3GTOI

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI02
3D6WA 4NBBA 2JNYA 3GTMS 2K5RA 3GTPI 1TFIA 4MH4A 4X6AI 3K7AI 3I4NI 2JA7I 1ZB8A 2PK7A 3H3VJ 1X3ZA 3Q87A 2NVTI 2E2JI 4NBEA 3GTKI 3HOXI 3S2HI 4NBAA 3VMIA 3GTMI 3HOZI 3ESWA 3GTQI 2NVQI 4Y52I 1QYPA 5IP7I 2F4MA 1TWHI 1TWGI 1WCMI 4A3KI 2RBLA 4NBGA 1Y1WI 4A3GI 4NBHA 2BJOA 1Y1VS 5C4XI 5C4JI 3FKII 4Y7NI 3GTLI 4BBRI 4A3CI 2KPIA 1DL6A 2AKLA 3S1QI 4A3FI 1ML8A 1TWCI 4A3JI 4NOZA 3VMHA 1R9TI 1Y1VI 4A3EI 3VMGA 4XX2A 3H0GI 4NB8A 3S1NI 4NBCA 2R7ZI 1USPB 3RZDI 3VB9A 3S14I 3S1RI 2JA5I 3GTOI 3GCFA 1YUAA 1LQLA 2E2HI 3HOWI 1I3QI 4A3BI 1USPA 2DE7A 4BBSI 4BY7I 1RO4A 3LUSA 2NVXI 2YU9I 4A93I 3M3YI 1I50I 5CM2M 2R93I 2E2II 2DE6A 1RLYA 3RZOI 2DE5A 3S2DI 3GTJI 3I4MI 4A3II 1L1OC 1VLAA 4BXXI 3GKQA 3EERA 3I07A 1NUIA 5FLMI 3S1MI 3S17I 2JR6A 4A3MI 4QTTA 3M4OI 2B63I 2JS4A 3CQZI 3PO3S 3U50C 2F4OA 2JA8I 3S16I 3PO2I 2JA6I 3HOVI 3HOUI 4A3DI 2VUMI 1I6HI 1TWAI 2J6AA 2HF1A 4QTUA 1WW9A 4NBDA 3S15I 1K83I 1N2FA 3GTGI 5C3EI 5C44I 1SFOI 4NBFA 3PO3I 4A3LI 4NB9A 3HOYI 2NVYI 2P3YA 2R92I 1PFTA 1X3WA 1TWFI 5IP9I 1ZB9A 4BY1I
chains in the Genus database with same CATH superfamily
4E33A 1Q812 3GTMS 2PM9A 1VQK1 3K7AI 4TNUA 3T4NB 1K8A1 2E2JI 1P9NA 2JMOA 4NBEA 4DK1A 1YJW1 4RVFA 3S2HI 3ESWA 1Q811 2K3RA 3G6EZ 1VQ5Z 1K732 4NBGA 3D2LA 2OOXB 4A3CI 4RVGA 4A3FI 1Z02A 3TDHB 4A3JI 4NOZA 1R9TI 1K731 1WIIA 3TE5B 4A3EI 2QRCB 3H0GI 4NB8A 1USPB 2GTHA 3RZDI 3VB9A 3S14I 3GTOI 3CPWY 2PMZA 2JIQA 3G6E1 1VQPZ 2QRDB 1VQ51 2DE7A 1RO4A 1KQSZ 3CCJZ 2R93I 1RLYA 2OZKA 4E2XA 1VLAA 1RNIA 2O4HA 1QVFY 2OTJZ 1NUIA 4QTTA 2QA41 3KIHA 3NDIA 2F4OA 3CCSZ 2LEXA 3F3FC 3S16I 4RV9A 2JA6I 2QKDA 1I6HI 3F3PC 1KC81 1VQ6Z 2LFUA 1VQ9Z 4HH4A 5C3EI 1SFOI 3PO3I 4NB9A 3HOYI 1M1K2 1VQKZ 1QVGY 5T64A 2Y0SA 4HGZA 2K5RA 3MZLB 1TFIA 1K9M1 4MH4A 2OTJ1 2PK7A 1WJ2A 3H3VJ 4NFRA 3Q87A 1JJ2Y 3CCS1 3CCRZ 2JIOA 3VMIA 3GTMI 1K8A2 2JUBA 2E7ZA 3GTQI 1QYPA 1ZH1A 5IP7I 1VQ61 2F4MA 1VQ91 4A3KI 3VTNA 1W2BY 4A3GI 3CCLZ 2YADA 2R6MA 1Y1VS 5C4XI 5C4JI 2ZAEB 3IX0A 2QEXZ 3S1QI 2M6NA 4EWCA 1ML8A 3BG1B 3IF8A 1RO2A 3CMEZ 3FQQA 1S72Z 3IFUA 3VMHA 4NH1C 3OW2Y 5D1OB 5FLXb 2E9HA 4HGYA 3CCR1 2VPZA 2R7ZI 3S1RI 2JA5I 2H85A 