3GTOI

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtoI02
3S1RI 1X3WA 1I50I 2P3YA 2JA7I 3S1QI 1Y1WI 1I3QI 1USPB 3S14I 4NBFA 4BXXI 2KPIA 5IP9I 2F4MA 4A3II 3HOUI 3GTOI 4BY1I 4A3LI 3I4NI 3RZDI 4A93I 2E2HI 5CM2M 3HOZI 4NBDA 3PO2I 3I4MI 2E2II 1TWAI 3I07A 2R92I 4A3GI 4NOZA 1RLYA 2E2JI 3PO3S 1X3ZA 3HOYI 3S15I 4A3CI 5FLMI 1VLAA 1LQLA 1WCMI 2F4OA 3GKQA 3S1NI 1L1OC 3GTGI 3EERA 2PK7A 3VMIA 2JA5I 4NB9A 4A3KI 3FKII 2DE5A 3GTPI 1RO4A 1SFOI 5C3EI 2DE7A 2B63I 2VUMI 1DL6A 4A3MI 3K7AI 4A3BI 4BY7I 3ESWA 3GTKI 4X6AI 3M4OI 1QYPA 3GTMI 4A3DI 3S2HI 2YU9I 1Y1VI 3PO3I 5C4XI 1N2FA 1ZB9A 1ML8A 3HOWI 4Y52I 1TWHI 4QTUA 4A3EI 3GCFA 3GTLI 2JA6I 2R7ZI 2R93I 3RZOI 2BJOA 2JS4A 2JR6A 4NBBA 1WW9A 3GTJI 1TFIA 2JNYA 1NUIA 2NVYI 5C4JI 2NVQI 4A3FI 4MH4A 3LUSA 1YUAA 2HF1A 1TWCI 4XX2A 5IP7I 3GTQI 4NBHA 2NVXI 4NB8A 3VMHA 1I6HI 1K83I 3VMGA 3Q87A 3VB9A 4BBSI 2DE6A 2K5RA 3CQZI 2AKLA 5C44I 3S2DI 3S1MI 3HOXI 4A3JI 4NBEA 2JA8I 4BBRI 3S16I 3S17I 3GTMS 1TWGI 4NBGA 4Y7NI 4QTTA 1Y1VS 4NBCA 1USPA 2J6AA 3HOVI 2NVTI 3H0GI 3U50C 3M3YI 4NBAA 1R9TI 1PFTA 2RBLA 3D6WA 3H3VJ 1TWFI 1ZB8A
chains in the Genus database with same CATH superfamily
3CC7Z 3CPWY 2HU9A 2JA7I 1KD11 1I3QI 3S14I 2KPIA 2M6NA 2Y0SA 5IP9I 2O53A 2QREB 4RVDA 3BG0B 1VQ81 4BY1I 4A3LI 3I4NI 1Q812 1YJN1 5CM2M 4NBDA 2E2II 3I07A 4NOZA 2G2KA 3PO3S 1VQ41 5D1OB 3HOYI 2OTJZ 1K9M1 1WCMI 3GKQA 3CCLZ 1L1OC 1M901 3GTGI 3CCJ1 1YIJZ 5A2Qf 3GTPI 2GU2A 3NH5A 1VQPZ 4EWCA 5T64A 5A2Qb 2B63I 3K7AI 4MD7A 3F3FC 3ESWA 3I561 2QRDB 2WB1A 3M4OI 2QLVB 4RS4A 2JUBA 2V45A 2YU9I 1Y1VI 1YHQ1 5FLXf 3HOWI 5T6BA 1YJW1 4A3EI 3GTLI 3CCR1 3BG1B 3G711 2BJOA 1VQ51 2I3CA 1WZNA 2KI7B 1WW9A 5C4JI 2NVYI 2NVQI 4DQYB 2O4HA 4MH4A 1N8R1 3I551 3CCS1 3FQQA 2V8KA 1QF8A 4E2WA 1I6HI 1X0TA 2VF1A 4RVFA 2K5RA 1YI2Z 2AKLA 5C44I 3S2DI 3S1MI 2PMZA 3CC21 2GTIA 2JA8I 4BBRI 3CCV1 1S721 1Z01A 1Y1VS 3U50C 3OW2Y 1KD12 1YITZ 3M3YI 1R9TI 2RHBA 1TWFI 2P3YA 1USPB 3CCQ1 2JIPA 4E32A 3CCEZ 1Q861 2VPXA 3CMEZ 4E31A 4E2YA 3RZDI 1VQN1 4A93I 3FQMA 5T67A 3HOZI 2RIQA 1K9M2 2QEX1 2VPZA 3J80f 3CD6Z 5IT9b 3CMA1 1X3ZA 2NAPA 2V8IA 3CCU1 4A3CI 5FLMI 1LQLA 1RNIA 1VQ91 2W03A 2JIQA 3F3PC 3CCMZ 2JA5I 2LEXA 3FKII 1AA6A 