1YI2Z

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2Z00
3CCJ1 3CCJZ 3CCVZ 2QA4Z 1NJI2 1K9M2 1Q822 3I56Z 1VQ51 1Q811 1K8A1 1KD11 1Q862 3CCRZ 1Q7Y2 1K732 3CCU1 1N8R2 1M901 3CCE1 3CCUZ 3CCSZ 3CC7Z 1VQMZ 1KC82 1M1K2 2QEX1 1KQSZ 3CXCY 3G6EZ 3CC41 1YIT1 2OTLZ 1YIJ1 1W2BZ 1JJ2Z 1Q821 3CC2Z 3CXCZ 3G711 1Q812 1KD12 3G4S1 1VQP1 1VQPZ 1VQN1 1VQ9Z 3CC4Z 1QVFY 1NJI1 1VQ4Z 1K9M1 2QEXZ 1VQO1 1Q861 3CPWZ 1VQOZ 1YHQ1 1YJN1 1Q7Y1 1QVGY 1K731 1QVGZ 3CPWY 1YJWZ 1VQ71 2OTJ1 1VQM1 1VQ6Z 1QVFZ 3OW2Z 3CC21 1KQSY 3CCL1 3CCLZ 1YJNZ 1JJ2Y 3G6E1 1VQ81 1YIJZ 1VQ41 1W2BY 1VQ61 3I55Z 3CMEZ 3CD6Z 3CME1 1YHQZ 3CD61 3CCQ1 3CCMZ 3OW2Y 1VQ91 3CCS1 3CC71 1YI2Z 1YJ9Z 3CCEZ 1VQ8Z 3CCV1 1KC81 1M1K1 1K8A2 3I561 1VQ5Z 1S721 1S72Z 2OTL1 1N8R1 1YJW1 1M902 1YITZ 2QA41 1VQL1 2OTJZ 1VQ7Z 1YJ91 1YI21 1VQK1 1VQKZ 3I551 3CMAZ 3CMA1 3CCQZ 3G4SZ 3CCR1 3G71Z 3CCM1 1VQNZ 1VQLZ
chains in the Genus database with same CATH superfamily
1QF8A 2Y0SA 2AYDA 4BY1I 4Y52I 4DGLA 4MXUA 1K9M2 1KD11 1TWHI 4NB9A 1RLYA 1K732 1N8R2 2P3YA 2V8IA 5CM2M 3CC7Z 3CCSZ 4A3EI 3VMIA 4MRIA 1SIWA 1YUAA 2VUGA 3G6EZ 5T67A 2VPXA 4QTUA 2PK7A 2BJOA 1QXFA 1KD12 5C44I 3GTQI 1I6HI 4A3GI 1RO2A 1VQ9Z 2R93I 1QVFY 3S14I 3RZOI 4E2ZA 3LUSA 3MZKB 2QEXZ 2NVXI 1YHQ1 1Q7Y1 2IZ3A 1TWAI 1R9TI 1YJWZ 3RZDI 2PM9A 1FDOA 1WW9A 3VMGA 4E30A 4E32A 1TWCI 2Q4ZA 3CC21 2V45A 1JJ2Y 1VQ81 4RVDA 4NBAA 2JIPA 3IX0A 4E2XA 1VQ41 2R92I 2QLVB 3S1NI 3I55Z 2IZ4A 3S2DI 3CD6Z 2NVTI 2V8JA 5IP9I 3NH4A 2QRDB 2JNYA 2F4MA 4CL1A 3NH8A 3GTMI 2E9HA 1KC81 1M1K1 1VQ5Z 2RBLA 1S721 4DQYB 1VQL1 1VQ7Z 1ML8A 4DK1A 1ZB9A 3CCQZ 2JIMA 3U50C 3F3FC 2VPYA 3CCVZ 1P9NA 1LQLA 4XX2A 3J7A4 2B63I 1Q811 4MH4A 1Q862 4HH4A 3GTOI 5AN9F 3CCE1 2WB1A 3VB9A 4MD9A 3HOXI 3GCFA 2JUBA 4S1TA 4NBBA 3NFZA 1W2BZ 2JIQA 3Q87A 2LFUA 1X3WA 1Q821 3CC2Z 3CXCZ 3G711 5IT9f 3MZLB 3G4S1 3D2LA 1VQN1 2EGTA 2K5RA 2JS4A 3CC4Z 5C3EI 