1LQLA 3P5JB 1VQ71 1I3QI 1VQNZ 5T6BA 3CCL1 2VPXA 4MXUA 3LUSA 2YU9I 4BY7I 3NH8A 4A93I 3MZKB 4E31A 3BG0B 2DE6A 5IT9b 2QEX1 1Q7Y2 2GU2A 2QA4Z 3NFZA 3CME1 3I56Z 1S721 3EERA 3GKQA 4E2YA 1Z01A 3S17I 2IZ4A 2B63I 3KIFA 3CXCY 2JS4A 1YHQZ 2OOYB 3HOVI 3CCUZ 1VQ81 4A3DI 1Q861 1Q7Y1 3QWUA 1TWAI 4E30A 1VQN1 3S15I 3EEDA 5C44I 4NBFA 1N8R1 3CC4Z 1KC82 2R92I 1TWFI 1YJNZ 1ZB9A 2JNYA 2V8KA 1VQLZ 3NH5A 3CCMZ 1QVGZ 2GTIA 3I561 3I4NI 1ZB8A 1X3ZA 2RT9A 2NVTI 1YHQ1 3HOXI 1K9M2 1FDIA 1M902 3CCU1 3G71Z 3HOZI 2NVQI 4Y52I 2RIQA 2V8JA 1WCMI 4RVDA 4DQYB 3CC41 2RBLA 1Q821 5T67A 2BJOA 1KQSY 5FLXf 2KI7B 3CC7Z 2G2KA 3FKII 4Y7NI 2KPIA 1YJN1 1DL6A 1M901 1W2BZ 1VQ4Z 5D1PA 2VPYA 1VQL1 2AKLA 2AYDA 3CCM1 4E2WA 2V3VA 2I3CA 4MONA 1NJI2 1Y1VI 4MD9A 2OTLZ 4XX2A 2JIMA 3I55Z 3S1NI 1VQ7Z 1KRLA 2VF1A 3G711 3OW2Z 5IT9f 2RHBA 4CL1A 3GCFA 3HOWI 4A3BI 1USPA 4MD8A 5A2Qb 2QREB 3CC2Z 1NJI1 4BBSI 2EGTA 4DGLA 3J81b 3CC71 2QR1B 3JAMb 2E2II 1VQ41 2O53A 3RZOI 3S2DI 3J80b 2JIPA 3I4MI 2V45A 3HKZA 3CCE1 4BXXI 5FLMI 3I07A 3NH4A 3S1MI 4A3MI 3J7A4 1VQ8Z 2OTL1 1SIWA 1VQMZ 3U50C 3I551 1QF8A 2JIRA 1RO0A 3FQMA 3CXCZ 3CPWZ 2J6AA 2HF1A 2Q4ZA 5AN9F 1WW9A 3CD6Z 2IV2X 3CMAZ 3CC21 4A3LI 1Q862 2NAPA 2P3YA 2Q51A 1PFTA 5IP9I 4BY1I 4MRIA 3D6WA 4NBBA 1N8R2 3CCQZ 4RS4A 3D9XA 3GTPI 4AYBA 4X6AI 1QVFZ 2RPRA 2JA7I 1VQM1 3GTKI 4NBAA 1YI2Z 3CD61 5LL6f 1TWHI 1TWGI 1Q16A 3CMA1 1Y1WI 1YIJZ 1RQFA 4NBHA 2LIYA 4E32A 1YITZ 2M48A 3GTLI 3IR7A 4BBRI 1VQOZ 2WAQA 3MONA 1Q822 3CCQ1 1NP6A 2P28A 1TWCI 5A2Qf 1YUKA 3VMGA 1QXFA 1Z03A 1JJ2Z 3J81f 3JAMf 4NBCA 1YI21 5D1OA 2HU9A 1Y8CA 2IZ3A 3NDJA 1YUAA 3J80f 2E2HI 4MD7A 1JWHC 2V8IA 1YIJ1 4RVHA 2NVXI 1KD12 1YIT1 1VQP1 3M3YI 1I50I 2VPWA 5CM2M 1VQO1 3G4SZ 3CCEZ 1YJ9Z 3CCVZ 2W03A 2DE5A 3GTJI 3CCJ1 4S1TA 1FDOA 4A3II 1L1OC 2JR6A 3M4OI 1WZNA 3CQZI 3PO3S 1AA6A 1YJWZ 1KD11 2JA8I 2VUGA 1S7MA 3PO2I 2WB1A 3HOUI 4E2ZA 2VUMI 2QLVB 4QTUA 1M1K1 4NBDA 1X0TA 1K83I 1N2FA 3GTGI 2NVYI 2W04A 1X3WA 3G4S1 1YJ91 3CCV1
chains in the Genus database with same CATH topology
