3GTOI

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI02
1PFTA 3HOZI 3GTMS 2E2II 5C3EI 5IP9I 4NB8A 3I4NI 1ML8A 4A3MI 4NBCA 2R93I 2DE6A 2KPIA 2YU9I 3GCFA 1R9TI 1I50I 3VMGA 4A3KI 3GTGI 1L1OC 5C4JI 4A3CI 3GTOI 3EERA 3ESWA 4NBFA 3GTKI 3U50C 2E2HI 3GTPI 4A3JI 1RLYA 3GKQA 3S15I 1YUAA 2JR6A 4BBRI 4BY7I 3PO3S 3RZOI 4NBEA 3M4OI 3CQZI 4Y52I 2VUMI 3VMHA 3I07A 4QTTA 3S1NI 1Y1WI 4BY1I 1TWHI 5CM2M 2RBLA 3GTLI 2DE5A 1ZB8A 4MH4A 2HF1A 5FLMI 1NUIA 4A3BI 2NVXI 3HOVI 5C44I 1I3QI 2E2JI 3HOYI 3S1QI 1SFOI 1VLAA 4NBGA 2DE7A 4A3EI 2NVTI 2J6AA 2JS4A 4QTUA 4A93I 3K7AI 2F4OA 1K83I 1TWGI 1TWAI 3S2HI 3RZDI 2BJOA 4BXXI 1Y1VS 4NBHA 3S1MI 1ZB9A 3LUSA 3VMIA 1WCMI 3PO2I 2R7ZI 5IP7I 2B63I 3H3VJ 3D6WA 3Q87A 3PO3I 4BBSI 1RO4A 3H0GI 3I4MI 3VB9A 3S17I 4X6AI 4NBDA 2P3YA 2JA8I 3S2DI 1TWFI 1X3ZA 2K5RA 4NBAA 1TFIA 1USPA 2AKLA 3GTJI 4A3II 3GTMI 3S1RI 2NVYI 3FKII 4NB9A 4A3LI 1TWCI 1I6HI 4A3GI 4Y7NI 4A3DI 2PK7A 3HOUI 1WW9A 1Y1VI 2F4MA 3HOWI 1USPB 4NBBA 2JA7I 4XX2A 5C4XI 1QYPA 2JA6I 1DL6A 1LQLA 2R92I 1X3WA 4A3FI 3HOXI 3GTQI 1N2FA 3M3YI 4NOZA 2NVQI 3S14I 2JNYA 2JA5I 3S16I
chains in the Genus database with same CATH superfamily
4E2XA 3F3FC 3IFUA 3I4NI 5AN9F 1ML8A 2OOYB 3NDIA 3CC71 2JMOA 3CCRZ 3I55Z 3GCFA 2QR1B 1VQ4Z 5C4JI 3J7A4 1QVGZ 2P28A 3GTOI 3GTKI 1S72Z 1SIWA 4A3JI 1YHQ1 3G71Z 1M1K1 1NP6A 1QXFA 1VQ51 2E7ZA 4Y52I 3VMHA 2OTL1 2EGTA 4QTTA 5T67A 1Z01A 1Y1WI 3CCE1 3GTLI 1JWHC 2HF1A 5FLMI 1I3QI 1VQN1 1KD12 2E2JI 1KC81 4NBGA 5A2Qb 4A3EI 2QA41 2F4OA 5IT9f 1TWAI 2BJOA 1VQ61 1Y1VS 4NBHA 5T64A 2JIQA 2E9HA 2B63I 3Q87A 3PO3I 3H0GI 3G6E1 2IZ4A 3CCQ1 4E2YA 3I561 4NBDA 3CCJ1 3JAMb 4RVDA 1YI21 1KQSY 4NBAA 3CPWZ 1KQSZ 4A3II 3CMA1 4EWCA 1VQ71 3S1RI 1RO0A 1VQO1 1Q812 2PMZA 4AYBA 2V8JA 2JA7I 1LQLA 3OW2Y 4RV9A 2M48A 5LL6f 2G2KA 3TE5B 3HOXI 1W2BZ 3J80b 3FQMA 2KI7B 2QA4Z 3TDHB 1Q16A 1WJ2A 1PFTA 2E2II 3CCVZ 5C3EI 5IP9I 4RVFA 1VQ6Z 4NBCA 2R93I 1I50I 3GTGI 2VPYA 2QEXZ 2E2HI 2RT9A 1RLYA 2W03A 2RHBA 1K8A1 3EEDA 4BBRI 1VQ81 1KD11 3FQQA 3CC41 1VQKZ 2VUMI 1VQ7Z 1N8R1 1TWHI 1Q811 1NUIA 1S7MA 3HOVI 2Y0SA 1VQOZ 1K9M2 1AA6A 3HOYI 3S1QI 1SFOI 3CCS1 3NH4A 2NVTI 4RVHA 4E31A 1Z02A 1YJW1 3K7AI 2ZAEB 1W2BY 4HH4A 3S2HI 