4A3KI 2JIRA 4E33A 5AN9F 5C3EI 1Z02A 3CC71 3IX0A 1WIIA 4X6AI 2R6MA 3GTMI 3CXCZ 1VQ8Z 1ML8A 2GTHA 3OW2Z 1YJNZ 1TWHI 2AYDA 3VTNA 3MZLB 2M48A 1Q822 2JA6I 1VQ4Z 1JWHC 1N8R2 2E9HA 1NUIA 3CCJZ 4A3FI 2VPWA 1VQL1 2HF1A 2VUGA 3CC4Z 2E7ZA 3VMGA 4BBSI 2DE6A 5FLXb 3I56Z 3HOXI 1S7MA 3S16I 5D1PA 2V3VA 3G6E1 3TDHB 3GTMS 1YHQZ 1ZH1A 1VQK1 2J6AA 3NH8A 1Q821 3HKZA 3MONA 1PFTA 3J81f 1YJWZ 4RVHA 1Q862 4RVGA 2RBLA 3CCRZ 3S1QI 1VQ61 1I50I 3J81b 1Y1WI 1VQ5Z 2F4MA 3IF8A 4A3II 3HOUI 1VQ71 5D1OA 1SIWA 2W04A 2E2HI 2EGTA 3PO2I 3I4MI 2WAQA 3I55Z 1YI21 1TWAI 3CCSZ 2R92I 2QR1B 4A3GI 2ZAEB 3CXCY 3KIHA 1VLAA 2VPYA 1K8A1 1WJ2A 3CC2Z 3EERA 2PK7A 3VMIA 4NB9A 4AYBA 3CCVZ 1VQO1 2P28A 1S72Z 2QRCB 1YJ91 1SFOI 4MD9A 2DE7A 1NP6A 3D9XA 3IFUA 4MXUA 1DL6A 4DGLA 2RPRA 4BY7I 2PM9A 1W2BZ 4TNUA 2OOYB 3CCQZ 3PO3I 3J80b 3CD61 4MONA 1VQNZ 2OTL1 1M1K2 2H85A 3G4S1 2QEXZ 1VQM1 2QA41 1QVFY 3CMAZ 3RZOI 3T4NB 1YUKA 3CCUZ 1VQ9Z 4MD8A 2OOXB 1P9NA 1Q16A 4XX2A 4NBHA 4NB8A 1NJI1 2OTJ1 1K83I 3VB9A 1RQFA 4RV9A 3CCL1 3NFZA 1RO2A 4NBEA 2YADA 1YIJ1 1M1K1 2IZ3A 1JJ2Z 1TWGI 4NBGA 3MZKB 2Q51A 4NBCA 1USPA 3TE5B 1VQP1 3HOVI 3H0GI 1KQSZ 1FDIA 1Q7Y2 2V8JA 2K3RA 3D6WA 3S1RI 1X3WA 1KC81 4BXXI 4NBFA 3JAMf 1QVGZ 1KRLA 2IV2X 3GTOI 1W2BY 3CC41 1VQLZ 3JAMb 2LIYA 1K8A2 1QVFZ 1RLYA 2E2JI 3D2LA 1Q811 3S15I 2JMOA 2F4OA 3S1NI 1FDOA 4E2XA 3G71Z 4HGZA 2DE5A 3G6EZ 1Q7Y1 1RO4A 1VQKZ 3CPWZ 4CL1A 3IR7A 4E2ZA 2VUMI 4A3MI 2JIOA 3NDIA 4A3BI 3NDJA 1K732 1QXFA 3GTKI 1VQ6Z 4NFRA 1Y8CA 1QYPA 4A3DI 3S2HI 4E30A 1VQ7Z 2RT9A 5C4XI 1N2FA 1ZB9A 4Y52I 4HH4A 1YIT1 3J7A4 4QTUA 1JJ2Y 2Q4ZA 3GCFA 4DK1A 3KIFA 3P5JB 2R7ZI 2R93I 1Z03A 3QWUA 1KQSY 2JS4A 2JR6A 4NBBA 3CCE1 2JIMA 3CME1 2OZKA 3GTJI 1TFIA 2JNYA 1NJI2 3LUSA 5LL6f 1VQOZ 1YUAA 1YJ9Z 1TWCI 1QVGY 1RO0A 5IP7I 4NH1C 1K731 3GTQI 3EEDA 4HGYA 3NH4A 2NVXI 3VMHA 3Q87A 3CQZI 2QKDA 4S1TA 4A3JI 5IT9f 3CCM1 3S17I 2IZ4A 2LFUA 4Y7NI 1M902 4QTTA 1KC82 2NVTI 2OTLZ 4NBAA 3G4SZ 1VQMZ 4MRIA 2QA4Z 3H3VJ 1ZB8A
chains in the Genus database with same CATH topology