1X3ZA 2E2II 1K9M1 4A3CI 1Y8CA 3T4NB 3QWUA 4A3II 1I3QI 1WCMI 1YJN1 2E7ZA 4Y7NI 1K731 4RV9A 1QVGZ 3CPWY 3J80f 1VQM1 2I3CA 4A3JI 2VUMI 3F3PC 1ZB8A 2DE5A 5LL6f 3GTMS 3CCL1 4RVFA 4NFRA 3GTLI 1USPB 1FDIA 5FLXf 1YIJZ 3GKQA 1JWHC 1W2BY 3NH5A 3I4NI 1QYPA 2R7ZI 3CD61 1YHQZ 5D1OA 4E2WA 1AA6A 2JR6A 2RHBA 5FLMI 3I07A 1YI2Z 3CQZI 1VQ8Z 2GTIA 3CCV1 2OOXB 3VTNA 2LIYA 3J80b 2OTL1 1M902 4HGYA 1YJW1 4NBCA 3IF8A 2OTJZ 1USPA 1VQK1 4NB8A 3I551 1NUIA 3CMAZ 2QRCB 3FQMA 3CCR1 3G71Z 1ZH1A 3CCM1 5FLXb 1TFIA 1Z02A 2R6MA 2QA4Z 3CCJ1 2JMOA 1Z01A 2K3RA 3IR7A 3I56Z 1Q822 1TWFI 1K8A1 3HOWI 3S1RI 3CCU1 3ESWA 1M901 3S1QI 3HOZI 1NP6A 5T64A 1Y1WI 1S7MA 1RO4A 1KC82 1M1K2 2QKDA 3BG1B 4E31A 2QEX1 2YU9I 4A93I 1KQSZ 2NVYI 3PO3S 4MONA 2RIQA 2OOYB 3M4OI 4A3BI 1YIJ1 4RS4A 4BBSI 2QREB 2M6NA 2W04A 2NAPA 2IV2X 3HOUI 3JAMb 2LEXA 5T6BA 1VQP1 4TNUA 3MONA 2H85A 2VF1A 1VQ4Z 1VQO1 2V8KA 4RVGA 3CPWZ 1QVGY 1RNIA 3H0GI 2DE6A 2HF1A 2OTJ1 2RT9A 2J6AA 1VQ6Z 1Q16A 4A3KI 3EERA 3OW2Z 2E2HI 2WAQA 1DL6A 3CCLZ 1Z03A 2HU9A 5C4JI 3G6E1 4AYBA 3TDHB 1VLAA 3J81b 4E33A 3BG0B 4E2YA 3CMEZ 3M3YI 2QR1B 3S2HI 3JAMf 3HOYI 2Q51A 3OW2Y 1VQ91 3H3VJ 1YJ9Z 3CCEZ 2E2JI 4A3DI 2JIRA 3S1MI 2YADA 3K7AI 2JA8I 3D6WA 3IFUA 1KRLA 1WZNA 2KPIA 1S72Z 3GTPI 1YI21 1VQKZ 2JA7I 2JA6I 4BBRI 3NDIA 1VQNZ 4RVHA 3TE5B 3J81f 1VQLZ 3GTJI 2W03A 3CCJZ 1NJI2 2AKLA 3P5JB 4HGZA 4NOZA 1VQ51 3CCRZ 1Q7Y2 3S17I 2V3VA 3CCUZ 3KIHA 1VQMZ 4BY7I 1K83I 5D1PA 1Y1VI 1I50I 3CXCY 3I4MI 2ZAEB 2NVQI 3CC41 5IT9b 1YIT1 5A2Qb 2OTLZ 3D9XA 3PO3I 2O53A 4A3FI 4EWCA 5IP7I 2O4HA 1JJ2Z 3HOVI 1Q812 1RO0A 2GTHA 4NH1C 1VQPZ 3NDJA 1YUKA 1N2FA 1NJI1 4NBDA 2PMZA 1Q861 3GTGI 1VQOZ 1SFOI 4A3MI 4NBHA 1VQ71 3GTKI 1QVFZ 2JA5I 3S15I 1KQSY 4BXXI 2VPWA 4MD8A 2M48A 4MD7A 3EEDA 1WIIA 2KI7B 1YJNZ 4NBGA 1WJ2A 2F4OA 5A2Qf 3S16I 4NBFA 2RPRA 4X6AI 2OZKA 1VQ61 3FKII 3CME1 1RQFA 3CCQ1 1PFTA 3CCMZ 5C4XI 3CCS1 3CC71 2GU2A 2G2KA 3KIFA 2DE7A 1X0TA 1K8A2 3I561 2JIOA 1N8R1 1YITZ 1L1OC 3FQQA 2QA41 2VPZA 1YJ91 1Y1VS 4NBEA 3CMA1 3G4SZ 3VMHA 3HKZA 4A3LI 2P28A 5D1OB 1TWGI 3PO2I 4QTTA