4E33A 1Q812 3GTMS 2PM9A 1VQK1 3K7AI 4TNUA 3T4NB 1K8A1 2E2JI 1P9NA 2JMOA 4NBEA 4DK1A 1YJW1 4RVFA 3S2HI 3ESWA 1Q811 2K3RA 3G6EZ 1VQ5Z 1K732 4NBGA 2OOXB 4A3CI 4RVGA 4A3FI 1Z02A 3TDHB 4A3JI 4NOZA 1R9TI 1K731 1WIIA 3TE5B 4A3EI 2QRCB 3H0GI 4NB8A 1USPB 2GTHA 3RZDI 3VB9A 3S14I 3GTOI 3CPWY 2PMZA 3G6E1 1VQPZ 2QRDB 1VQ51 2DE7A 1RO4A 1KQSZ 3CCJZ 2R93I 1RLYA 2OZKA 4E2XA 1VLAA 1RNIA 2O4HA 1QVFY 2OTJZ 1NUIA 4QTTA 2QA41 3KIHA 3NDIA 2F4OA 3CCSZ 3S16I 3F3FC 4RV9A 2JA6I 2QKDA 1I6HI 3F3PC 1KC81 1VQ6Z 2LFUA 1VQ9Z 4HH4A 5C3EI 1SFOI 3PO3I 4NB9A 3HOYI 1M1K2 1VQKZ 1QVGY 5T64A 2Y0SA 4HGZA 2K5RA 3MZLB 1TFIA 1K9M1 4MH4A 2OTJ1 2PK7A 3H3VJ 4NFRA 3Q87A 1JJ2Y 3CCS1 3CCRZ 3VMIA 3GTMI 1K8A2 2JUBA 3GTQI 1QYPA 1ZH1A 5IP7I 1VQ61 2F4MA 1VQ91 4A3KI 3VTNA 1W2BY 4A3GI 3CCLZ 2YADA 2R6MA 1Y1VS 5C4XI 5C4JI 2ZAEB 3IX0A 2QEXZ 3S1QI 2M6NA 4EWCA 1ML8A 3BG1B 3IF8A 1RO2A 3CMEZ 3FQQA 1S72Z 3IFUA 3VMHA 4NH1C 3OW2Y 5D1OB 5FLXb 2E9HA 4HGYA 3CCR1 2R7ZI 3S1RI 2JA5I 2H85A 1LQLA 3P5JB 1VQ71 1I3QI 1VQNZ 5T6BA 3CCL1 4MXUA 3LUSA 2YU9I 4BY7I 3NH8A 4A93I 3MZKB 4E31A 3BG0B 2DE6A 5IT9b 2QEX1 1Q7Y2 2GU2A 3CME1 3NFZA 2QA4Z 3I56Z 1S721 3EERA 3GKQA 4E2YA 1Z01A 3S17I 2IZ4A 2B63I 1YHQZ 3KIFA 3CXCY 2JS4A 2OOYB 3HOVI 3CCUZ 1VQ81 4A3DI 1Q861 1Q7Y1 3QWUA 1TWAI 4E30A 1VQN1 3S15I 3EEDA 5C44I 4NBFA 1N8R1 3CC4Z 1KC82 2R92I 1TWFI 1YJNZ 1ZB9A 2JNYA 2V8KA 1VQLZ 3NH5A 3CCMZ 1QVGZ 2GTIA 3I561 3I4NI 1ZB8A 1X3ZA 2RT9A 2NVTI 1YHQ1 3HOXI 1K9M2 1M902 3CCU1 3G71Z 3HOZI 2NVQI 4Y52I 2RIQA 2V8JA 1WCMI 4RVDA 4DQYB 3CC41 2RBLA 1Q821 5T67A 2BJOA 1KQSY 5FLXf 2KI7B 3CC7Z 2G2KA 3FKII 4Y7NI 2KPIA 1YJN1 1DL6A 1M901 1W2BZ 1VQ4Z 5D1PA 1VQL1 2AKLA 3CCM1 4E2WA 2I3CA 4MONA 1NJI2 1Y1VI 4MD9A 2OTLZ 4XX2A 3I55Z 3S1NI 1VQ7Z 1KRLA 2VF1A 3G711 3OW2Z 5IT9f 2RHBA 4CL1A 3GCFA 3HOWI 4A3BI 1USPA 4MD8A 5A2Qb 2QREB 3CC2Z 1NJI1 4BBSI 2EGTA 4DGLA 3J81b 3CC71 2QR1B 3JAMb 2E2II 1VQ41 2O53A 3RZOI 3S2DI 3J80b 3I4MI 3HKZA 3CCE1 4BXXI 5FLMI 3I07A 3NH4A 3S1MI 4A3MI 3J7A4 1VQ8Z 2OTL1 1VQMZ 3U50C 3I551 1QF8A 3FQMA 1RO0A 3CXCZ 3CPWZ 2J6AA 2HF1A 2Q4ZA 5AN9F 1WW9A 3CD6Z 3CMAZ 3CC21 4A3LI 1Q862 2P3YA 2Q51A 1PFTA 5IP9I 4BY1I 4MRIA 3D6WA 4NBBA 1N8R2 3CCQZ 4RS4A 3D9XA 3GTPI 4AYBA 4X6AI 1QVFZ 2RPRA 2JA7I 1VQM1 3GTKI 4NBAA 1YI2Z 3CD61 5LL6f 1TWHI 1TWGI 3CMA1 1Y1WI 1YIJZ 1RQFA 4NBHA 2LIYA 4E32A 1YITZ 2M48A 3GTLI 4BBRI 1VQOZ 2WAQA 3MONA 