3CC7Z 3CPWY 2HU9A 2JA7I 1KD11 1I3QI 3S14I 2KPIA 2M6NA 2Y0SA 5IP9I 2O53A 2QREB 4RVDA 3BG0B 1VQ81 4BY1I 4A3LI 3I4NI 1Q812 1YJN1 5CM2M 4NBDA 2E2II 3I07A 4NOZA 2G2KA 3PO3S 1VQ41 5D1OB 3HOYI 2OTJZ 1K9M1 1WCMI 3GKQA 3CCLZ 1L1OC 1M901 3GTGI 3CCJ1 1YIJZ 5A2Qf 3GTPI 2GU2A 3NH5A 1VQPZ 4EWCA 5T64A 5A2Qb 2B63I 3K7AI 4MD7A 3F3FC 3ESWA 3I561 2QRDB 2WB1A 3M4OI 2QLVB 4RS4A 2JUBA 2YU9I 1Y1VI 1YHQ1 5FLXf 3HOWI 5T6BA 1YJW1 4A3EI 3GTLI 3CCR1 3BG1B 3G711 2BJOA 1VQ51 2I3CA 2KI7B 1WW9A 5C4JI 2NVYI 2NVQI 4DQYB 2O4HA 4MH4A 1N8R1 3I551 3CCS1 3FQQA 2V8KA 1QF8A 4E2WA 1I6HI 1X0TA 2VF1A 4RVFA 2K5RA 1YI2Z 2AKLA 5C44I 3S2DI 3S1MI 2PMZA 3CC21 2GTIA 2JA8I 4BBRI 3CCV1 1S721 1Z01A 1Y1VS 3U50C 3OW2Y 1KD12 1YITZ 3M3YI 1R9TI 2RHBA 1TWFI 2P3YA 1USPB 3CCQ1 4E32A 3CCEZ 1Q861 3CMEZ 4E31A 4E2YA 3RZDI 1VQN1 4A93I 3FQMA 5T67A 3HOZI 2RIQA 1K9M2 2QEX1 3J80f 3CD6Z 5IT9b 3CMA1 1X3ZA 2V8IA 3CCU1 4A3CI 5FLMI 1LQLA 1RNIA 1VQ91 2W03A 3F3PC 3CCMZ 2JA5I 4A3KI 3FKII 4E33A 5AN9F 5C3EI 1Z02A 3CC71 3IX0A 1WIIA 4X6AI 2R6MA 3GTMI 3CXCZ 1VQ8Z 1ML8A 2GTHA 3OW2Z 1YJNZ 1TWHI 3VTNA 3MZLB 2M48A 1Q822 2JA6I 1VQ4Z 1JWHC 1N8R2 2E9HA 1NUIA 3CCJZ 4A3FI 1VQL1 2HF1A 2VUGA 3CC4Z 3VMGA 4BBSI 2DE6A 5FLXb 3I56Z 3HOXI 1S7MA 3S16I 5D1PA 3G6E1 3TDHB 3GTMS 1YHQZ 1ZH1A 1VQK1 2J6AA 3NH8A 1Q821 3HKZA 3MONA 1PFTA 3J81f 1YJWZ 4RVHA 1Q862 4RVGA 2RBLA 3CCRZ 3S1QI 1VQ61 1I50I 3J81b 1Y1WI 1VQ5Z 2F4MA 3IF8A 4A3II 3HOUI 1VQ71 5D1OA 2W04A 2E2HI 2EGTA 3PO2I 3I4MI 2WAQA 3I55Z 1YI21 1TWAI 3CCSZ 2R92I 2QR1B 4A3GI 2ZAEB 3CXCY 3KIHA 1VLAA 1K8A1 3CC2Z 3EERA 2PK7A 3VMIA 4NB9A 4AYBA 3CCVZ 1VQO1 2P28A 1S72Z 2QRCB 1YJ91 1SFOI 4MD9A 2DE7A 1NP6A 3D9XA 3IFUA 4MXUA 1DL6A 4DGLA 2RPRA 4BY7I 2PM9A 1W2BZ 4TNUA 2OOYB 3CCQZ 3PO3I 3J80b 3CD61 4MONA 1VQNZ 2OTL1 1M1K2 2H85A 3G4S1 2QEXZ 1VQM1 2QA41 1QVFY 3CMAZ 3RZOI 3T4NB 1YUKA 3CCUZ 1VQ9Z 4MD8A 2OOXB 1P9NA 4XX2A 4NBHA 4NB8A 1NJI1 2OTJ1 1K83I 3VB9A 1RQFA 4RV9A 3CCL1 3NFZA 1RO2A 4NBEA 2YADA 1YIJ1 1M1K1 2IZ3A 1JJ2Z 1TWGI 4NBGA 3MZKB 2Q51A 4NBCA 1USPA 3TE5B 1VQP1 3HOVI 3H0GI 1KQSZ 1Q7Y2 2V8JA 2K3RA 3D6WA 3S1RI 1X3WA 1KC81 4BXXI 4NBFA 3JAMf 1QVGZ 1KRLA 3GTOI 1W2BY 3CC41 1VQLZ 3JAMb 2LIYA 1K8A2 1QVFZ 1RLYA 2E2JI 1Q811 3S15I 2JMOA 2F4OA 3S1NI 4E2XA 3G71Z 4HGZA 2DE5A 3G6EZ 1Q7Y1 1RO4A 1VQKZ 3CPWZ 4CL1A 4E2ZA 2VUMI 4A3MI 3NDIA 4A3BI 3NDJA 1K732 3GTKI 1VQ6Z 4NFRA 1QYPA 4A3DI 