3GTOI

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI02
1Y1VI 1Y1WI 2E2JI 4A3DI 4A3BI 3PO3I 1I50I 3VMHA 3GTOI 4Y52I 1TWAI 3ESWA 1X3WA 5FLMI 2NVTI 3RZOI 4NBDA 1TFIA 4X6AI 3H3VJ 1ZB9A 3M4OI 5IP7I 3HOYI 3I4MI 1N2FA 1PFTA 4NOZA 3U50C 3VB9A 2NVXI 2KPIA 3GTMS 1TWCI 3HOUI 4QTTA 3GTJI 4A3II 2R92I 2NVQI 2PK7A 2R93I 3GTPI 3M3YI 2P3YA 1VLAA 3S2HI 2E2II 3GTMI 1RO4A 2AKLA 3CQZI 4BXXI 4A3GI 5C44I 4NB8A 2JS4A 3K7AI 4NBEA 5IP9I 4NBGA 3S1RI 1L1OC 1Y1VS 1ML8A 2JR6A 1USPB 1ZB8A 1K83I 3S2DI 3GCFA 1LQLA 4MH4A 4XX2A 2RBLA 3GTGI 4BY1I 3GTQI 4NBFA 3S1NI 4A3LI 4QTUA 2VUMI 1DL6A 3S15I 1USPA 5C4JI 3S1MI 1I3QI 3HOZI 4NBHA 4NB9A 3HOWI 4A93I 2DE7A 3H0GI 2NVYI 3GKQA 3S14I 2F4OA 1YUAA 4A3JI 3EERA 4Y7NI 2E2HI 3S1QI 3S17I 4BBSI 5C4XI 1TWGI 2JNYA 2K5RA 2JA7I 1NUIA 2HF1A 2JA5I 3VMIA 2R7ZI 5C3EI 4A3CI 3GTKI 3S16I 2B63I 4NBBA 2JA8I 1TWHI 3D6WA 2BJOA 3HOVI 5CM2M 3RZDI 4A3EI 1I6HI 4NBAA 1QYPA 1X3ZA 3HOXI 4BBRI 3I07A 1WW9A 1R9TI 2DE5A 3LUSA 3FKII 4A3MI 2JA6I 3PO2I 1TWFI 3VMGA 1RLYA 3Q87A 2YU9I 3GTLI 4A3KI 4BY7I 4A3FI 3PO3S 2F4MA 1SFOI 2J6AA 1WCMI 2DE6A 4NBCA 3I4NI
chains in the Genus database with same CATH superfamily
1JWHC 4A3BI 3VMHA 3ESWA 4HGYA 3CC4Z 2PMZA 1VQ8Z 4E2ZA 2VPWA 1ZB9A 2K3RA 3CPWY 1VQ5Z 4E33A 1RNIA 1N2FA 1PFTA 3U50C 4MRIA 1QXFA 4HGZA 1TWCI 4A3II 2NVQI 2QKDA 1YJN1 2P3YA 3S2HI 2R6MA 4DQYB 1RO4A 3G4S1 3CQZI 5C44I 4NB8A 1YJW1 2LIYA 1ZH1A 4MD7A 1YJ9Z 1Y1VS 1WIIA 3VTNA 1USPB 3CC21 1Q821 3GCFA 5D1PA 1LQLA 4MH4A 3GTGI 2EGTA 3GTQI 2V3VA 1VQ9Z 1RO2A 1RQFA 4A3LI 3I55Z 3OW2Z 1YHQZ 1K8A2 1USPA 1K9M1 3S1MI 1I3QI 1Q16A 2V8IA 3HOZI 4NBHA 4NB9A 2V45A 3GKQA 1Q822 2PM9A 3I561 3S1QI 2E2HI 1TWGI 2JMOA 2OTL1 1KRLA 2O4HA 1KD12 4CL1A 3G6E1 3I551 1AA6A 4E2XA 2Y0SA 4RVHA 3J81f 1Q812 2JA8I 2QEX1 3KIHA 2VUGA 4NBAA 1QYPA 2QA4Z 1YI21 3CCJZ 3HOXI 3CCEZ 3I07A 4RVGA 4RS4A 5T6BA 1VQM1 1N8R1 3CCE1 3Q87A 2YU9I 4MXUA 1FDIA 3CXCY 2F4MA 3NH5A 2QEXZ 1JJ2Z 3BG1B 1Y1VI 2RIQA 2M6NA 4Y52I 1TWAI 1K8A1 2G2KA 1VQL1 3RZOI 3M4OI 2Q4ZA 1Z03A 3CMA1 4NOZA 3I56Z 1VQ41 2KI7B 2KPIA 1KQSZ 2VF1A 4DGLA 3HOUI 4QTTA 3GTJI 2R92I 1QF8A 3GTPI 2E9HA 1VLAA 3FQQA 3F3FC 3K7AI 1YI2Z 1L1OC 1ML8A 4E2WA 2JR6A 1ZB8A 1QVFY 3S2DI 