3S1MI 3MZKB 3VMIA 3OW2Z 2LEXA 4HGZA 2JIMA 5FLXf 2JUBA 2AYDA 3I4MI 4MD7A 2QLVB 2JA8I 1TWFI 1X3ZA 4MRIA 2K5RA 4CL1A 1TFIA 1USPA 3I551 2OTLZ 2NVYI 3CCSZ 1KC82 1I6HI 1VQ41 4Y7NI 4A3DI 4A3GI 2Q4ZA 2O4HA 4S1TA 1Y1VI 3HOWI 2F4MA 1YJWZ 3CMEZ 4NBBA 5FLXb 3JAMf 1Q7Y1 1Q862 3HKZA 3CD61 2V8IA 4RS4A 4XX2A 2JA6I 1DL6A 5D1OB 1Q7Y2 1M902 4NFRA 2R92I 4DK1A 1QVFY 2Q51A 1VQ5Z 3GTQI 1FDOA 3M3YI 1VQ91 4NOZA 1WIIA 2JNYA 2R6MA 3S16I 3CCM1 1K732 1VQNZ 4NB8A 3IR7A 4A3MI 3BG1B 3G6EZ 2YU9I 1VQL1 2I3CA 3MONA 2VUGA 3I56Z 1R9TI 3VMGA 4A3KI 1YITZ 5T6BA 3ESWA 4E32A 2OTJ1 3CCUZ 4RVGA 3NDJA 3CPWY 1WZNA 3IF8A 3J81f 3S15I 1YUAA 5D1PA 4BY7I 3PO3S 3D9XA 1YJN1 3M4OI 2QRCB 3I07A 1M1K2 5CM2M 2RBLA 1ZB8A 4MD8A 2NVXI 2H85A 2RIQA 1Y8CA 2VF1A 2DE7A 4E2WA 4MONA 1Q822 1VQLZ 3CCL1 1Z03A 1K8A2 1K83I 1RO2A 3VTNA 1NJI1 2RPRA 1TWGI 3RZDI 3BG0B 3KIFA 1ZB9A 2OTJZ 1WCMI 3PO2I 3CXCZ 3D6WA 3G711 2IV2X 1RO4A 4X6AI 3S17I 3CCV1 2P3YA 3S2DI 1S721 3T4NB 3GTMI 3GTJI 3CCU1 1VQK1 3CC4Z 3FKII 2IZ3A 1NJI2 3G4S1 2WB1A 2QEX1 3HOUI 2GU2A 1WW9A 1YJNZ 3CXCY 3F3PC 1QYPA 4E2ZA 4DQYB 1VQ8Z 1X3WA 2NVQI 3J80f 3S14I 1P9NA 1JJ2Z 2W04A 3CCQZ 3CCLZ 3J81b 3GTMS 3HOZI 3CCJZ 5A2Qf 4TNUA 2DE6A 2KPIA 3CMAZ 5IT9b 4DGLA 1L1OC 4MD9A 1FDIA 4E33A 4A3CI 3NH8A 3EERA 4NBFA 3U50C 2GTIA 1QF8A 3GTPI 3MZLB 2LIYA 1YUKA 1X0TA 3GKQA 1YI2Z 2JIRA 2JR6A 2PM9A 3D2LA 2GTHA 1VQP1 4NBEA 3RZOI 3NH5A 3CQZI 2VPWA 1YJ91 3S1NI 2QKDA 4BY1I 3CD6Z 4HGYA 2DE5A 3QWUA 2V3VA 3G4SZ 4MH4A 2VPXA 4A3BI 5C44I 1YIJZ 1VQM1 2V8KA 2NAPA 1VLAA 2J6AA 2JS4A 3CCMZ 1ZH1A 4QTUA 2WAQA 4A93I 3CME1 2VPZA 4BXXI 1QVFZ 3NFZA 3LUSA 3IX0A 3CCR1 2R7ZI 5IP7I 3H3VJ 2JIOA 1VQ9Z 3CC2Z 4BBSI 1YIT1 2JIPA 3VB9A 1K731 2O53A 2QRDB 1YHQZ 2OZKA 1RQFA 1YIJ1 2AKLA 1Q821 3CC7Z 2V45A 4NH1C 1M901 4NB9A 4A3LI 1TWCI 3CCEZ 2LFUA 1QVGY 2PK7A 1Q861 1VQPZ 1USPB 2QREB 1YJ9Z 2M6NA 1RNIA 5C4XI 2OOXB 1KRLA 1K9M1 1VQMZ 4A3FI 5D1OA 1N2FA 1JJ2Y 3CC21 2K3RA 2YADA 1N8R2 3KIHA 2JA5I 3P5JB 2HU9A 4E30A 4MXUA
chains in the Genus database with same CATH topology