3S2HI 4E30A 1VQ7Z 2RT9A 5C4XI 1N2FA 1ZB9A 4Y52I 4HH4A 1YIT1 3J7A4 4QTUA 1JJ2Y 2Q4ZA 3GCFA 4DK1A 3KIFA 3P5JB 2R7ZI 2R93I 1Z03A 3QWUA 1KQSY 2JS4A 2JR6A 4NBBA 3CCE1 3CME1 2OZKA 3GTJI 1TFIA 2JNYA 1NJI2 3LUSA 5LL6f 1VQOZ 1YUAA 1YJ9Z 1TWCI 1QVGY 1RO0A 5IP7I 4NH1C 1K731 3GTQI 3EEDA 4HGYA 3NH4A 2NVXI 3VMHA 3Q87A 3CQZI 2QKDA 4S1TA 4A3JI 5IT9f 3CCM1 3S17I 2IZ4A 2LFUA 4Y7NI 1M902 4QTTA 1KC82 2NVTI 2OTLZ 4NBAA 3G4SZ 1VQMZ 4MRIA 2QA4Z 3H3VJ 1ZB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R I;  1X3W A;  1I50 I;  2P3Y A;  2JA7 I;  3S1Q I;  1Y1W I;  1I3Q I;  1USP B;  3S14 I;  4NBF A;  4BXX I;  2KPI A;  5IP9 I;  2F4M A;  4A3I I;  3HOU I;  3GTO I;  4BY1 I;  4A3L I;  3I4N I;  3RZD I;  4A93 I;  2E2H I;  5CM2 M;  3HOZ I;  4NBD A;  3PO2 I;  3I4M I;  2E2I I;  1TWA I;  3I07 A;  2R92 I;  4A3G I;  4NOZ A;  1RLY A;  2E2J I;  3PO3 S;  1X3Z A;  3HOY I;  3S15 I;  4A3C I;  5FLM I;  1VLA A;  1LQL A;  1WCM I;  2F4O A;  3GKQ A;  3S1N I;  1L1O C;  3GTG I;  3EER A;  2PK7 A;  3VMI A;  2JA5 I;  4NB9 A;  4A3K I;  3FKI I;  2DE5 A;  3GTP I;  1RO4 A;  1SFO I;  5C3E I;  2DE7 A;  2B63 I;  2VUM I;  1DL6 A;  4A3M I;  3K7A I;  4A3B I;  4BY7 I;  3ESW A;  3GTK I;  4X6A I;  3M4O I;  1QYP A;  3GTM I;  4A3D I;  3S2H I;  2YU9 I;  1Y1V I;  3PO3 I;  5C4X I;  1N2F A;  1ZB9 A;  1ML8 A;  3HOW I;  4Y52 I;  1TWH I;  4QTU A;  4A3E I;  3GCF A;  3GTL I;  2JA6 I;  2R7Z I;  2R93 I;  3RZO I;  2BJO A;  2JS4 A;  2JR6 A;  4NBB A;  1WW9 A;  3GTJ I;  1TFI A;  2JNY A;  1NUI A;  2NVY I;  5C4J I;  2NVQ I;  4A3F I;  4MH4 A;  3LUS A;  1YUA A;  2HF1 A;  1TWC I;  4XX2 A;  5IP7 I;  3GTQ I;  4NBH A;  2NVX I;  4NB8 A;  3VMH A;  1I6H I;  1K83 I;  3VMG A;  3Q87 A;  3VB9 A;  4BBS I;  2DE6 A;  2K5R A;  3CQZ I;  2AKL A;  5C44 I;  3S2D I;  3S1M I;  3HOX I;  4A3J I;  4NBE A;  2JA8 I;  4BBR I;  3S16 I;  3S17 I;  3GTM S;  1TWG I;  4NBG A;  4Y7N I;  4QTT A;  1Y1V S;  4NBC A;  1USP A;  2J6A A;  3HOV I;  2NVT I;  3H0G I;  3U50 C;  3M3Y I;  4NBA A;  1R9T I;  1PFT A;  2RBL A;  3D6W A;  3H3V J;  1TWF I;  1ZB8 A; 
#chains in the Genus database with same CATH topology