4MD8A 2WAQA 4BY1I 3FQMA 3S1NI 4QTUA 3CMAZ 1YJNZ 3MZLB 2JIMA 2RPRA 4A93I 2DE7A 3H0GI 2IV2X 3S14I 1N8R2 1YUAA 1M901 3J7A4 1VQ61 1K731 4Y7NI 4BBSI 3D9XA 2K5RA 3CC41 2VPZA 2HF1A 3CME1 1M1K2 4RV9A 3EEDA 2VPYA 4A3CI 4MONA 4NBBA 1TWHI 3D6WA 1S7MA 5CM2M 3IF8A 1VQ7Z 1YJWZ 2GTHA 1X3ZA 1WJ2A 3G4SZ 1VQK1 2W03A 3CCV1 1VQNZ 3TDHB 4E31A 3KIFA 4A3KI 3CMEZ 1W2BY 2QRCB 2OTJZ 2OTLZ 4NBCA 3JAMf 2V8JA 3I4NI 1YIT1 2H85A 1Y1WI 2E2JI 4A3DI 1I50I 3G71Z 1NJI2 3CCS1 1KQSY 1X3WA 2NVTI 1VQ4Z 1Q862 3CC71 4NBDA 3NDIA 3CC7Z 1W2BZ 1VQLZ 1Z01A 1VQ91 1NP6A 3GTMS 2PK7A 1NJI1 3NH4A 3CC2Z 1KC81 2OTJ1 4S1TA 3GTMI 1WZNA 4RVDA 5A2Qf 2JS4A 1YJ91 5AN9F 4NBGA 2YADA 4RVFA 5IT9b 1X0TA 1SIWA 1VQN1 1M1K1 3CCVZ 1VQKZ 3J81b 3TE5B 5T64A 4XX2A 2RBLA 1Y8CA 2QA41 1S721 2V8KA 1KD11 1DL6A 2Q51A 1VQ51 2IZ3A 3HOWI 4NH1C 4E2YA 3T4NB 3S17I 5C4XI 1VQ6Z 4MD9A 2JA7I 1NUIA 3NH8A 1VQP1 3F3PC 3CCMZ 1K9M2 2R7ZI 2QR1B 1YIJZ 3CD61 2GTIA 3J80b 3GTKI 3S16I 2B63I 2JUBA 3HKZA 3IX0A 3CXCZ 1YHQ1 3CCUZ 3CCLZ 3OW2Y 3RZDI 1Z02A 4A3EI 1I6HI 3CCJ1 2NAPA 3CCQZ 1WW9A 3IR7A 2JA6I 3FKII 4A3MI 3CCR1 1TWFI 1P9NA 3VMGA 4TNUA 5IT9f 3BG0B 4BY7I 3CCL1 3PO3S 2RHBA 3G6EZ 3CPWZ 1SFOI 1WCMI 4AYBA 1Q7Y1 3CD6Z 3PO3I 2OZKA 1M902 3GTOI 4E32A 1K732 2QREB 2LFUA 2JIOA 5FLMI 1FDOA 3NFZA 1TFIA 4X6AI 3H3VJ 1VQO1 5IP7I 4NFRA 3HOYI 4DK1A 3I4MI 1VQ81 2JIPA 2WB1A 3VB9A 2NVXI 2LEXA 4EWCA 2R93I 3M3YI 2E2II 2E7ZA 3JAMb 2VPXA 2AKLA 1S72Z 4BXXI 4A3GI 1JJ2Y 3CCQ1 3NDJA 1QVGY 5IP9I 4NBEA 3S1RI 3MZKB 2I3CA 3MONA 1VQMZ 1K83I 2QLVB 2QRDB 2P28A 3CCM1 4NBFA 3D2LA 2VUMI 3S15I 5C4JI 1RO0A 2JIRA 2AYDA 2GU2A 5FLXb 3J80f 2NVYI 1Q861 5LL6f 5A2Qb 2F4OA 1KC82 4A3JI 2IZ4A 3EERA 1VQOZ 4E30A 2JNYA 5T67A 3QWUA 2W04A 3CCSZ 3VMIA 2ZAEB 3IFUA 4HH4A 3G711 1Q811 1YUKA 5C3EI 2JIQA 1YITZ 3CCRZ 2BJOA 3HOVI 1QVGZ 2OOYB 5D1OA 2RT9A 4BBRI 1R9TI 2DE5A 3LUSA 3PO2I 1QVFZ 2OOXB 1RLYA 1YIJ1 2M48A 2HU9A 3GTLI 1VQ71 4A3FI 1VQPZ 5D1OB 5FLXf 1Q7Y2 3CCU1 2J6AA 2JA5I 2O53A 2DE6A 3P5JB
chains in the Genus database with same CATH topology
