  4Y7N I;  3CCE Z;  1VQ6 Z;  3CC2 Z;  2YAD A;  3S2D I;  2QA4 1;  3CMA 1;  1YIJ Z;  3CCR Z;  1USP B;  2G2K A;  5C4X I;  1M90 1;  3IFU A;  1YJ9 1;  1Y1V S;  2RBL A;  5D1O A;  2Q4Z A;  2HF1 A;  3GTM S;  3GTG I;  4HGZ A;  1TWH I;  4NBF A;  3CC4 Z;  2QRD B;  2E2I I;  2HU9 A;  4S1T A;  2NVX I;  2VUG A;  4A3F I;  1YHQ 1;  3CCS 1;  3JAM f;  3BG0 B;  3EED A;  1S72 Z;  1QVF Z;  3FQM A;  2YU9 I;  5LL6 f;  3S17 I;  4NBH A;  3CCJ Z;  4A3M I;  1JWH C;  4TNU A;  3S1M I;  3I56 1;  2W03 A;  2OTL 1;  3VB9 A;  2QKD A;  2ZAE B;  2O53 A;  3TE5 B;  3S16 I;  1Q7Y 2;  3K7A I;  1TWF I;  1VQO Z;  1S7M A;  3NDJ A;  3JAM b;  1JJ2 Y;  2QRC B;  2LEX A;  1Z03 A;  2AYD A;  3BG1 B;  2QLV B;  2JR6 A;  2E9H A;  4MD8 A;  2Y0S A;  1TWG I;  3OW2 Y;  1Q81 2;  3ESW A;  1M1K 1;  3CCQ Z;  2KPI A;  1VQP 1;  3G4S 1;  1QVG Y;  1VQN 1;  2V3V A;  3CC7 1;  2QR1 B;  3H0G I;  2JUB A;  1VQL Z;  2QRE B;  3G6E 1;  2AKL A;  1Q7Y 1;  2B63 I;  3J80 b;  4RVG A;  1K8A 2;  3TDH B;  2PK7 A;  5AN9 F;  3NDI A;  1ZH1 A;  1WJ2 A;  4A3G I;  4HH4 A;  1Q81 1;  2LIY A;  2WB1 A;  1Z02 A;  1RNI A;  2PMZ A;  1X3Z A;  1YJN 1;  1WW9 A;  1X3W A;  3HOV I;  4A3B I;  3GCF A;  2IZ3 A;  1NUI A;  3CD6 Z;  3F3F C;  2OTJ Z;  2R93 I;  1VQ9 1;  2LFU A;  2OZK A;  2O4H A;  3CME Z;  3H3V J;  1K9M 1;  3PO3 I;  1VQ6 1;  2BJO A;  3CC2 1;  3GTJ I;  2M6N A;  1JJ2 Z;  4Y52 I;  1KRL A;  1VQ5 Z;  1X0T A;  1YIJ 1;  3IX0 A;  3CCR 1;  2JIQ A;  1KQS Y;  1R9T I;  4MD9 A;  1Q86 2;  3EER A;  3J7A 4;  3VMI A;  3OW2 Z;  3I55 Z;  3VMG A;  1Y1W I;  3CC4 1;  1YIT Z;  1QVG Z;  3S1Q I;  4X6A I;  1Q82 2;  3CQZ I;  1TWC I;  3I4N I;  1N2F A;  1QF8 A;  3GKQ A;  1YI2 1;  2JIP A;  5C4J I;  2F4O A;  4NH1 C;  1W2B Y;  1S72 1;  3D9X A;  2WAQ A;  5IP7 I;  3P5J B;  1VQ8 Z;  3CCV 1;  1SFO I;  1VQK Z;  3LUS A;  2OOY B;  4RVD A;  3CCJ 1;  1L1O C;  1Q86 1;  2R7Z I;  2JS4 A;  4E2X A;  2Q51 A;  1VQ7 Z;  2VPY A;  1Q16 A;  5C44 I;  1RO0 A;  4E32 A;  1VQO 1;  2QA4 Z;  1Q82 1;  