1Q822 3CCQ1 1NP6A 2P28A 1TWCI 5A2Qf 1YUKA 3VMGA 1JJ2Z 1Z03A 3J81f 3JAMf 4NBCA 1YI21 5D1OA 2HU9A 2IZ3A 3NDJA 1YUAA 3J80f 2E2HI 4MD7A 1JWHC 2V8IA 1YIJ1 4RVHA 2NVXI 1KD12 1YIT1 1VQP1 3M3YI 1I50I 5CM2M 1VQO1 3G4SZ 3CCEZ 1YJ9Z 3CCVZ 2W03A 2DE5A 3GTJI 3CCJ1 4S1TA 4A3II 1L1OC 2JR6A 3M4OI 3CQZI 3PO3S 1KD11 1YJWZ 2JA8I 2VUGA 1S7MA 3PO2I 2WB1A 3HOUI 4E2ZA 2VUMI 2QLVB 4QTUA 1M1K1 4NBDA 1X0TA 1K83I 1N2FA 3GTGI 2NVYI 2W04A 1X3WA 3G4S1 1YJ91 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6W A;  4NBB A;  2JNY A;  3GTM S;  2K5R A;  3GTP I;  1TFI A;  4MH4 A;  4X6A I;  3K7A I;  3I4N I;  2JA7 I;  1ZB8 A;  2PK7 A;  3H3V J;  1X3Z A;  3Q87 A;  2NVT I;  2E2J I;  4NBE A;  3GTK I;  3HOX I;  3S2H I;  4NBA A;  3VMI A;  3GTM I;  3HOZ I;  3ESW A;  3GTQ I;  2NVQ I;  4Y52 I;  1QYP A;  5IP7 I;  2F4M A;  1TWH I;  1TWG I;  1WCM I;  4A3K I;  2RBL A;  4NBG A;  1Y1W I;  4A3G I;  4NBH A;  2BJO A;  1Y1V S;  5C4X I;  5C4J I;  3FKI I;  4Y7N I;  3GTL I;  4BBR I;  4A3C I;  2KPI A;  1DL6 A;  2AKL A;  3S1Q I;  4A3F I;  1ML8 A;  1TWC I;  4A3J I;  4NOZ A;  3VMH A;  1R9T I;  1Y1V I;  4A3E I;  3VMG A;  4XX2 A;  3H0G I;  4NB8 A;  3S1N I;  4NBC A;  2R7Z I;  1USP B;  3RZD I;  3VB9 A;  3S14 I;  3S1R I;  2JA5 I;  3GTO I;  3GCF A;  1YUA A;  1LQL A;  2E2H I;  3HOW I;  1I3Q I;  4A3B I;  1USP A;  2DE7 A;  4BBS I;  4BY7 I;  1RO4 A;  3LUS A;  2NVX I;  2YU9 I;  4A93 I;  3M3Y I;  1I50 I;  5CM2 M;  2R93 I;  2E2I I;  2DE6 A;  1RLY A;  3RZO I;  2DE5 A;  3S2D I;  3GTJ I;  3I4M I;  4A3I I;  1L1O C;  1VLA A;  4BXX I;  3GKQ A;  3EER A;  3I07 A;  1NUI A;  5FLM I;  3S1M I;  3S17 I;  2JR6 A;  4A3M I;  4QTT A;  3M4O I;  2B63 I;  2JS4 A;  3CQZ I;  3PO3 S;  3U50 C;  2F4O A;  2JA8 I;  3S16 I;  3PO2 I;  2JA6 I;  3HOV I;  3HOU I;  4A3D I;  2VUM I;  1I6H I;  1TWA I;  2J6A A;  2HF1 A;  4QTU A;  1WW9 A;  4NBD A;  3S15 I;  1K83 I;  1N2F A;  3GTG I;  5C3E I;  5C44 I;  1SFO I;  4NBF A;  3PO3 I;  4A3L I;  4NB9 A;  3HOY I;  2NVY I;  2P3Y A;  2R92 I;  1PFT A;  1X3W A;  1TWF I;  5IP9 I;  1ZB9 A;  4BY1 I; 
#chains in the Genus database with same CATH topology