1JWHC 4A3BI 3VMHA 3ESWA 4HGYA 3CC4Z 2PMZA 1VQ8Z 4E2ZA 1ZB9A 2K3RA 3CPWY 1VQ5Z 4E33A 1RNIA 1N2FA 1PFTA 3U50C 4MRIA 4HGZA 1TWCI 4A3II 2NVQI 2QKDA 1YJN1 2P3YA 3S2HI 2R6MA 4DQYB 1RO4A 3G4S1 3CQZI 5C44I 4NB8A 1YJW1 2LIYA 1ZH1A 4MD7A 1YJ9Z 1Y1VS 1WIIA 3VTNA 1USPB 3CC21 1Q821 3GCFA 5D1PA 1LQLA 4MH4A 3GTGI 2EGTA 3GTQI 1VQ9Z 1RO2A 1RQFA 4A3LI 3I55Z 3OW2Z 1YHQZ 1K8A2 1USPA 1K9M1 3S1MI 1I3QI 2V8IA 3HOZI 4NBHA 4NB9A 3GKQA 1Q822 2PM9A 3I561 3S1QI 2E2HI 1TWGI 2JMOA 2OTL1 1KRLA 2O4HA 1KD12 4CL1A 3G6E1 3I551 4E2XA 2Y0SA 4RVHA 3J81f 1Q812 2JA8I 2QEX1 3KIHA 2VUGA 4NBAA 1QYPA 2QA4Z 1YI21 3CCJZ 3HOXI 3CCEZ 3I07A 4RVGA 4RS4A 5T6BA 1VQM1 1N8R1 3CCE1 3Q87A 2YU9I 4MXUA 3CXCY 2F4MA 3NH5A 2QEXZ 1JJ2Z 3BG1B 1Y1VI 2RIQA 2M6NA 4Y52I 1TWAI 1K8A1 2G2KA 1VQL1 3RZOI 3M4OI 2Q4ZA 1Z03A 3CMA1 4NOZA 3I56Z 1VQ41 2KI7B 2KPIA 1KQSZ 2VF1A 4DGLA 3HOUI 4QTTA 3GTJI 2R92I 1QF8A 3GTPI 2E9HA 1VLAA 3FQQA 3F3FC 3K7AI 1YI2Z 1L1OC 1ML8A 4E2WA 2JR6A 1ZB8A 1QVFY 3S2DI 4MD8A 2WAQA 4BY1I 3FQMA 3S1NI 4QTUA 3CMAZ 1YJNZ 3MZLB 2RPRA 4A93I 2DE7A 3H0GI 3S14I 1N8R2 1YUAA 1M901 3J7A4 1VQ61 1K731 4Y7NI 4BBSI 3D9XA 2K5RA 3CC41 2HF1A 3CME1 1M1K2 4RV9A 3EEDA 4A3CI 4MONA 4NBBA 1TWHI 3D6WA 1S7MA 5CM2M 3IF8A 1VQ7Z 1YJWZ 2GTHA 1X3ZA 3G4SZ 1VQK1 2W03A 3CCV1 1VQNZ 3TDHB 4E31A 3KIFA 4A3KI 3CMEZ 1W2BY 2QRCB 2OTJZ 2OTLZ 4NBCA 3JAMf 2V8JA 3I4NI 1YIT1 2H85A 1Y1WI 2E2JI 4A3DI 1I50I 3G71Z 1NJI2 3CCS1 1KQSY 1X3WA 2NVTI 1VQ4Z 1Q862 3CC71 4NBDA 3NDIA 3CC7Z 1W2BZ 1VQLZ 1Z01A 1VQ91 1NP6A 3GTMS 2PK7A 1NJI1 3NH4A 3CC2Z 1KC81 2OTJ1 4S1TA 3GTMI 4RVDA 5A2Qf 2JS4A 1YJ91 5AN9F 4NBGA 2YADA 4RVFA 5IT9b 1X0TA 1VQN1 1M1K1 3CCVZ 1VQKZ 3J81b 3TE5B 5T64A 4XX2A 2RBLA 2QA41 1S721 2V8KA 1KD11 1DL6A 2Q51A 1VQ51 2IZ3A 3HOWI 4NH1C 4E2YA 3T4NB 3S17I 5C4XI 1VQ6Z 4MD9A 2JA7I 1NUIA 3NH8A 1VQP1 3F3PC 3CCMZ 1K9M2 2R7ZI 2QR1B 1YIJZ 3CD61 2GTIA 3J80b 3GTKI 3S16I 2B63I 2JUBA 3HKZA 3IX0A 3CXCZ 1YHQ1 3CCUZ 3CCLZ 3OW2Y 3RZDI 1Z02A 4A3EI 1I6HI 3CCJ1 3CCQZ 1WW9A 2JA6I 3FKII 4A3MI 3CCR1 1TWFI 1P9NA 3VMGA 4TNUA 5IT9f 3BG0B 4BY7I 3CCL1 3PO3S 2RHBA 3G6EZ 3CPWZ 1SFOI 1WCMI 4AYBA 1Q7Y1 3CD6Z 3PO3I 2OZKA 1M902 3GTOI 4E32A 1K732 2QREB 2LFUA 5FLMI 3NFZA 1TFIA 4X6AI 3H3VJ 1VQO1 5IP7I 4NFRA 3HOYI 4DK1A 3I4MI 1VQ81 2WB1A 3VB9A 2NVXI 4EWCA 2R93I 3M3YI 2E2II 3JAMb 2AKLA 1S72Z 4BXXI 4A3GI 1JJ2Y 3CCQ1 3NDJA 1QVGY 5IP9I 4NBEA 