4E2XA 3F3FC 3IFUA 3I4NI 5AN9F 1ML8A 2OOYB 3NDIA 3CC71 2JMOA 3CCRZ 3I55Z 3GCFA 2QR1B 1VQ4Z 5C4JI 3J7A4 1QVGZ 2P28A 3GTOI 3GTKI 1S72Z 4A3JI 1YHQ1 3G71Z 1M1K1 1NP6A 1VQ51 4Y52I 3VMHA 2OTL1 2EGTA 4QTTA 5T67A 1Z01A 1Y1WI 3CCE1 3GTLI 1JWHC 2HF1A 5FLMI 1I3QI 1VQN1 1KD12 2E2JI 1KC81 4NBGA 5A2Qb 4A3EI 2QA41 2F4OA 5IT9f 1TWAI 2BJOA 1VQ61 1Y1VS 4NBHA 5T64A 2E9HA 2B63I 3Q87A 3PO3I 3H0GI 3G6E1 2IZ4A 3CCQ1 4E2YA 3I561 4NBDA 3CCJ1 3JAMb 4RVDA 1YI21 1KQSY 4NBAA 3CPWZ 1KQSZ 4A3II 3CMA1 4EWCA 1VQ71 3S1RI 1RO0A 1VQO1 1Q812 2PMZA 4AYBA 2V8JA 2JA7I 1LQLA 3OW2Y 4RV9A 2M48A 5LL6f 2G2KA 3TE5B 3HOXI 1W2BZ 3J80b 3FQMA 2KI7B 2QA4Z 3TDHB 1PFTA 2E2II 3CCVZ 5C3EI 5IP9I 4RVFA 1VQ6Z 4NBCA 2R93I 1I50I 3GTGI 2QEXZ 2E2HI 2RT9A 1RLYA 2W03A 2RHBA 1K8A1 3EEDA 4BBRI 1VQ81 1KD11 3FQQA 3CC41 1VQKZ 2VUMI 1VQ7Z 1N8R1 1TWHI 1Q811 1NUIA 1S7MA 3HOVI 2Y0SA 1VQOZ 1K9M2 3HOYI 3S1QI 1SFOI 3CCS1 3NH4A 2NVTI 4RVHA 4E31A 1Z02A 1YJW1 3K7AI 2ZAEB 1W2BY 4HH4A 3S2HI 3S1MI 3MZKB 3VMIA 3OW2Z 4HGZA 5FLXf 2JUBA 3I4MI 4MD7A 2QLVB 2JA8I 1TWFI 1X3ZA 4MRIA 2K5RA 4CL1A 1TFIA 1USPA 3I551 2OTLZ 2NVYI 3CCSZ 1KC82 1I6HI 1VQ41 4Y7NI 4A3DI 4A3GI 2Q4ZA 2O4HA 4S1TA 1Y1VI 3HOWI 2F4MA 1YJWZ 3CMEZ 4NBBA 5FLXb 3JAMf 1Q7Y1 1Q862 3HKZA 3CD61 2V8IA 4RS4A 4XX2A 2JA6I 1DL6A 5D1OB 1Q7Y2 1M902 4NFRA 2R92I 4DK1A 1QVFY 2Q51A 1VQ5Z 3GTQI 3M3YI 1VQ91 4NOZA 1WIIA 2JNYA 2R6MA 3S16I 3CCM1 1K732 1VQNZ 4NB8A 4A3MI 3BG1B 3G6EZ 2YU9I 1VQL1 2I3CA 3MONA 2VUGA 3I56Z 1R9TI 3VMGA 4A3KI 1YITZ 5T6BA 3ESWA 4E32A 2OTJ1 3CCUZ 4RVGA 3NDJA 3CPWY 3IF8A 3J81f 3S15I 1YUAA 5D1PA 4BY7I 3PO3S 3D9XA 1YJN1 3M4OI 2QRCB 3I07A 1M1K2 5CM2M 2RBLA 1ZB8A 4MD8A 2NVXI 2H85A 2RIQA 2VF1A 2DE7A 4E2WA 4MONA 1Q822 1VQLZ 3CCL1 1Z03A 1K8A2 1K83I 1RO2A 3VTNA 1NJI1 2RPRA 1TWGI 3RZDI 3BG0B 3KIFA 1ZB9A 2OTJZ 1WCMI 3PO2I 3CXCZ 3D6WA 3G711 1RO4A 4X6AI 3S17I 3CCV1 2P3YA 3S2DI 1S721 3T4NB 3GTMI 3GTJI 3CCU1 1VQK1 3CC4Z 3FKII 2IZ3A 1NJI2 3G4S1 2WB1A 2QEX1 3HOUI 2GU2A 1WW9A 1YJNZ 3CXCY 3F3PC 1QYPA 4E2ZA 4DQYB 1VQ8Z 1X3WA 2NVQI 3J80f 3S14I 1P9NA 1JJ2Z 2W04A 3CCQZ 3CCLZ 3J81b 3GTMS 3HOZI 3CCJZ 5A2Qf 4TNUA 2DE6A 2KPIA 3CMAZ 5IT9b 4DGLA 1L1OC 4MD9A 4E33A 4A3CI 3NH8A 3EERA 4NBFA 3U50C 2GTIA 1QF8A 3GTPI 3MZLB 2LIYA 1YUKA 1X0TA 3GKQA 1YI2Z 2JR6A 2PM9A 1VQP1 2GTHA 3RZOI 4NBEA 3NH5A 3CQZI 1YJ91 3S1NI 2QKDA 4BY1I 3CD6Z 4HGYA 2DE5A 3QWUA 3G4SZ 4MH4A 