 4E33 A;  1Q81 2;  3GTM S;  2PM9 A;  1VQK 1;  3K7A I;  4TNU A;  3T4N B;  1K8A 1;  2E2J I;  1P9N A;  2JMO A;  4NBE A;  4DK1 A;  1YJW 1;  4RVF A;  3S2H I;  3ESW A;  1Q81 1;  2K3R A;  3G6E Z;  1VQ5 Z;  1K73 2;  4NBG A;  3D2L A;  2OOX B;  4A3C I;  4RVG A;  4A3F I;  1Z02 A;  3TDH B;  4A3J I;  4NOZ A;  1R9T I;  1K73 1;  1WII A;  3TE5 B;  4A3E I;  2QRC B;  3H0G I;  4NB8 A;  1USP B;  2GTH A;  3RZD I;  3VB9 A;  3S14 I;  3GTO I;  3CPW Y;  2PMZ A;  2JIQ A;  3G6E 1;  1VQP Z;  2QRD B;  1VQ5 1;  2DE7 A;  1RO4 A;  1KQS Z;  3CCJ Z;  2R93 I;  1RLY A;  2OZK A;  4E2X A;  1VLA A;  1RNI A;  2O4H A;  1QVF Y;  2OTJ Z;  1NUI A;  4QTT A;  2QA4 1;  3KIH A;  3NDI A;  2F4O A;  3CCS Z;  2LEX A;  3F3F C;  3S16 I;  4RV9 A;  2JA6 I;  2QKD A;  1I6H I;  3F3P C;  1KC8 1;  1VQ6 Z;  2LFU A;  1VQ9 Z;  4HH4 A;  5C3E I;  1SFO I;  3PO3 I;  4NB9 A;  3HOY I;  1M1K 2;  1VQK Z;  1QVG Y;  5T64 A;  2Y0S A;  4HGZ A;  2K5R A;  3MZL B;  1TFI A;  1K9M 1;  4MH4 A;  2OTJ 1;  2PK7 A;  1WJ2 A;  3H3V J;  4NFR A;  3Q87 A;  1JJ2 Y;  3CCS 1;  3CCR Z;  2JIO A;  3VMI A;  3GTM I;  1K8A 2;  2JUB A;  2E7Z A;  3GTQ I;  1QYP A;  1ZH1 A;  5IP7 I;  1VQ6 1;  2F4M A;  1VQ9 1;  4A3K I;  3VTN A;  1W2B Y;  4A3G I;  3CCL Z;  2YAD A;  2R6M A;  1Y1V S;  5C4X I;  5C4J I;  2ZAE B;  3IX0 A;  2QEX Z;  3S1Q I;  2M6N A;  4EWC A;  1ML8 A;  3BG1 B;  3IF8 A;  1RO2 A;  3CME Z;  3FQQ A;  1S72 Z;  3IFU A;  3VMH A;  4NH1 C;  3OW2 Y;  5D1O B;  5FLX b;  2E9H A;  4HGY A;  3CCR 1;  2VPZ A;  2R7Z I;  3S1R I;  2JA5 I;  2H85 A;  1LQL A;  3P5J B;  1VQ7 1;  1I3Q I;  1VQN Z;  5T6B A;  3CCL 1;  2VPX A;  4MXU A;  3LUS A;  2YU9 I;  4BY7 I;  3NH8 A;  4A93 I;  3MZK B;  4E31 A;  3BG0 B;  2DE6 A;  5IT9 b;  2QEX 1;  1Q7Y 2;  2GU2 A;  2QA4 Z;  3NFZ A;  3CME 1;  3I56 Z;  1S72 1;  3EER A;  3GKQ A;  4E2Y A;  1Z01 A;  3S17 I;  2IZ4 A;  2B63 I;  3KIF A;  3CXC Y;  2JS4 A;  1YHQ Z;  2OOY B;  3HOV I;  3CCU Z;  1VQ8 1;  4A3D I;  1Q86 1;  1Q7Y 1;  3QWU A;  1TWA I;  4E30 A;  1VQN 1;  3S15 I;  3EED A;  5C44 I;  4NBF A;  1N8R 1;  3CC4 Z;  1KC8 2;  2R92 I;  1TWF I;  1YJN Z;  1ZB9 A;  2JNY A;  2V8K A;  1VQL Z;  3NH5 A;  3CCM Z;  1QVG Z;  2GTI A;  3I56 1;  3I4N I;  1ZB8 A;  1X3Z A;  2RT9 A;  2NVT I;  1YHQ 1;  3HOX I;  1K9M 