 3CC7 Z;  3CPW Y;  2HU9 A;  2JA7 I;  1KD1 1;  1I3Q I;  3S14 I;  2KPI A;  2M6N A;  2Y0S A;  5IP9 I;  2O53 A;  2QRE B;  4RVD A;  3BG0 B;  1VQ8 1;  4BY1 I;  4A3L I;  3I4N I;  1Q81 2;  1YJN 1;  5CM2 M;  4NBD A;  2E2I I;  3I07 A;  4NOZ A;  2G2K A;  3PO3 S;  1VQ4 1;  5D1O B;  3HOY I;  2OTJ Z;  1K9M 1;  1WCM I;  3GKQ A;  3CCL Z;  1L1O C;  1M90 1;  3GTG I;  3CCJ 1;  1YIJ Z;  5A2Q f;  3GTP I;  2GU2 A;  3NH5 A;  1VQP Z;  4EWC A;  5T64 A;  5A2Q b;  2B63 I;  3K7A I;  4MD7 A;  3F3F C;  3ESW A;  3I56 1;  2QRD B;  2WB1 A;  3M4O I;  2QLV B;  4RS4 A;  2JUB A;  2V45 A;  2YU9 I;  1Y1V I;  1YHQ 1;  5FLX f;  3HOW I;  5T6B A;  1YJW 1;  4A3E I;  3GTL I;  3CCR 1;  3BG1 B;  3G71 1;  2BJO A;  1VQ5 1;  2I3C A;  1WZN A;  2KI7 B;  1WW9 A;  5C4J I;  2NVY I;  2NVQ I;  4DQY B;  2O4H A;  4MH4 A;  1N8R 1;  3I55 1;  3CCS 1;  3FQQ A;  2V8K A;  1QF8 A;  4E2W A;  1I6H I;  1X0T A;  2VF1 A;  4RVF A;  2K5R A;  1YI2 Z;  2AKL A;  5C44 I;  3S2D I;  3S1M I;  2PMZ A;  3CC2 1;  2GTI A;  2JA8 I;  4BBR I;  3CCV 1;  1S72 1;  1Z01 A;  1Y1V S;  3U50 C;  3OW2 Y;  1KD1 2;  1YIT Z;  3M3Y I;  1R9T I;  2RHB A;  1TWF I;  2P3Y A;  1USP B;  3CCQ 1;  2JIP A;  4E32 A;  3CCE Z;  1Q86 1;  2VPX A;  3CME Z;  4E31 A;  4E2Y A;  3RZD I;  1VQN 1;  4A93 I;  3FQM A;  5T67 A;  3HOZ I;  2RIQ A;  1K9M 2;  2QEX 1;  2VPZ A;  3J80 f;  3CD6 Z;  5IT9 b;  3CMA 1;  1X3Z A;  2NAP A;  2V8I A;  3CCU 1;  4A3C I;  5FLM I;  1LQL A;  1RNI A;  1VQ9 1;  2W03 A;  2JIQ A;  3F3P C;  3CCM Z;  2JA5 I;  2LEX A;  3FKI I;  1AA6 A;  4A3K I;  2JIR A;  4E33 A;  5AN9 F;  5C3E I;  1Z02 A;  3CC7 1;  3IX0 A;  1WII A;  4X6A I;  2R6M A;  3GTM I;  3CXC Z;  1VQ8 Z;  1ML8 A;  2GTH A;  3OW2 Z;  1YJN Z;  1TWH I;  2AYD A;  3VTN A;  3MZL B;  2M48 A;  1Q82 2;  2JA6 I;  1VQ4 Z;  1JWH C;  1N8R 2;  2E9H A;  1NUI A;  3CCJ Z;  4A3F I;  2VPW A;  1VQL 1;  2HF1 A;  2VUG A;  3CC4 Z;  2E7Z A;  3VMG A;  4BBS I;  2DE6 A;  5FLX b;  3I56 Z;  3HOX I;  1S7M A;  3S16 I;  5D1P A;  2V3V A;  3G6E 1;  3TDH B;  3GTM S;  1YHQ Z;  1ZH1 A;  1VQK 1;  2J6A A;  3NH8 A;  1Q82 1;  3HKZ A;  3MON A;  1PFT A;  3J81 f;  1YJW Z;  4RVH A;  1Q86 2;  4RVG A;  2RBL A;  3CCR Z;  3S1Q I;  1VQ6 1;  1I50 I;  3J81 b;  1Y1W I;  1VQ5 Z;  2F4M A;  3IF8 A;  4A3I I;  