3S1RI 3MZKB 2I3CA 3MONA 1VQMZ 1K83I 2QLVB 2QRDB 2P28A 3CCM1 4NBFA 2VUMI 3S15I 5C4JI 1RO0A 2GU2A 5FLXb 3J80f 2NVYI 1Q861 5LL6f 5A2Qb 2F4OA 1KC82 4A3JI 2IZ4A 3EERA 1VQOZ 4E30A 2JNYA 5T67A 3QWUA 2W04A 3CCSZ 3VMIA 2ZAEB 3IFUA 4HH4A 3G711 1Q811 1YUKA 5C3EI 1YITZ 3CCRZ 2BJOA 3HOVI 1QVGZ 2OOYB 5D1OA 2RT9A 4BBRI 1R9TI 2DE5A 3LUSA 3PO2I 1QVFZ 2OOXB 1RLYA 1YIJ1 2M48A 2HU9A 3GTLI 1VQ71 4A3FI 1VQPZ 5D1OB 5FLXf 1Q7Y2 3CCU1 2J6AA 2JA5I 2O53A 2DE6A 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  1Y1W I;  2E2J I;  4A3D I;  4A3B I;  3PO3 I;  1I50 I;  3VMH A;  3GTO I;  4Y52 I;  1TWA I;  3ESW A;  1X3W A;  5FLM I;  2NVT I;  3RZO I;  4NBD A;  1TFI A;  4X6A I;  3H3V J;  1ZB9 A;  3M4O I;  5IP7 I;  3HOY I;  3I4M I;  1N2F A;  1PFT A;  4NOZ A;  3U50 C;  3VB9 A;  2NVX I;  2KPI A;  3GTM S;  1TWC I;  3HOU I;  4QTT A;  3GTJ I;  4A3I I;  2R92 I;  2NVQ I;  2PK7 A;  2R93 I;  3GTP I;  3M3Y I;  2P3Y A;  1VLA A;  3S2H I;  2E2I I;  3GTM I;  1RO4 A;  2AKL A;  3CQZ I;  4BXX I;  4A3G I;  5C44 I;  4NB8 A;  2JS4 A;  3K7A I;  4NBE A;  5IP9 I;  4NBG A;  3S1R I;  1L1O C;  1Y1V S;  1ML8 A;  2JR6 A;  1USP B;  1ZB8 A;  1K83 I;  3S2D I;  3GCF A;  1LQL A;  4MH4 A;  4XX2 A;  2RBL A;  3GTG I;  4BY1 I;  3GTQ I;  4NBF A;  3S1N I;  4A3L I;  4QTU A;  2VUM I;  1DL6 A;  3S15 I;  1USP A;  5C4J I;  3S1M I;  1I3Q I;  3HOZ I;  4NBH A;  4NB9 A;  3HOW I;  4A93 I;  2DE7 A;  3H0G I;  2NVY I;  3GKQ A;  3S14 I;  2F4O A;  1YUA A;  4A3J I;  3EER A;  4Y7N I;  2E2H I;  3S1Q I;  3S17 I;  4BBS I;  5C4X I;  1TWG I;  2JNY A;  2K5R A;  2JA7 I;  1NUI A;  2HF1 A;  2JA5 I;  3VMI A;  2R7Z I;  5C3E I;  4A3C I;  3GTK I;  3S16 I;  2B63 I;  4NBB A;  2JA8 I;  1TWH I;  3D6W A;  2BJO A;  3HOV I;  5CM2 M;  3RZD I;  4A3E I;  1I6H I;  4NBA A;  1QYP A;  1X3Z A;  3HOX I;  4BBR I;  3I07 A;  1WW9 A;  1R9T I;  2DE5 A;  3LUS A;  3FKI I;  4A3M I;  2JA6 I;  3PO2 I;  1TWF I;  3VMG A;  1RLY A;  3Q87 A;  2YU9 I;  3GTL I;  4A3K I;  4BY7 I;  4A3F I;  3PO3 S;  2F4M A;  1SFO I;  2J6A A;  1WCM I;  2DE6 A;  4NBC A;  3I4N I; 
#chains in the Genus database with same CATH topology