3HOU I;  1WCM I;  3CCM Z;  3G71 Z;  2K5R A;  3GTP I;  4MD7 A;  4AYB A;  3HOZ I;  2P3Y A;  1TFI A;  2R92 I;  2V8K A;  4A3I I;  2JNY A;  3VTN A;  3CCQ 1;  3J80 f;  4CL1 A;  4BBS I;  4E30 A;  1VLA A;  4NB8 A;  4BY1 I;  1VQL 1;  3PO2 I;  3S14 I;  1K73 2;  4QTT A;  1KQS Z;  3HOX I;  3IR7 A;  1ML8 A;  3CXC Y;  3MON A;  3PO3 S;  2PM9 A;  3HKZ A;  2I3C A;  2K3R A;  5A2Q b;  2NVT I;  5C3E I;  2M48 A;  2VUM I;  3S2H I;  4NFR A;  4DK1 A;  1KD1 2;  4BXX I;  1W2B Z;  1RLY A;  2V8J A;  4NBA A;  5FLM I;  1K73 1;  3CD6 1;  1N8R 2;  2OTJ 1;  1YUA A;  1SIW A;  4XX2 A;  4EWC A;  3GTO I;  3HOY I;  2R6M A;  3CME 1;  4NB9 A;  5IP9 I;  1I3Q I;  2DE6 A;  1P9N A;  2F4M A;  2GTH A;  1VQ5 1;  2VPX A;  1VQM Z;  2IZ4 A;  3RZD I;  1K8A 1;  4NBD A;  2DE7 A;  3CCE 1;  4A3C I;  2JIR A;  3I55 1;  3QWU A;  2J6A A;  1N8R 1;  2OOX B;  2JA5 I;  1ZB8 A;  3CPW Y;  4NBC A;  2NAP A;  3D2L A;  2RIQ A;  3KIF A;  1YJW Z;  4A3K I;  5FLX b;  4DGL A;  2JA8 I;  5D1P A;  3CXC Z;  5IT9 b;  1VQ8 1;  1VQK 1;  2QEX Z;  5T6B A;  4RS4 A;  3CCL Z;  1VQ4 Z;  2VF1 A;  2JA7 I;  1VQ7 1;  3HOW I;  4DQY B;  3T4N B;  3S1R I;  1YUK A;  2JIM A;  3CCU Z;  1DL6 A;  2JMO A;  3CCM 1;  3G71 1;  3F3P C;  1QXF A;  2VPW A;  3NH4 A;  2GU2 A;  4RV9 A;  3CMA Z;  1LQL A;  2NVY I;  3Q87 A;  1YJ9 Z;  2H85 A;  3J81 f;  4RVH A;  5T64 A;  2GTI A;  1YI2 Z;  2E7Z A;  1RQF A;  1I6H I;  1WII A;  3S15 I;  2NVQ I;  3I07 A;  2RT9 A;  5A2Q f;  3CCV Z;  4A3E I;  4A3D I;  1M1K 2;  2E2J I;  1YHQ Z;  3IF8 A;  3CCS Z;  3U50 C;  1I50 I;  3CPW Z;  4E33 A;  2V8I A;  2V45 A;  3J81 b;  4MRI A;  3MZL B;  4MXU A; 
#chains in the Genus database with same CATH homology
 3M3Y I;  3NH8 A;  1Y1V I;  2EGT A;  3VMH A;  1NJI 2;  3I4M I;  1KC8 2;  1PFT A;  3GTQ I;  3S1N I;  3GTM I;  3I56 Z;  1QYP A;  1NP6 A;  2OTL Z;  1K83 I;  3M4O I;  2DE5 A;  4E31 A;  4NBG A;  3GTK I;  2P28 A;  4A3J I;  4HGY A;  3KIH A;  4BBR I;  5T67 A;  1USP A;  2W04 A;  4MH4 A;  5D1O B;  1VQM 