3HOU I;  1VQ7 1;  5D1O A;  1SIW A;  2W04 A;  2E2H I;  2EGT A;  3PO2 I;  3I4M I;  2WAQ A;  3I55 Z;  1YI2 1;  1TWA I;  3CCS Z;  2R92 I;  2QR1 B;  4A3G I;  2ZAE B;  3CXC Y;  3KIH A;  1VLA A;  2VPY A;  1K8A 1;  1WJ2 A;  3CC2 Z;  3EER A;  2PK7 A;  3VMI A;  4NB9 A;  4AYB A;  3CCV Z;  1VQO 1;  2P28 A;  1S72 Z;  2QRC B;  1YJ9 1;  1SFO I;  4MD9 A;  2DE7 A;  1NP6 A;  3D9X A;  3IFU A;  4MXU A;  1DL6 A;  4DGL A;  2RPR A;  4BY7 I;  2PM9 A;  1W2B Z;  4TNU A;  2OOY B;  3CCQ Z;  3PO3 I;  3J80 b;  3CD6 1;  4MON A;  1VQN Z;  2OTL 1;  1M1K 2;  2H85 A;  3G4S 1;  2QEX Z;  1VQM 1;  2QA4 1;  1QVF Y;  3CMA Z;  3RZO I;  3T4N B;  1YUK A;  3CCU Z;  1VQ9 Z;  4MD8 A;  2OOX B;  1P9N A;  1Q16 A;  4XX2 A;  4NBH A;  4NB8 A;  1NJI 1;  2OTJ 1;  1K83 I;  3VB9 A;  1RQF A;  4RV9 A;  3CCL 1;  3NFZ A;  1RO2 A;  4NBE A;  2YAD A;  1YIJ 1;  1M1K 1;  2IZ3 A;  1JJ2 Z;  1TWG I;  4NBG A;  3MZK B;  2Q51 A;  4NBC A;  1USP A;  3TE5 B;  1VQP 1;  3HOV I;  3H0G I;  1KQS Z;  1FDI A;  1Q7Y 2;  2V8J A;  2K3R A;  3D6W A;  3S1R I;  1X3W A;  1KC8 1;  4BXX I;  4NBF A;  3JAM f;  1QVG Z;  1KRL A;  2IV2 X;  3GTO I;  1W2B Y;  3CC4 1;  1VQL Z;  3JAM b;  2LIY A;  1K8A 2;  1QVF Z;  1RLY A;  2E2J I;  3D2L A;  1Q81 1;  3S15 I;  2JMO A;  2F4O A;  3S1N I;  1FDO A;  4E2X A;  3G71 Z;  4HGZ A;  2DE5 A;  3G6E Z;  1Q7Y 1;  1RO4 A;  1VQK Z;  3CPW Z;  4CL1 A;  3IR7 A;  4E2Z A;  2VUM I;  4A3M I;  2JIO A;  3NDI A;  4A3B I;  3NDJ A;  1K73 2;  1QXF A;  3GTK I;  1VQ6 Z;  4NFR A;  1Y8C A;  1QYP A;  4A3D I;  3S2H I;  4E30 A;  1VQ7 Z;  2RT9 A;  5C4X I;  1N2F A;  1ZB9 A;  4Y52 I;  4HH4 A;  1YIT 1;  3J7A 4;  4QTU A;  1JJ2 Y;  2Q4Z A;  3GCF A;  4DK1 A;  3KIF A;  3P5J B;  2R7Z I;  2R93 I;  1Z03 A;  3QWU A;  1KQS Y;  2JS4 A;  2JR6 A;  4NBB A;  3CCE 1;  2JIM A;  3CME 1;  2OZK A;  3GTJ I;  1TFI A;  2JNY A;  1NJI 2;  3LUS A;  5LL6 f;  1VQO Z;  1YUA A;  1YJ9 Z;  1TWC I;  1QVG Y;  1RO0 A;  5IP7 I;  4NH1 C;  1K73 1;  3GTQ I;  3EED A;  4HGY A;  3NH4 A;  2NVX I;  3VMH A;  3Q87 A;  3CQZ I;  2QKD A;  4S1T A;  4A3J I;  5IT9 f;  3CCM 1;  3S17 I;  2IZ4 A;  2LFU A;  4Y7N I;  1M90 2;  4QTT A;  1KC8 2;  2NVT I;  2OTL Z;  4NBA A;  3G4S Z;  1VQM Z;  4MRI A;  2QA4 Z;  3H3V J;  1ZB8 A; 