 1JWH C;  4A3B I;  3VMH A;  3ESW A;  4HGY A;  3CC4 Z;  2PMZ A;  1VQ8 Z;  4E2Z A;  2VPW A;  1ZB9 A;  2K3R A;  3CPW Y;  1VQ5 Z;  4E33 A;  1RNI A;  1N2F A;  1PFT A;  3U50 C;  4MRI A;  1QXF A;  4HGZ A;  1TWC I;  4A3I I;  2NVQ I;  2QKD A;  1YJN 1;  2P3Y A;  3S2H I;  2R6M A;  4DQY B;  1RO4 A;  3G4S 1;  3CQZ I;  5C44 I;  4NB8 A;  1YJW 1;  2LIY A;  1ZH1 A;  4MD7 A;  1YJ9 Z;  1Y1V S;  1WII A;  3VTN A;  1USP B;  3CC2 1;  1Q82 1;  3GCF A;  5D1P A;  1LQL A;  4MH4 A;  3GTG I;  2EGT A;  3GTQ I;  2V3V A;  1VQ9 Z;  1RO2 A;  1RQF A;  4A3L I;  3I55 Z;  3OW2 Z;  1YHQ Z;  1K8A 2;  1USP A;  1K9M 1;  3S1M I;  1I3Q I;  1Q16 A;  2V8I A;  3HOZ I;  4NBH A;  4NB9 A;  2V45 A;  3GKQ A;  1Q82 2;  2PM9 A;  3I56 1;  3S1Q I;  2E2H I;  1TWG I;  2JMO A;  2OTL 1;  1KRL A;  2O4H A;  1KD1 2;  4CL1 A;  3G6E 1;  3I55 1;  1AA6 A;  4E2X A;  2Y0S A;  4RVH A;  3J81 f;  1Q81 2;  2JA8 I;  2QEX 1;  3KIH A;  2VUG A;  4NBA A;  1QYP A;  2QA4 Z;  1YI2 1;  3CCJ Z;  3HOX I;  3CCE Z;  3I07 A;  4RVG A;  4RS4 A;  5T6B A;  1VQM 1;  1N8R 1;  3CCE 1;  3Q87 A;  2YU9 I;  4MXU A;  1FDI A;  3CXC Y;  2F4M A;  3NH5 A;  2QEX Z;  1JJ2 Z;  3BG1 B;  1Y1V I;  2RIQ A;  2M6N A;  4Y52 I;  1TWA I;  1K8A 1;  2G2K A;  1VQL 1;  3RZO I;  3M4O I;  2Q4Z A;  1Z03 A;  3CMA 1;  4NOZ A;  3I56 Z;  1VQ4 1;  2KI7 B;  2KPI A;  1KQS Z;  2VF1 A;  4DGL A;  3HOU I;  4QTT A;  3GTJ I;  2R92 I;  1QF8 A;  3GTP I;  2E9H A;  1VLA A;  3FQQ A;  3F3F C;  3K7A I;  1YI2 Z;  1L1O C;  1ML8 A;  4E2W A;  2JR6 A;  1ZB8 A;  1QVF Y;  3S2D I;  4MD8 A;  2WAQ A;  4BY1 I;  3FQM A;  3S1N I;  4QTU A;  3CMA Z;  1YJN Z;  3MZL B;  2JIM A;  2RPR A;  4A93 I;  2DE7 A;  3H0G I;  2IV2 X;  3S14 I;  1N8R 2;  1YUA A;  1M90 1;  3J7A 4;  1VQ6 1;  1K73 1;  4Y7N I;  4BBS I;  3D9X A;  2K5R A;  3CC4 1;  2VPZ A;  2HF1 A;  3CME 1;  1M1K 2;  4RV9 A;  3EED A;  2VPY A;  4A3C I;  4MON A;  4NBB A;  1TWH I;  3D6W A;  1S7M A;  5CM2 M;  3IF8 A;  1VQ7 Z;  1YJW Z;  2GTH A;  1X3Z A;  1WJ2 A;  3G4S Z;  1VQK 1;  2W03 A;  3CCV 1;  1VQN Z;  3TDH B;  4E31 A;  3KIF A;  4A3K I;  3CME Z;  1W2B Y;  2QRC B;  2OTJ Z;  2OTL Z;  4NBC A;  3JAM f;  2V8J A;  3I4N I;  1YIT 1;  2H85 A;  1Y1W I;  2E2J I;  4A3D I;  1I50 I;  3G71 Z;  1NJI 2;  3CCS 1;  1KQS Y;  1X3W A;  