1;  4MON A;  4E2Z A;  4QTU A;  1NJI 1;  1KC8 1;  1VQP Z;  3G4S Z;  2KI7 B;  1K9M 2;  1VQN Z;  3CC7 Z;  3FKI I;  3GTL I;  4E2W A;  3G6E Z;  5CM2 M;  5FLX f;  1KD1 1;  1QVF Y;  4A93 I;  2E2H I;  5IT9 f;  2RPR A;  4NBE A;  1YJW 1;  4E2Y A;  3NH5 A;  4RVF A;  3MZK B;  1ZB9 A;  3NFZ A;  1YIT 1;  1Z01 A;  2QEX 1;  1M90 2;  3CCL 1;  1VQ4 1;  2RHB A;  1YJN Z;  3RZO I;  4A3L I;  3D6W A;  4NOZ A;  1RO2 A;  3FQQ A;  1TWA I;  1RO4 A;  1VQ9 Z;  3CCU 1;  4NBB A;  4BY7 I;  2JA6 I;  4Y7N I;  3CCE Z;  1VQ6 Z;  3CC2 Z;  2YAD A;  3S2D I;  2QA4 1;  3CMA 1;  1YIJ Z;  3CCR Z;  1USP B;  2G2K A;  5C4X I;  1M90 1;  3IFU A;  1YJ9 1;  1Y1V S;  2RBL A;  5D1O A;  2Q4Z A;  2HF1 A;  3GTM S;  3GTG I;  4HGZ A;  1TWH I;  4NBF A;  3CC4 Z;  2QRD B;  2E2I I;  2HU9 A;  4S1T A;  2NVX I;  2VUG A;  4A3F I;  1YHQ 1;  3CCS 1;  3JAM f;  3BG0 B;  3EED A;  1S72 Z;  1QVF Z;  3FQM A;  2YU9 I;  5LL6 f;  3S17 I;  4NBH A;  3CCJ Z;  4A3M I;  1JWH C;  4TNU A;  3S1M I;  3I56 1;  2W03 A;  2OTL 1;  3VB9 A;  2QKD A;  2ZAE B;  2O53 A;  3TE5 B;  3S16 I;  1Q7Y 2;  3K7A I;  1TWF I;  1VQO Z;  1S7M A;  3NDJ A;  3JAM b;  1JJ2 Y;  2QRC B;  1Z03 A;  3BG1 B;  2QLV B;  2JR6 A;  2E9H A;  4MD8 A;  2Y0S A;  1TWG I;  3OW2 Y;  1Q81 2;  3ESW A;  1M1K 1;  3CCQ Z;  2KPI A;  1VQP 1;  3G4S 1;  1QVG Y;  1VQN 1;  3CC7 1;  2QR1 B;  3H0G I;  2JUB A;  1VQL Z;  2QRE B;  3G6E 1;  2AKL A;  1Q7Y 1;  2B63 I;  3J80 b;  4RVG A;  1K8A 2;  3TDH B;  2PK7 A;  5AN9 F;  3NDI A;  1ZH1 A;  4A3G I;  4HH4 A;  1Q81 1;  2LIY A;  2WB1 A;  1Z02 A;  1RNI A;  2PMZ A;  1X3Z A;  1YJN 1;  1WW9 A;  1X3W A;  3HOV I;  4A3B I;  3GCF A;  2IZ3 A;  1NUI A;  3CD6 Z;  3F3F C;  2OTJ Z;  2R93 I;  1VQ9 1;  2LFU A;  2OZK A;  2O4H A;  3CME Z;  3H3V J;  1K9M 1;  3PO3 I;  1VQ6 1;  2BJO A;  3CC2 1;  3GTJ I;  2M6N A;  1JJ2 Z;  4Y52 I;  1KRL A;  1VQ5 Z;  1X0T A;  1YIJ 1;  3IX0 A;  3CCR 1;  1KQS Y;  1R9T I;  4MD9 A;  1Q86 2;  3EER A;  3J7A 4;  3VMI A;  3OW2 Z;  3I55 Z;  3VMG A;  