2;  1FDI A;  1M90 2;  3CCU 1;  3G71 Z;  3HOZ I;  2NVQ I;  4Y52 I;  2RIQ A;  2V8J A;  1WCM I;  4RVD A;  4DQY B;  3CC4 1;  2RBL A;  1Q82 1;  5T67 A;  2BJO A;  1KQS Y;  5FLX f;  2KI7 B;  3CC7 Z;  2G2K A;  3FKI I;  4Y7N I;  2KPI A;  1YJN 1;  1DL6 A;  1M90 1;  1W2B Z;  1VQ4 Z;  5D1P A;  2VPY A;  1VQL 1;  2AKL A;  2AYD A;  3CCM 1;  4E2W A;  2V3V A;  2I3C A;  4MON A;  1NJI 2;  1Y1V I;  4MD9 A;  2OTL Z;  4XX2 A;  2JIM A;  3I55 Z;  3S1N I;  1VQ7 Z;  1KRL A;  2VF1 A;  3G71 1;  3OW2 Z;  5IT9 f;  2RHB A;  4CL1 A;  3GCF A;  3HOW I;  4A3B I;  1USP A;  4MD8 A;  5A2Q b;  2QRE B;  3CC2 Z;  1NJI 1;  4BBS I;  2EGT A;  4DGL A;  3J81 b;  3CC7 1;  2QR1 B;  3JAM b;  2E2I I;  1VQ4 1;  2O53 A;  3RZO I;  3S2D I;  3J80 b;  2JIP A;  3I4M I;  2V45 A;  3HKZ A;  3CCE 1;  4BXX I;  5FLM I;  3I07 A;  3NH4 A;  3S1M I;  4A3M I;  3J7A 4;  1VQ8 Z;  2OTL 1;  1SIW A;  1VQM Z;  3U50 C;  3I55 1;  1QF8 A;  2JIR A;  1RO0 A;  3FQM A;  3CXC Z;  3CPW Z;  2J6A A;  2HF1 A;  2Q4Z A;  5AN9 F;  1WW9 A;  3CD6 Z;  2IV2 X;  3CMA Z;  3CC2 1;  4A3L I;  1Q86 2;  2NAP A;  2P3Y A;  2Q51 A;  1PFT A;  5IP9 I;  4BY1 I;  4MRI A;  3D6W A;  4NBB A;  1N8R 2;  3CCQ Z;  4RS4 A;  3D9X A;  3GTP I;  4AYB A;  4X6A I;  1QVF Z;  2RPR A;  2JA7 I;  1VQM 1;  3GTK I;  4NBA A;  1YI2 Z;  3CD6 1;  5LL6 f;  1TWH I;  1TWG I;  1Q16 A;  3CMA 1;  1Y1W I;  1YIJ Z;  1RQF A;  4NBH A;  2LIY A;  4E32 A;  1YIT Z;  2M48 A;  3GTL I;  3IR7 A;  4BBR I;  1VQO Z;  2WAQ A;  3MON A;  1Q82 2;  3CCQ 1;  1NP6 A;  2P28 A;  1TWC I;  5A2Q f;  1YUK A;  3VMG A;  1QXF A;  1Z03 A;  1JJ2 Z;  3J81 f;  3JAM f;  4NBC A;  1YI2 1;  5D1O A;  2HU9 A;  1Y8C A;  2IZ3 A;  3NDJ A;  1YUA A;  3J80 f;  2E2H I;  4MD7 A;  1JWH C;  2V8I A;  1YIJ 1;  4RVH A;  2NVX I;  1KD1 2;  1YIT 1;  1VQP 1;  3M3Y I;  1I50 I;  2VPW A;  5CM2 M;  1VQO 1;  3G4S Z;  3CCE Z;  1YJ9 Z;  3CCV Z;  2W03 A;  2DE5 A;  3GTJ I;  3CCJ 1;  4S1T A;  1FDO A;  4A3I I;  1L1O C;  2JR6 A;  3M4O I;  1WZN A;  3CQZ I;  3PO3 S;  1AA6 A;  1YJW Z;  1KD1 1;  2JA8 I;  2VUG A;  1S7M A;  3PO2 I;  2WB1 A;  3HOU I;  4E2Z A;  2VUM I;  2QLV B;  4QTU A;  1M1K 1;  4NBD A;  1X0T A;  1K83 I;  1N2F A;  3GTG I;  2NVY I;  2W04 A;  1X3W A;  3G4S 1;  1YJ9 1;  3CCV 1; 