2NVT I;  1VQ4 Z;  1Q86 2;  3CC7 1;  4NBD A;  3NDI A;  3CC7 Z;  1W2B Z;  1VQL Z;  1Z01 A;  1VQ9 1;  1NP6 A;  3GTM S;  2PK7 A;  1NJI 1;  3NH4 A;  3CC2 Z;  1KC8 1;  2OTJ 1;  4S1T A;  3GTM I;  1WZN A;  4RVD A;  5A2Q f;  2JS4 A;  1YJ9 1;  5AN9 F;  4NBG A;  2YAD A;  4RVF A;  5IT9 b;  1X0T A;  1SIW A;  1VQN 1;  1M1K 1;  3CCV Z;  1VQK Z;  3J81 b;  3TE5 B;  5T64 A;  4XX2 A;  2RBL A;  1Y8C A;  2QA4 1;  1S72 1;  2V8K A;  1KD1 1;  1DL6 A;  2Q51 A;  1VQ5 1;  2IZ3 A;  3HOW I;  4NH1 C;  4E2Y A;  3T4N B;  3S17 I;  5C4X I;  1VQ6 Z;  4MD9 A;  2JA7 I;  1NUI A;  3NH8 A;  1VQP 1;  3F3P C;  3CCM Z;  1K9M 2;  2R7Z I;  2QR1 B;  1YIJ Z;  3CD6 1;  2GTI A;  3J80 b;  3GTK I;  3S16 I;  2B63 I;  2JUB A;  3HKZ A;  3IX0 A;  3CXC Z;  1YHQ 1;  3CCU Z;  3CCL Z;  3OW2 Y;  3RZD I;  1Z02 A;  4A3E I;  1I6H I;  3CCJ 1;  2NAP A;  3CCQ Z;  1WW9 A;  3IR7 A;  2JA6 I;  3FKI I;  4A3M I;  3CCR 1;  1TWF I;  1P9N A;  3VMG A;  4TNU A;  5IT9 f;  3BG0 B;  4BY7 I;  3CCL 1;  3PO3 S;  2RHB A;  3G6E Z;  3CPW Z;  1SFO I;  1WCM I;  4AYB A;  1Q7Y 1;  3CD6 Z;  3PO3 I;  2OZK A;  1M90 2;  3GTO I;  4E32 A;  1K73 2;  2QRE B;  2LFU A;  2JIO A;  5FLM I;  1FDO A;  3NFZ A;  1TFI A;  4X6A I;  3H3V J;  1VQO 1;  5IP7 I;  4NFR A;  3HOY I;  4DK1 A;  3I4M I;  1VQ8 1;  2JIP A;  2WB1 A;  3VB9 A;  2NVX I;  2LEX A;  4EWC A;  2R93 I;  3M3Y I;  2E2I I;  2E7Z A;  3JAM b;  2VPX A;  2AKL A;  1S72 Z;  4BXX I;  4A3G I;  1JJ2 Y;  3CCQ 1;  3NDJ A;  1QVG Y;  5IP9 I;  4NBE A;  3S1R I;  3MZK B;  2I3C A;  3MON A;  1VQM Z;  1K83 I;  2QLV B;  2QRD B;  2P28 A;  3CCM 1;  4NBF A;  3D2L A;  2VUM I;  3S15 I;  5C4J I;  1RO0 A;  2JIR A;  2AYD A;  2GU2 A;  5FLX b;  3J80 f;  2NVY I;  1Q86 1;  5LL6 f;  5A2Q b;  2F4O A;  1KC8 2;  4A3J I;  2IZ4 A;  3EER A;  1VQO Z;  4E30 A;  2JNY A;  5T67 A;  3QWU A;  2W04 A;  3CCS Z;  3VMI A;  2ZAE B;  3IFU A;  4HH4 A;  3G71 1;  1Q81 1;  1YUK A;  5C3E I;  2JIQ A;  1YIT Z;  3CCR Z;  2BJO A;  3HOV I;  1QVG Z;  2OOY B;  5D1O A;  2RT9 A;  4BBR I;  1R9T I;  2DE5 A;  3LUS A;  3PO2 I;  1QVF Z;  2OOX B;  1RLY A;  1YIJ 1;  2M48 A;  2HU9 A;  3GTL I;  1VQ7 1;  4A3F I;  1VQP Z;  5D1O B;  5FLX f;  1Q7Y 2;  3CCU 1;  2J6A A;  2JA5 I;  2O53 A;  2DE6 A;  3P5J B; 