#chains in the Genus database with same CATH homology
 3CC7 Z;  3CPW Y;  2HU9 A;  2JA7 I;  1KD1 1;  1I3Q I;  3S14 I;  2KPI A;  2M6N A;  2Y0S A;  5IP9 I;  2O53 A;  2QRE B;  4RVD A;  3BG0 B;  1VQ8 1;  4BY1 I;  4A3L I;  3I4N I;  1Q81 2;  1YJN 1;  5CM2 M;  4NBD A;  2E2I I;  3I07 A;  4NOZ A;  2G2K A;  3PO3 S;  1VQ4 1;  5D1O B;  3HOY I;  2OTJ Z;  1K9M 1;  1WCM I;  3GKQ A;  3CCL Z;  1L1O C;  1M90 1;  3GTG I;  3CCJ 1;  1YIJ Z;  5A2Q f;  3GTP I;  2GU2 A;  3NH5 A;  1VQP Z;  4EWC A;  5T64 A;  5A2Q b;  2B63 I;  3K7A I;  4MD7 A;  3F3F C;  3ESW A;  3I56 1;  2QRD B;  2WB1 A;  3M4O I;  2QLV B;  4RS4 A;  2JUB A;  2YU9 I;  1Y1V I;  1YHQ 1;  5FLX f;  3HOW I;  5T6B A;  1YJW 1;  4A3E I;  3GTL I;  3CCR 1;  3BG1 B;  3G71 1;  2BJO A;  1VQ5 1;  2I3C A;  2KI7 B;  1WW9 A;  5C4J I;  2NVY I;  2NVQ I;  4DQY B;  2O4H A;  4MH4 A;  1N8R 1;  3I55 1;  3CCS 1;  3FQQ A;  2V8K A;  1QF8 A;  4E2W A;  1I6H I;  1X0T A;  2VF1 A;  4RVF A;  2K5R A;  1YI2 Z;  2AKL A;  5C44 I;  3S2D I;  3S1M I;  2PMZ A;  3CC2 1;  2GTI A;  2JA8 I;  4BBR I;  3CCV 1;  1S72 1;  1Z01 A;  1Y1V S;  3U50 C;  3OW2 Y;  1KD1 2;  1YIT Z;  3M3Y I;  1R9T I;  2RHB A;  1TWF I;  2P3Y A;  1USP B;  3CCQ 1;  4E32 A;  3CCE Z;  1Q86 1;  3CME Z;  4E31 A;  4E2Y A;  3RZD I;  1VQN 1;  4A93 I;  3FQM A;  5T67 A;  3HOZ I;  2RIQ A;  1K9M 2;  2QEX 1;  3J80 f;  3CD6 Z;  5IT9 b;  3CMA 1;  1X3Z A;  2V8I A;  3CCU 1;  4A3C I;  5FLM I;  1LQL A;  1RNI A;  1VQ9 1;  2W03 A;  3F3P C;  3CCM Z;  2JA5 I;  4A3K I;  3FKI I;  4E33 A;  5AN9 F;  5C3E I;  1Z02 A;  3CC7 1;  3IX0 A;  1WII A;  4X6A I;  2R6M A;  3GTM I;  3CXC Z;  1VQ8 Z;  1ML8 A;  2GTH A;  3OW2 Z;  1YJN Z;  1TWH I;  3VTN A;  3MZL B;  2M48 A;  1Q82 2;  2JA6 I;  1VQ4 Z;  1JWH C;  1N8R 2;  2E9H A;  1NUI A;  3CCJ Z;  4A3F I;  1VQL 1;  2HF1 A;  2VUG A;  3CC4 Z;  3VMG A;  4BBS I;  2DE6 A;  5FLX b;  3I56 Z;  3HOX I;  1S7M A;  3S16 I;  5D1P A;  3G6E 1;  3TDH B;  3GTM S;  1YHQ Z;  1ZH1 A;  1VQK 1;  2J6A A;  3NH8 A;  1Q82 1;  3HKZ A;  3MON A;  1PFT A;  3J81 f;  1YJW Z;  4RVH A;  1Q86 2;  4RVG A;  2RBL A;  3CCR Z;  3S1Q I;  1VQ6 1;  1I50 I;  3J81 b;  1Y1W I;  1VQ5 