4A3BI 5C44I 1YIJZ 1VQM1 2V8KA 1VLAA 2J6AA 2JS4A 3CCMZ 1ZH1A 4QTUA 2WAQA 4A93I 3CME1 4BXXI 1QVFZ 3NFZA 3LUSA 3IX0A 3CCR1 2R7ZI 5IP7I 3H3VJ 1VQ9Z 3CC2Z 4BBSI 1YIT1 3VB9A 1K731 2O53A 2QRDB 1YHQZ 2OZKA 1RQFA 1YIJ1 2AKLA 1Q821 3CC7Z 4NH1C 1M901 4NB9A 4A3LI 1TWCI 3CCEZ 2LFUA 1QVGY 2PK7A 1Q861 1VQPZ 1USPB 2QREB 1YJ9Z 2M6NA 1RNIA 5C4XI 2OOXB 1KRLA 1K9M1 1VQMZ 4A3FI 5D1OA 1N2FA 1JJ2Y 3CC21 2K3RA 2YADA 1N8R2 3KIHA 2JA5I 3P5JB 2HU9A 4E30A 4MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFT A;  3HOZ I;  3GTM S;  2E2I I;  5C3E I;  5IP9 I;  4NB8 A;  3I4N I;  1ML8 A;  4A3M I;  4NBC A;  2R93 I;  2DE6 A;  2KPI A;  2YU9 I;  3GCF A;  1R9T I;  1I50 I;  3VMG A;  4A3K I;  3GTG I;  1L1O C;  5C4J I;  4A3C I;  3GTO I;  3EER A;  3ESW A;  4NBF A;  3GTK I;  3U50 C;  2E2H I;  3GTP I;  4A3J I;  1RLY A;  3GKQ A;  3S15 I;  1YUA A;  2JR6 A;  4BBR I;  4BY7 I;  3PO3 S;  3RZO I;  4NBE A;  3M4O I;  3CQZ I;  4Y52 I;  2VUM I;  3VMH A;  3I07 A;  4QTT A;  3S1N I;  1Y1W I;  4BY1 I;  1TWH I;  5CM2 M;  2RBL A;  3GTL I;  2DE5 A;  1ZB8 A;  4MH4 A;  2HF1 A;  5FLM I;  1NUI A;  4A3B I;  2NVX I;  3HOV I;  5C44 I;  1I3Q I;  2E2J I;  3HOY I;  3S1Q I;  1SFO I;  1VLA A;  4NBG A;  2DE7 A;  4A3E I;  2NVT I;  2J6A A;  2JS4 A;  4QTU A;  4A93 I;  3K7A I;  2F4O A;  1K83 I;  1TWG I;  1TWA I;  3S2H I;  3RZD I;  2BJO A;  4BXX I;  1Y1V S;  4NBH A;  3S1M I;  1ZB9 A;  3LUS A;  3VMI A;  1WCM I;  3PO2 I;  2R7Z I;  5IP7 I;  2B63 I;  3H3V J;  3D6W A;  3Q87 A;  3PO3 I;  4BBS I;  1RO4 A;  3H0G I;  3I4M I;  3VB9 A;  3S17 I;  4X6A I;  4NBD A;  2P3Y A;  2JA8 I;  3S2D I;  1TWF I;  1X3Z A;  2K5R A;  4NBA A;  1TFI A;  1USP A;  2AKL A;  3GTJ I;  4A3I I;  3GTM I;  3S1R I;  2NVY I;  3FKI I;  4NB9 A;  4A3L I;  1TWC I;  1I6H I;  4A3G I;  4Y7N I;  4A3D I;  2PK7 A;  3HOU I;  1WW9 A;  1Y1V I;  2F4M A;  3HOW I;  1USP B;  4NBB A;  2JA7 I;  4XX2 A;  5C4X I;  1QYP A;  2JA6 I;  1DL6 A;  1LQL A;  2R92 I;  1X3W A;  4A3F I;  3HOX I;  3GTQ I;  1N2F A;  3M3Y I;  4NOZ A;  2NVQ I;  3S14 I;  2JNY A;  2JA5 I;  3S16 I; 
#chains in the Genus database with same CATH topology