#chains in the Genus database with same CATH homology
 1JWH C;  4A3B I;  3VMH A;  3ESW A;  4HGY A;  3CC4 Z;  2PMZ A;  1VQ8 Z;  4E2Z A;  1ZB9 A;  2K3R A;  3CPW Y;  1VQ5 Z;  4E33 A;  1RNI A;  1N2F A;  1PFT A;  3U50 C;  4MRI A;  4HGZ A;  1TWC I;  4A3I I;  2NVQ I;  2QKD A;  1YJN 1;  2P3Y A;  3S2H I;  2R6M A;  4DQY B;  1RO4 A;  3G4S 1;  3CQZ I;  5C44 I;  4NB8 A;  1YJW 1;  2LIY A;  1ZH1 A;  4MD7 A;  1YJ9 Z;  1Y1V S;  1WII A;  3VTN A;  1USP B;  3CC2 1;  1Q82 1;  3GCF A;  5D1P A;  1LQL A;  4MH4 A;  3GTG I;  2EGT A;  3GTQ I;  1VQ9 Z;  1RO2 A;  1RQF A;  4A3L I;  3I55 Z;  3OW2 Z;  1YHQ Z;  1K8A 2;  1USP A;  1K9M 1;  3S1M I;  1I3Q I;  2V8I A;  3HOZ I;  4NBH A;  4NB9 A;  3GKQ A;  1Q82 2;  2PM9 A;  3I56 1;  3S1Q I;  2E2H I;  1TWG I;  2JMO A;  2OTL 1;  1KRL A;  2O4H A;  1KD1 2;  4CL1 A;  3G6E 1;  3I55 1;  4E2X A;  2Y0S A;  4RVH A;  3J81 f;  1Q81 2;  2JA8 I;  2QEX 1;  3KIH A;  2VUG A;  4NBA A;  1QYP A;  2QA4 Z;  1YI2 1;  3CCJ Z;  3HOX I;  3CCE Z;  3I07 A;  4RVG A;  4RS4 A;  5T6B A;  1VQM 1;  1N8R 1;  3CCE 1;  3Q87 A;  2YU9 I;  4MXU A;  3CXC Y;  2F4M A;  3NH5 A;  2QEX Z;  1JJ2 Z;  3BG1 B;  1Y1V I;  2RIQ A;  2M6N A;  4Y52 I;  1TWA I;  1K8A 1;  2G2K A;  1VQL 1;  3RZO I;  3M4O I;  2Q4Z A;  1Z03 A;  3CMA 1;  4NOZ A;  3I56 Z;  1VQ4 1;  2KI7 B;  2KPI A;  1KQS Z;  2VF1 A;  4DGL A;  3HOU I;  4QTT A;  3GTJ I;  2R92 I;  1QF8 A;  3GTP I;  2E9H A;  1VLA A;  3FQQ A;  3F3F C;  3K7A I;  1YI2 Z;  1L1O C;  1ML8 A;  4E2W A;  2JR6 A;  1ZB8 A;  1QVF Y;  3S2D I;  4MD8 A;  2WAQ A;  4BY1 I;  3FQM A;  3S1N I;  4QTU A;  3CMA Z;  1YJN Z;  3MZL B;  2RPR A;  4A93 I;  2DE7 A;  3H0G I;  3S14 I;  1N8R 2;  1YUA A;  1M90 1;  3J7A 4;  1VQ6 1;  1K73 1;  4Y7N I;  4BBS I;  3D9X A;  2K5R A;  3CC4 1;  2HF1 A;  3CME 1;  1M1K 2;  4RV9 A;  3EED A;  4A3C I;  4MON A;  4NBB A;  1TWH I;  3D6W A;  1S7M A;  5CM2 M;  3IF8 A;  1VQ7 Z;  1YJW Z;  2GTH A;  1X3Z A;  3G4S Z;  1VQK 1;  2W03 A;  3CCV 1;  1VQN Z;  3TDH B;  4E31 A;  3KIF A;  4A3K I;  3CME Z;  1W2B Y;  2QRC B;  2OTJ Z;  2OTL Z;  4NBC A;  3JAM f;  2V8J A;  3I4N I;  1YIT 1;  2H85 A;  1Y1W I;  2E2J I;  4A3D I;  