1Y1W I;  3CC4 1;  1YIT Z;  1QVG Z;  3S1Q I;  4X6A I;  1Q82 2;  3CQZ I;  1TWC I;  3I4N I;  1N2F A;  1QF8 A;  3GKQ A;  1YI2 1;  5C4J I;  2F4O A;  4NH1 C;  1W2B Y;  1S72 1;  3D9X A;  2WAQ A;  5IP7 I;  3P5J B;  1VQ8 Z;  3CCV 1;  1SFO I;  1VQK Z;  3LUS A;  2OOY B;  4RVD A;  3CCJ 1;  1L1O C;  1Q86 1;  2R7Z I;  2JS4 A;  4E2X A;  2Q51 A;  1VQ7 Z;  5C44 I;  1RO0 A;  4E32 A;  1VQO 1;  2QA4 Z;  1Q82 1;  3HOU I;  1WCM I;  3CCM Z;  3G71 Z;  2K5R A;  3GTP I;  4MD7 A;  4AYB A;  3HOZ I;  2P3Y A;  1TFI A;  2R92 I;  2V8K A;  4A3I I;  2JNY A;  3VTN A;  3CCQ 1;  3J80 f;  4CL1 A;  4BBS I;  4E30 A;  1VLA A;  4NB8 A;  4BY1 I;  1VQL 1;  3PO2 I;  3S14 I;  1K73 2;  4QTT A;  1KQS Z;  3HOX I;  1ML8 A;  3CXC Y;  3MON A;  3PO3 S;  2PM9 A;  3HKZ A;  2I3C A;  2K3R A;  5A2Q b;  2NVT I;  5C3E I;  2M48 A;  2VUM I;  3S2H I;  4NFR A;  4DK1 A;  1KD1 2;  4BXX I;  1W2B Z;  1RLY A;  2V8J A;  4NBA A;  5FLM I;  1K73 1;  3CD6 1;  1N8R 2;  2OTJ 1;  1YUA A;  4XX2 A;  4EWC A;  3GTO I;  3HOY I;  2R6M A;  3CME 1;  4NB9 A;  5IP9 I;  1I3Q I;  2DE6 A;  1P9N A;  2F4M A;  2GTH A;  1VQ5 1;  1VQM Z;  2IZ4 A;  3RZD I;  1K8A 1;  4NBD A;  2DE7 A;  3CCE 1;  4A3C I;  3I55 1;  3QWU A;  2J6A A;  1N8R 1;  2OOX B;  2JA5 I;  1ZB8 A;  3CPW Y;  4NBC A;  2RIQ A;  3KIF A;  1YJW Z;  4A3K I;  5FLX b;  4DGL A;  2JA8 I;  5D1P A;  3CXC Z;  5IT9 b;  1VQ8 1;  1VQK 1;  2QEX Z;  5T6B A;  4RS4 A;  3CCL Z;  1VQ4 Z;  2VF1 A;  2JA7 I;  1VQ7 1;  3HOW I;  4DQY B;  3T4N B;  3S1R I;  1YUK A;  3CCU Z;  1DL6 A;  2JMO A;  3CCM 1;  3G71 1;  3F3P C;  3NH4 A;  2GU2 A;  4RV9 A;  3CMA Z;  1LQL A;  2NVY I;  3Q87 A;  1YJ9 Z;  2H85 A;  3J81 f;  4RVH A;  5T64 A;  2GTI A;  1YI2 Z;  1RQF A;  1I6H I;  1WII A;  3S15 I;  2NVQ I;  3I07 A;  2RT9 A;  5A2Q f;  3CCV Z;  4A3E I;  4A3D I;  1M1K 2;  2E2J I;  1YHQ Z;  3IF8 A;  3CCS Z;  3U50 C;  1I50 I;  3CPW Z;  4E33 A;  2V8I A;  3J81 b;  4MRI A;  3MZL B;  4MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...