 4E2X A;  3F3F C;  3IFU A;  3I4N I;  5AN9 F;  1ML8 A;  2OOY B;  3NDI A;  3CC7 1;  2JMO A;  3CCR Z;  3I55 Z;  3GCF A;  2QR1 B;  1VQ4 Z;  5C4J I;  3J7A 4;  1QVG Z;  2P28 A;  3GTO I;  3GTK I;  1S72 Z;  1SIW A;  4A3J I;  1YHQ 1;  3G71 Z;  1M1K 1;  1NP6 A;  1QXF A;  1VQ5 1;  2E7Z A;  4Y52 I;  3VMH A;  2OTL 1;  2EGT A;  4QTT A;  5T67 A;  1Z01 A;  1Y1W I;  3CCE 1;  3GTL I;  1JWH C;  2HF1 A;  5FLM I;  1I3Q I;  1VQN 1;  1KD1 2;  2E2J I;  1KC8 1;  4NBG A;  5A2Q b;  4A3E I;  2QA4 1;  2F4O A;  5IT9 f;  1TWA I;  2BJO A;  1VQ6 1;  1Y1V S;  4NBH A;  5T64 A;  2JIQ A;  2E9H A;  2B63 I;  3Q87 A;  3PO3 I;  3H0G I;  3G6E 1;  2IZ4 A;  3CCQ 1;  4E2Y A;  3I56 1;  4NBD A;  3CCJ 1;  3JAM b;  4RVD A;  1YI2 1;  1KQS Y;  4NBA A;  3CPW Z;  1KQS Z;  4A3I I;  3CMA 1;  4EWC A;  1VQ7 1;  3S1R I;  1RO0 A;  1VQO 1;  1Q81 2;  2PMZ A;  4AYB A;  2V8J A;  2JA7 I;  1LQL A;  3OW2 Y;  4RV9 A;  2M48 A;  5LL6 f;  2G2K A;  3TE5 B;  3HOX I;  1W2B Z;  3J80 b;  3FQM A;  2KI7 B;  2QA4 Z;  3TDH B;  1Q16 A;  1WJ2 A;  1PFT A;  2E2I I;  3CCV Z;  5C3E I;  5IP9 I;  4RVF A;  1VQ6 Z;  4NBC A;  2R93 I;  1I50 I;  3GTG I;  2VPY A;  2QEX Z;  2E2H I;  2RT9 A;  1RLY A;  2W03 A;  2RHB A;  1K8A 1;  3EED A;  4BBR I;  1VQ8 1;  1KD1 1;  3FQQ A;  3CC4 1;  1VQK Z;  2VUM I;  1VQ7 Z;  1N8R 1;  1TWH I;  1Q81 1;  1NUI A;  1S7M A;  3HOV I;  2Y0S A;  1VQO Z;  1K9M 2;  1AA6 A;  3HOY I;  3S1Q I;  1SFO I;  3CCS 1;  3NH4 A;  2NVT I;  4RVH A;  4E31 A;  1Z02 A;  1YJW 1;  3K7A I;  2ZAE B;  1W2B Y;  4HH4 A;  3S2H I;  3S1M I;  3MZK B;  3VMI A;  3OW2 Z;  2LEX A;  4HGZ A;  2JIM A;  5FLX f;  2JUB A;  2AYD A;  3I4M I;  4MD7 A;  2QLV B;  2JA8 I;  1TWF I;  1X3Z A;  4MRI A;  2K5R A;  4CL1 A;  1TFI A;  1USP A;  3I55 1;  2OTL Z;  2NVY I;  3CCS Z;  1KC8 2;  1I6H I;  1VQ4 1;  4Y7N I;  4A3D I;  4A3G I;  2Q4Z A;  2O4H A;  4S1T A;  1Y1V I;  3HOW I;  2F4M A;  1YJW Z;  3CME Z;  4NBB A;  5FLX b;  3JAM f;  1Q7Y 1;  1Q86 2;  3HKZ A;  3CD6 1;  2V8I A;  4RS4 A;  4XX2 A;  2JA6 I;  1DL6 A;  5D1O B;  1Q7Y 2;  1M90 2;  4NFR A;  2R92 I;  4DK1 A;  1QVF Y;  2Q51 A;  1VQ5 Z;  3GTQ I;  1FDO A;  3M3Y I;  1VQ9 1;  4NOZ A;  1WII A;  2JNY A;  2R6M A;  3S16 I;  3CCM 1;  1K73 2;  1VQN Z;  4NB8 A;  3IR7 A;  4A3M I;  3BG1 B;  