Z;  2F4M A;  3IF8 A;  4A3I I;  3HOU I;  1VQ7 1;  5D1O A;  2W04 A;  2E2H I;  2EGT A;  3PO2 I;  3I4M I;  2WAQ A;  3I55 Z;  1YI2 1;  1TWA I;  3CCS Z;  2R92 I;  2QR1 B;  4A3G I;  2ZAE B;  3CXC Y;  3KIH A;  1VLA A;  1K8A 1;  3CC2 Z;  3EER A;  2PK7 A;  3VMI A;  4NB9 A;  4AYB A;  3CCV Z;  1VQO 1;  2P28 A;  1S72 Z;  2QRC B;  1YJ9 1;  1SFO I;  4MD9 A;  2DE7 A;  1NP6 A;  3D9X A;  3IFU A;  4MXU A;  1DL6 A;  4DGL A;  2RPR A;  4BY7 I;  2PM9 A;  1W2B Z;  4TNU A;  2OOY B;  3CCQ Z;  3PO3 I;  3J80 b;  3CD6 1;  4MON A;  1VQN Z;  2OTL 1;  1M1K 2;  2H85 A;  3G4S 1;  2QEX Z;  1VQM 1;  2QA4 1;  1QVF Y;  3CMA Z;  3RZO I;  3T4N B;  1YUK A;  3CCU Z;  1VQ9 Z;  4MD8 A;  2OOX B;  1P9N A;  4XX2 A;  4NBH A;  4NB8 A;  1NJI 1;  2OTJ 1;  1K83 I;  3VB9 A;  1RQF A;  4RV9 A;  3CCL 1;  3NFZ A;  1RO2 A;  4NBE A;  2YAD A;  1YIJ 1;  1M1K 1;  2IZ3 A;  1JJ2 Z;  1TWG I;  4NBG A;  3MZK B;  2Q51 A;  4NBC A;  1USP A;  3TE5 B;  1VQP 1;  3HOV I;  3H0G I;  1KQS Z;  1Q7Y 2;  2V8J A;  2K3R A;  3D6W A;  3S1R I;  1X3W A;  1KC8 1;  4BXX I;  4NBF A;  3JAM f;  1QVG Z;  1KRL A;  3GTO I;  1W2B Y;  3CC4 1;  1VQL Z;  3JAM b;  2LIY A;  1K8A 2;  1QVF Z;  1RLY A;  2E2J I;  1Q81 1;  3S15 I;  2JMO A;  2F4O A;  3S1N I;  4E2X A;  3G71 Z;  4HGZ A;  2DE5 A;  3G6E Z;  1Q7Y 1;  1RO4 A;  1VQK Z;  3CPW Z;  4CL1 A;  4E2Z A;  2VUM I;  4A3M I;  3NDI A;  4A3B I;  3NDJ A;  1K73 2;  3GTK I;  1VQ6 Z;  4NFR A;  1QYP A;  4A3D I;  3S2H I;  4E30 A;  1VQ7 Z;  2RT9 A;  5C4X I;  1N2F A;  1ZB9 A;  4Y52 I;  4HH4 A;  1YIT 1;  3J7A 4;  4QTU A;  1JJ2 Y;  2Q4Z A;  3GCF A;  4DK1 A;  3KIF A;  3P5J B;  2R7Z I;  2R93 I;  1Z03 A;  3QWU A;  1KQS Y;  2JS4 A;  2JR6 A;  4NBB A;  3CCE 1;  3CME 1;  2OZK A;  3GTJ I;  1TFI A;  2JNY A;  1NJI 2;  3LUS A;  5LL6 f;  1VQO Z;  1YUA A;  1YJ9 Z;  1TWC I;  1QVG Y;  1RO0 A;  5IP7 I;  4NH1 C;  1K73 1;  3GTQ I;  3EED A;  4HGY A;  3NH4 A;  2NVX I;  3VMH A;  3Q87 A;  3CQZ I;  2QKD A;  4S1T A;  4A3J I;  5IT9 f;  3CCM 1;  3S17 I;  2IZ4 A;  2LFU A;  4Y7N I;  1M90 2;  4QTT A;  1KC8 2;  2NVT I;  2OTL Z;  4NBA A;  3G4S Z;  1VQM Z;  4MRI A;  2QA4 Z;  3H3V J;  1ZB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...