#chains in the Genus database with same CATH homology
 4E33 A;  1Q81 2;  3GTM S;  2PM9 A;  1VQK 1;  3K7A I;  4TNU A;  3T4N B;  1K8A 1;  2E2J I;  1P9N A;  2JMO A;  4NBE A;  4DK1 A;  1YJW 1;  4RVF A;  3S2H I;  3ESW A;  1Q81 1;  2K3R A;  3G6E Z;  1VQ5 Z;  1K73 2;  4NBG A;  2OOX B;  4A3C I;  4RVG A;  4A3F I;  1Z02 A;  3TDH B;  4A3J I;  4NOZ A;  1R9T I;  1K73 1;  1WII A;  3TE5 B;  4A3E I;  2QRC B;  3H0G I;  4NB8 A;  1USP B;  2GTH A;  3RZD I;  3VB9 A;  3S14 I;  3GTO I;  3CPW Y;  2PMZ A;  3G6E 1;  1VQP Z;  2QRD B;  1VQ5 1;  2DE7 A;  1RO4 A;  1KQS Z;  3CCJ Z;  2R93 I;  1RLY A;  2OZK A;  4E2X A;  1VLA A;  1RNI A;  2O4H A;  1QVF Y;  2OTJ Z;  1NUI A;  4QTT A;  2QA4 1;  3KIH A;  3NDI A;  2F4O A;  3CCS Z;  3S16 I;  3F3F C;  4RV9 A;  2JA6 I;  2QKD A;  1I6H I;  3F3P C;  1KC8 1;  1VQ6 Z;  2LFU A;  1VQ9 Z;  4HH4 A;  5C3E I;  1SFO I;  3PO3 I;  4NB9 A;  3HOY I;  1M1K 2;  1VQK Z;  1QVG Y;  5T64 A;  2Y0S A;  4HGZ A;  2K5R A;  3MZL B;  1TFI A;  1K9M 1;  4MH4 A;  2OTJ 1;  2PK7 A;  3H3V J;  4NFR A;  3Q87 A;  1JJ2 Y;  3CCS 1;  3CCR Z;  3VMI A;  3GTM I;  1K8A 2;  2JUB A;  3GTQ I;  1QYP A;  1ZH1 A;  5IP7 I;  1VQ6 1;  2F4M A;  1VQ9 1;  4A3K I;  3VTN A;  1W2B Y;  4A3G I;  3CCL Z;  2YAD A;  2R6M A;  1Y1V S;  5C4X I;  5C4J I;  2ZAE B;  3IX0 A;  2QEX Z;  3S1Q I;  2M6N A;  4EWC A;  1ML8 A;  3BG1 B;  3IF8 A;  1RO2 A;  3CME Z;  3FQQ A;  1S72 Z;  3IFU A;  3VMH A;  4NH1 C;  3OW2 Y;  5D1O B;  5FLX b;  2E9H A;  4HGY A;  3CCR 1;  2R7Z I;  3S1R I;  2JA5 I;  2H85 A;  1LQL A;  3P5J B;  1VQ7 1;  1I3Q I;  1VQN Z;  5T6B A;  3CCL 1;  4MXU A;  3LUS A;  2YU9 I;  4BY7 I;  3NH8 A;  4A93 I;  3MZK B;  4E31 A;  3BG0 B;  2DE6 A;  5IT9 b;  2QEX 1;  1Q7Y 2;  2GU2 A;  3CME 1;  3NFZ A;  2QA4 Z;  3I56 Z;  1S72 1;  3EER A;  3GKQ A;  4E2Y A;  1Z01 A;  3S17 I;  2IZ4 A;  2B63 I;  1YHQ Z;  3KIF A;  3CXC Y;  2JS4 A;  2OOY B;  3HOV I;  3CCU Z;  1VQ8 1;  4A3D I;  1Q86 1;  1Q7Y 1;  3QWU A;  1TWA I;  4E30 A;  1VQN 1;  3S15 I;  3EED A;  5C44 I;  4NBF A;  1N8R 1;  3CC4 Z;  1KC8 2;  2R92 I;  1TWF I;  1YJN Z;  1ZB9 A;  2JNY A;  2V8K A;  1VQL Z;  3NH5 A;  3CCM Z;  1QVG Z;  