3G6E Z;  2YU9 I;  1VQL 1;  2I3C A;  3MON A;  2VUG A;  3I56 Z;  1R9T I;  3VMG A;  4A3K I;  1YIT Z;  5T6B A;  3ESW A;  4E32 A;  2OTJ 1;  3CCU Z;  4RVG A;  3NDJ A;  3CPW Y;  1WZN A;  3IF8 A;  3J81 f;  3S15 I;  1YUA A;  5D1P A;  4BY7 I;  3PO3 S;  3D9X A;  1YJN 1;  3M4O I;  2QRC B;  3I07 A;  1M1K 2;  5CM2 M;  2RBL A;  1ZB8 A;  4MD8 A;  2NVX I;  2H85 A;  2RIQ A;  1Y8C A;  2VF1 A;  2DE7 A;  4E2W A;  4MON A;  1Q82 2;  1VQL Z;  3CCL 1;  1Z03 A;  1K8A 2;  1K83 I;  1RO2 A;  3VTN A;  1NJI 1;  2RPR A;  1TWG I;  3RZD I;  3BG0 B;  3KIF A;  1ZB9 A;  2OTJ Z;  1WCM I;  3PO2 I;  3CXC Z;  3D6W A;  3G71 1;  2IV2 X;  1RO4 A;  4X6A I;  3S17 I;  3CCV 1;  2P3Y A;  3S2D I;  1S72 1;  3T4N B;  3GTM I;  3GTJ I;  3CCU 1;  1VQK 1;  3CC4 Z;  3FKI I;  2IZ3 A;  1NJI 2;  3G4S 1;  2WB1 A;  2QEX 1;  3HOU I;  2GU2 A;  1WW9 A;  1YJN Z;  3CXC Y;  3F3P C;  1QYP A;  4E2Z A;  4DQY B;  1VQ8 Z;  1X3W A;  2NVQ I;  3J80 f;  3S14 I;  1P9N A;  1JJ2 Z;  2W04 A;  3CCQ Z;  3CCL Z;  3J81 b;  3GTM S;  3HOZ I;  3CCJ Z;  5A2Q f;  4TNU A;  2DE6 A;  2KPI A;  3CMA Z;  5IT9 b;  4DGL A;  1L1O C;  4MD9 A;  1FDI A;  4E33 A;  4A3C I;  3NH8 A;  3EER A;  4NBF A;  3U50 C;  2GTI A;  1QF8 A;  3GTP I;  3MZL B;  2LIY A;  1YUK A;  1X0T A;  3GKQ A;  1YI2 Z;  2JIR A;  2JR6 A;  2PM9 A;  3D2L A;  2GTH A;  1VQP 1;  4NBE A;  3RZO I;  3NH5 A;  3CQZ I;  2VPW A;  1YJ9 1;  3S1N I;  2QKD A;  4BY1 I;  3CD6 Z;  4HGY A;  2DE5 A;  3QWU A;  2V3V A;  3G4S Z;  4MH4 A;  2VPX A;  4A3B I;  5C44 I;  1YIJ Z;  1VQM 1;  2V8K A;  2NAP A;  1VLA A;  2J6A A;  2JS4 A;  3CCM Z;  1ZH1 A;  4QTU A;  2WAQ A;  4A93 I;  3CME 1;  2VPZ A;  4BXX I;  1QVF Z;  3NFZ A;  3LUS A;  3IX0 A;  3CCR 1;  2R7Z I;  5IP7 I;  3H3V J;  2JIO A;  1VQ9 Z;  3CC2 Z;  4BBS I;  1YIT 1;  2JIP A;  3VB9 A;  1K73 1;  2O53 A;  2QRD B;  1YHQ Z;  2OZK A;  1RQF A;  1YIJ 1;  2AKL A;  1Q82 1;  3CC7 Z;  2V45 A;  4NH1 C;  1M90 1;  4NB9 A;  4A3L I;  1TWC I;  3CCE Z;  2LFU A;  1QVG Y;  2PK7 A;  1Q86 1;  1VQP Z;  1USP B;  2QRE B;  1YJ9 Z;  2M6N A;  1RNI A;  5C4X I;  2OOX B;  1KRL A;  1K9M 1;  1VQM Z;  4A3F I;  5D1O A;  1N2F A;  1JJ2 Y;  3CC2 1;  2K3R A;  2YAD A;  1N8R 2;  3KIH A;  2JA5 I;  3P5J B;  2HU9 A;  4E30 A;  4MXU A; 