1I50 I;  3G71 Z;  1NJI 2;  3CCS 1;  1KQS Y;  1X3W A;  2NVT I;  1VQ4 Z;  1Q86 2;  3CC7 1;  4NBD A;  3NDI A;  3CC7 Z;  1W2B Z;  1VQL Z;  1Z01 A;  1VQ9 1;  1NP6 A;  3GTM S;  2PK7 A;  1NJI 1;  3NH4 A;  3CC2 Z;  1KC8 1;  2OTJ 1;  4S1T A;  3GTM I;  4RVD A;  5A2Q f;  2JS4 A;  1YJ9 1;  5AN9 F;  4NBG A;  2YAD A;  4RVF A;  5IT9 b;  1X0T A;  1VQN 1;  1M1K 1;  3CCV Z;  1VQK Z;  3J81 b;  3TE5 B;  5T64 A;  4XX2 A;  2RBL A;  2QA4 1;  1S72 1;  2V8K A;  1KD1 1;  1DL6 A;  2Q51 A;  1VQ5 1;  2IZ3 A;  3HOW I;  4NH1 C;  4E2Y A;  3T4N B;  3S17 I;  5C4X I;  1VQ6 Z;  4MD9 A;  2JA7 I;  1NUI A;  3NH8 A;  1VQP 1;  3F3P C;  3CCM Z;  1K9M 2;  2R7Z I;  2QR1 B;  1YIJ Z;  3CD6 1;  2GTI A;  3J80 b;  3GTK I;  3S16 I;  2B63 I;  2JUB A;  3HKZ A;  3IX0 A;  3CXC Z;  1YHQ 1;  3CCU Z;  3CCL Z;  3OW2 Y;  3RZD I;  1Z02 A;  4A3E I;  1I6H I;  3CCJ 1;  3CCQ Z;  1WW9 A;  2JA6 I;  3FKI I;  4A3M I;  3CCR 1;  1TWF I;  1P9N A;  3VMG A;  4TNU A;  5IT9 f;  3BG0 B;  4BY7 I;  3CCL 1;  3PO3 S;  2RHB A;  3G6E Z;  3CPW Z;  1SFO I;  1WCM I;  4AYB A;  1Q7Y 1;  3CD6 Z;  3PO3 I;  2OZK A;  1M90 2;  3GTO I;  4E32 A;  1K73 2;  2QRE B;  2LFU A;  5FLM I;  3NFZ A;  1TFI A;  4X6A I;  3H3V J;  1VQO 1;  5IP7 I;  4NFR A;  3HOY I;  4DK1 A;  3I4M I;  1VQ8 1;  2WB1 A;  3VB9 A;  2NVX I;  4EWC A;  2R93 I;  3M3Y I;  2E2I I;  3JAM b;  2AKL A;  1S72 Z;  4BXX I;  4A3G I;  1JJ2 Y;  3CCQ 1;  3NDJ A;  1QVG Y;  5IP9 I;  4NBE A;  3S1R I;  3MZK B;  2I3C A;  3MON A;  1VQM Z;  1K83 I;  2QLV B;  2QRD B;  2P28 A;  3CCM 1;  4NBF A;  2VUM I;  3S15 I;  5C4J I;  1RO0 A;  2GU2 A;  5FLX b;  3J80 f;  2NVY I;  1Q86 1;  5LL6 f;  5A2Q b;  2F4O A;  1KC8 2;  4A3J I;  2IZ4 A;  3EER A;  1VQO Z;  4E30 A;  2JNY A;  5T67 A;  3QWU A;  2W04 A;  3CCS Z;  3VMI A;  2ZAE B;  3IFU A;  4HH4 A;  3G71 1;  1Q81 1;  1YUK A;  5C3E I;  1YIT Z;  3CCR Z;  2BJO A;  3HOV I;  1QVG Z;  2OOY B;  5D1O A;  2RT9 A;  4BBR I;  1R9T I;  2DE5 A;  3LUS A;  3PO2 I;  1QVF Z;  2OOX B;  1RLY A;  1YIJ 1;  2M48 A;  2HU9 A;  3GTL I;  1VQ7 1;  4A3F I;  1VQP Z;  5D1O B;  5FLX f;  1Q7Y 2;  3CCU 1;  2J6A A;  2JA5 I;  2O53 A;  2DE6 A;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...