2GTI A;  3I56 1;  3I4N I;  1ZB8 A;  1X3Z A;  2RT9 A;  2NVT I;  1YHQ 1;  3HOX I;  1K9M 2;  1M90 2;  3CCU 1;  3G71 Z;  3HOZ I;  2NVQ I;  4Y52 I;  2RIQ A;  2V8J A;  1WCM I;  4RVD A;  4DQY B;  3CC4 1;  2RBL A;  1Q82 1;  5T67 A;  2BJO A;  1KQS Y;  5FLX f;  2KI7 B;  3CC7 Z;  2G2K A;  3FKI I;  4Y7N I;  2KPI A;  1YJN 1;  1DL6 A;  1M90 1;  1W2B Z;  1VQ4 Z;  5D1P A;  1VQL 1;  2AKL A;  3CCM 1;  4E2W A;  2I3C A;  4MON A;  1NJI 2;  1Y1V I;  4MD9 A;  2OTL Z;  4XX2 A;  3I55 Z;  3S1N I;  1VQ7 Z;  1KRL A;  2VF1 A;  3G71 1;  3OW2 Z;  5IT9 f;  2RHB A;  4CL1 A;  3GCF A;  3HOW I;  4A3B I;  1USP A;  4MD8 A;  5A2Q b;  2QRE B;  3CC2 Z;  1NJI 1;  4BBS I;  2EGT A;  4DGL A;  3J81 b;  3CC7 1;  2QR1 B;  3JAM b;  2E2I I;  1VQ4 1;  2O53 A;  3RZO I;  3S2D I;  3J80 b;  3I4M I;  3HKZ A;  3CCE 1;  4BXX I;  5FLM I;  3I07 A;  3NH4 A;  3S1M I;  4A3M I;  3J7A 4;  1VQ8 Z;  2OTL 1;  1VQM Z;  3U50 C;  3I55 1;  1QF8 A;  3FQM A;  1RO0 A;  3CXC Z;  3CPW Z;  2J6A A;  2HF1 A;  2Q4Z A;  5AN9 F;  1WW9 A;  3CD6 Z;  3CMA Z;  3CC2 1;  4A3L I;  1Q86 2;  2P3Y A;  2Q51 A;  1PFT A;  5IP9 I;  4BY1 I;  4MRI A;  3D6W A;  4NBB A;  1N8R 2;  3CCQ Z;  4RS4 A;  3D9X A;  3GTP I;  4AYB A;  4X6A I;  1QVF Z;  2RPR A;  2JA7 I;  1VQM 1;  3GTK I;  4NBA A;  1YI2 Z;  3CD6 1;  5LL6 f;  1TWH I;  1TWG I;  3CMA 1;  1Y1W I;  1YIJ Z;  1RQF A;  4NBH A;  2LIY A;  4E32 A;  1YIT Z;  2M48 A;  3GTL I;  4BBR I;  1VQO Z;  2WAQ A;  3MON A;  1Q82 2;  3CCQ 1;  1NP6 A;  2P28 A;  1TWC I;  5A2Q f;  1YUK A;  3VMG A;  1JJ2 Z;  1Z03 A;  3J81 f;  3JAM f;  4NBC A;  1YI2 1;  5D1O A;  2HU9 A;  2IZ3 A;  3NDJ A;  1YUA A;  3J80 f;  2E2H I;  4MD7 A;  1JWH C;  2V8I A;  1YIJ 1;  4RVH A;  2NVX I;  1KD1 2;  1YIT 1;  1VQP 1;  3M3Y I;  1I50 I;  5CM2 M;  1VQO 1;  3G4S Z;  3CCE Z;  1YJ9 Z;  3CCV Z;  2W03 A;  2DE5 A;  3GTJ I;  3CCJ 1;  4S1T A;  4A3I I;  1L1O C;  2JR6 A;  3M4O I;  3CQZ I;  3PO3 S;  1KD1 1;  1YJW Z;  2JA8 I;  2VUG A;  1S7M A;  3PO2 I;  2WB1 A;  3HOU I;  4E2Z A;  2VUM I;  2QLV B;  4QTU A;  1M1K 1;  4NBD A;  1X0T A;  1K83 I;  1N2F A;  3GTG I;  2NVY I;  2W04 A;  1X3W A;  3G4S 1;  1YJ9 1;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...