#chains in the Genus database with same CATH homology
 4E2X A;  3F3F C;  3IFU A;  3I4N I;  5AN9 F;  1ML8 A;  2OOY B;  3NDI A;  3CC7 1;  2JMO A;  3CCR Z;  3I55 Z;  3GCF A;  2QR1 B;  1VQ4 Z;  5C4J I;  3J7A 4;  1QVG Z;  2P28 A;  3GTO I;  3GTK I;  1S72 Z;  4A3J I;  1YHQ 1;  3G71 Z;  1M1K 1;  1NP6 A;  1VQ5 1;  4Y52 I;  3VMH A;  2OTL 1;  2EGT A;  4QTT A;  5T67 A;  1Z01 A;  1Y1W I;  3CCE 1;  3GTL I;  1JWH C;  2HF1 A;  5FLM I;  1I3Q I;  1VQN 1;  1KD1 2;  2E2J I;  1KC8 1;  4NBG A;  5A2Q b;  4A3E I;  2QA4 1;  2F4O A;  5IT9 f;  1TWA I;  2BJO A;  1VQ6 1;  1Y1V S;  4NBH A;  5T64 A;  2E9H A;  2B63 I;  3Q87 A;  3PO3 I;  3H0G I;  3G6E 1;  2IZ4 A;  3CCQ 1;  4E2Y A;  3I56 1;  4NBD A;  3CCJ 1;  3JAM b;  4RVD A;  1YI2 1;  1KQS Y;  4NBA A;  3CPW Z;  1KQS Z;  4A3I I;  3CMA 1;  4EWC A;  1VQ7 1;  3S1R I;  1RO0 A;  1VQO 1;  1Q81 2;  2PMZ A;  4AYB A;  2V8J A;  2JA7 I;  1LQL A;  3OW2 Y;  4RV9 A;  2M48 A;  5LL6 f;  2G2K A;  3TE5 B;  3HOX I;  1W2B Z;  3J80 b;  3FQM A;  2KI7 B;  2QA4 Z;  3TDH B;  1PFT A;  2E2I I;  3CCV Z;  5C3E I;  5IP9 I;  4RVF A;  1VQ6 Z;  4NBC A;  2R93 I;  1I50 I;  3GTG I;  2QEX Z;  2E2H I;  2RT9 A;  1RLY A;  2W03 A;  2RHB A;  1K8A 1;  3EED A;  4BBR I;  1VQ8 1;  1KD1 1;  3FQQ A;  3CC4 1;  1VQK Z;  2VUM I;  1VQ7 Z;  1N8R 1;  1TWH I;  1Q81 1;  1NUI A;  1S7M A;  3HOV I;  2Y0S A;  1VQO Z;  1K9M 2;  3HOY I;  3S1Q I;  1SFO I;  3CCS 1;  3NH4 A;  2NVT I;  4RVH A;  4E31 A;  1Z02 A;  1YJW 1;  3K7A I;  2ZAE B;  1W2B Y;  4HH4 A;  3S2H I;  3S1M I;  3MZK B;  3VMI A;  3OW2 Z;  4HGZ A;  5FLX f;  2JUB A;  3I4M I;  4MD7 A;  2QLV B;  2JA8 I;  1TWF I;  1X3Z A;  4MRI A;  2K5R A;  4CL1 A;  1TFI A;  1USP A;  3I55 1;  2OTL Z;  2NVY I;  3CCS Z;  1KC8 2;  1I6H I;  1VQ4 1;  4Y7N I;  4A3D I;  4A3G I;  2Q4Z A;  2O4H A;  4S1T A;  1Y1V I;  3HOW I;  2F4M A;  1YJW Z;  3CME Z;  4NBB A;  5FLX b;  3JAM f;  1Q7Y 1;  1Q86 2;  3HKZ A;  3CD6 1;  2V8I A;  4RS4 A;  4XX2 A;  2JA6 I;  1DL6 A;  5D1O B;  1Q7Y 2;  1M90 2;  4NFR A;  2R92 I;  4DK1 A;  1QVF Y;  2Q51 A;  1VQ5 Z;  3GTQ I;  3M3Y I;  1VQ9 1;  4NOZ A;  1WII A;  2JNY A;  2R6M A;  3S16 I;  3CCM 1;  1K73 