chains in the Genus database with same CATH topology
1QF8A 2Y0SA 4BY1I 4Y52I 4DGLA 4MXUA 1K9M2 1KD11 1TWHI 4NB9A 1RLYA 1K732 1N8R2 2P3YA 2V8IA 5CM2M 3CC7Z 3CCSZ 4A3EI 3VMIA 4MRIA 1YUAA 2VUGA 3G6EZ 5T67A 4QTUA 2PK7A 2BJOA 1KD12 5C44I 3GTQI 1I6HI 4A3GI 1RO2A 1VQ9Z 2R93I 1QVFY 3S14I 3RZOI 4E2ZA 3LUSA 3MZKB 2QEXZ 2NVXI 1YHQ1 1Q7Y1 2IZ3A 1TWAI 1R9TI 1YJWZ 3RZDI 2PM9A 1WW9A 3VMGA 4E30A 4E32A 1TWCI 2Q4ZA 3CC21 1JJ2Y 1VQ81 4RVDA 4NBAA 3IX0A 4E2XA 1VQ41 2R92I 2QLVB 3S1NI 3I55Z 2IZ4A 3S2DI 3CD6Z 2NVTI 2V8JA 5IP9I 3NH4A 2QRDB 2JNYA 2F4MA 4CL1A 3NH8A 3GTMI 2E9HA 1KC81 1M1K1 1VQ5Z 2RBLA 1S721 4DQYB 1VQL1 1VQ7Z 1ML8A 4DK1A 1ZB9A 3CCQZ 3U50C 3F3FC 3CCVZ 1P9NA 1LQLA 4XX2A 3J7A4 2B63I 1Q811 4MH4A 1Q862 4HH4A 3GTOI 5AN9F 3CCE1 2WB1A 3VB9A 4MD9A 3HOXI 3GCFA 2JUBA 4S1TA 4NBBA 3NFZA 1W2BZ 3Q87A 2LFUA 1X3WA 1Q821 3CC2Z 3CXCZ 3G711 5IT9f 3MZLB 3G4S1 1VQN1 2EGTA 2K5RA 2JS4A 3CC4Z 5C3EI 1X3ZA 2E2II 1K9M1 4A3CI 3T4NB 3QWUA 4A3II 1I3QI 1WCMI 1YJN1 4Y7NI 1K731 4RV9A 1QVGZ 3CPWY 3J80f 1VQM1 2I3CA 4A3JI 2VUMI 3F3PC 1ZB8A 2DE5A 5LL6f 3GTMS 3CCL1 4RVFA 4NFRA 3GTLI 1USPB 5FLXf 1YIJZ 3GKQA 1JWHC 1W2BY 3NH5A 3I4NI 1QYPA 2R7ZI 3CD61 4E2WA 5D1OA 1YHQZ 2JR6A 2RHBA 5FLMI 3I07A 1YI2Z 3CQZI 1VQ8Z 2GTIA 3CCV1 2OOXB 3VTNA 2LIYA 3J80b 2OTL1 1M902 4HGYA 1YJW1 4NBCA 3IF8A 2OTJZ 1USPA 1VQK1 4NB8A 3I551 1NUIA 3CMAZ 2QRCB 3FQMA 3CCR1 3G71Z 1ZH1A 3CCM1 5FLXb 1TFIA 1Z02A 2R6MA 2QA4Z 3CCJ1 2JMOA 1Z01A 2K3RA 3I56Z 1Q822 1TWFI 1K8A1 3HOWI 3S1RI 3CCU1 3ESWA 1M901 3S1QI 3HOZI 1NP6A 5T64A 1Y1WI 1S7MA 1RO4A 1KC82 1M1K2 2QKDA 3BG1B 4E31A 2QEX1 2YU9I 4A93I 1KQSZ 2NVYI 3PO3S 4MONA 2RIQA 2OOYB 3M4OI 4A3BI 1YIJ1 4RS4A 4BBSI 2QREB 2M6NA 2W04A 3HOUI 3JAMb 5T6BA 