2;  1VQN Z;  4NB8 A;  4A3M I;  3BG1 B;  3G6E Z;  2YU9 I;  1VQL 1;  2I3C A;  3MON A;  2VUG A;  3I56 Z;  1R9T I;  3VMG A;  4A3K I;  1YIT Z;  5T6B A;  3ESW A;  4E32 A;  2OTJ 1;  3CCU Z;  4RVG A;  3NDJ A;  3CPW Y;  3IF8 A;  3J81 f;  3S15 I;  1YUA A;  5D1P A;  4BY7 I;  3PO3 S;  3D9X A;  1YJN 1;  3M4O I;  2QRC B;  3I07 A;  1M1K 2;  5CM2 M;  2RBL A;  1ZB8 A;  4MD8 A;  2NVX I;  2H85 A;  2RIQ A;  2VF1 A;  2DE7 A;  4E2W A;  4MON A;  1Q82 2;  1VQL Z;  3CCL 1;  1Z03 A;  1K8A 2;  1K83 I;  1RO2 A;  3VTN A;  1NJI 1;  2RPR A;  1TWG I;  3RZD I;  3BG0 B;  3KIF A;  1ZB9 A;  2OTJ Z;  1WCM I;  3PO2 I;  3CXC Z;  3D6W A;  3G71 1;  1RO4 A;  4X6A I;  3S17 I;  3CCV 1;  2P3Y A;  3S2D I;  1S72 1;  3T4N B;  3GTM I;  3GTJ I;  3CCU 1;  1VQK 1;  3CC4 Z;  3FKI I;  2IZ3 A;  1NJI 2;  3G4S 1;  2WB1 A;  2QEX 1;  3HOU I;  2GU2 A;  1WW9 A;  1YJN Z;  3CXC Y;  3F3P C;  1QYP A;  4E2Z A;  4DQY B;  1VQ8 Z;  1X3W A;  2NVQ I;  3J80 f;  3S14 I;  1P9N A;  1JJ2 Z;  2W04 A;  3CCQ Z;  3CCL Z;  3J81 b;  3GTM S;  3HOZ I;  3CCJ Z;  5A2Q f;  4TNU A;  2DE6 A;  2KPI A;  3CMA Z;  5IT9 b;  4DGL A;  1L1O C;  4MD9 A;  4E33 A;  4A3C I;  3NH8 A;  3EER A;  4NBF A;  3U50 C;  2GTI A;  1QF8 A;  3GTP I;  3MZL B;  2LIY A;  1YUK A;  1X0T A;  3GKQ A;  1YI2 Z;  2JR6 A;  2PM9 A;  1VQP 1;  2GTH A;  3RZO I;  4NBE A;  3NH5 A;  3CQZ I;  1YJ9 1;  3S1N I;  2QKD A;  4BY1 I;  3CD6 Z;  4HGY A;  2DE5 A;  3QWU A;  3G4S Z;  4MH4 A;  4A3B I;  5C44 I;  1YIJ Z;  1VQM 1;  2V8K A;  1VLA A;  2J6A A;  2JS4 A;  3CCM Z;  1ZH1 A;  4QTU A;  2WAQ A;  4A93 I;  3CME 1;  4BXX I;  1QVF Z;  3NFZ A;  3LUS A;  3IX0 A;  3CCR 1;  2R7Z I;  5IP7 I;  3H3V J;  1VQ9 Z;  3CC2 Z;  4BBS I;  1YIT 1;  3VB9 A;  1K73 1;  2O53 A;  2QRD B;  1YHQ Z;  2OZK A;  1RQF A;  1YIJ 1;  2AKL A;  1Q82 1;  3CC7 Z;  4NH1 C;  1M90 1;  4NB9 A;  4A3L I;  1TWC I;  3CCE Z;  2LFU A;  1QVG Y;  2PK7 A;  1Q86 1;  1VQP Z;  1USP B;  2QRE B;  1YJ9 Z;  2M6N A;  1RNI A;  5C4X I;  2OOX B;  1KRL A;  1K9M 1;  1VQM Z;  4A3F I;  5D1O A;  1N2F A;  1JJ2 Y;  3CC2 1;  2K3R A;  2YAD A;  1N8R 2;  3KIH A;  2JA5 I;  3P5J B;  2HU9 A;  4E30 A;  4MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...