1VQP1 4TNUA 3MONA 2H85A 2VF1A 1VQ4Z 1VQO1 2V8KA 4RVGA 3CPWZ 1QVGY 1RNIA 3H0GI 2DE6A 2HF1A 2OTJ1 2RT9A 2J6AA 1VQ6Z 4A3KI 3EERA 3OW2Z 2E2HI 2WAQA 1DL6A 3CCLZ 1Z03A 2HU9A 5C4JI 3G6E1 4AYBA 3TDHB 1VLAA 3J81b 4E33A 3BG0B 4E2YA 3CMEZ 3M3YI 2QR1B 3S2HI 3JAMf 3HOYI 2Q51A 3OW2Y 1VQ91 3H3VJ 1YJ9Z 3CCEZ 2E2JI 4A3DI 3S1MI 2YADA 3K7AI 2JA8I 3D6WA 3IFUA 1KRLA 2KPIA 1S72Z 3GTPI 1YI21 1VQKZ 2JA7I 2JA6I 4BBRI 3NDIA 1VQNZ 4RVHA 3TE5B 3J81f 1VQLZ 3GTJI 2W03A 3CCJZ 1NJI2 2AKLA 3P5JB 4HGZA 4NOZA 1VQ51 3CCRZ 1Q7Y2 3S17I 3CCUZ 3KIHA 1VQMZ 4BY7I 1K83I 5D1PA 1Y1VI 1I50I 3CXCY 3I4MI 2ZAEB 2NVQI 3CC41 5IT9b 1YIT1 5A2Qb 2OTLZ 3D9XA 3PO3I 2O53A 4A3FI 4EWCA 5IP7I 2O4HA 1JJ2Z 3HOVI 1Q812 1RO0A 2GTHA 4NH1C 1VQPZ 3NDJA 1YUKA 1N2FA 1NJI1 4NBDA 2PMZA 1Q861 3GTGI 1VQOZ 1SFOI 4A3MI 4NBHA 1VQ71 3GTKI 1QVFZ 2JA5I 3S15I 1KQSY 4BXXI 4MD8A 2M48A 4MD7A 3EEDA 1WIIA 2KI7B 1YJNZ 4NBGA 2F4OA 5A2Qf 3S16I 4NBFA 2RPRA 4X6AI 2OZKA 1VQ61 3FKII 3CME1 1RQFA 3CCQ1 1PFTA 3CCMZ 5C4XI 3CCS1 3CC71 2GU2A 2G2KA 3KIFA 2DE7A 1X0TA 1K8A2 3I561 1N8R1 1YITZ 1L1OC 3FQQA 2QA41 1YJ91 1Y1VS 4NBEA 3CMA1 3G4SZ 3VMHA 3HKZA 4A3LI 2P28A 5D1OB 1TWGI 3PO2I 4QTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ 1;  3CCJ Z;  3CCV Z;  2QA4 Z;  1NJI 2;  1K9M 2;  1Q82 2;  3I56 Z;  1VQ5 1;  1Q81 1;  1K8A 1;  1KD1 1;  1Q86 2;  3CCR Z;  1Q7Y 2;  1K73 2;  3CCU 1;  1N8R 2;  1M90 1;  3CCE 1;  3CCU Z;  3CCS Z;  3CC7 Z;  1VQM Z;  1KC8 2;  1M1K 2;  2QEX 1;  1KQS Z;  3CXC Y;  3G6E Z;  3CC4 1;  1YIT 1;  2OTL Z;  1YIJ 1;  1W2B Z;  1JJ2 Z;  1Q82 1;  3CC2 Z;  3CXC Z;  3G71 1;  1Q81 2;  1KD1 2;  3G4S 1;  1VQP 1;  1VQP Z;  1VQN 1;  1VQ9 Z;  3CC4 Z;  1QVF Y;  1NJI 1;  1VQ4 Z;  1K9M 1;  2QEX Z;  1VQO 1;  1Q86 1;  3CPW Z;  1VQO Z;  1YHQ 1;  1YJN 1;  1Q7Y 1;  1QVG Y;  1K73 1;  1QVG Z;  3CPW Y;  1YJW Z;  1VQ7 1;  2OTJ 1;  1VQM 1;  1VQ6 Z;  1QVF Z;  3OW2 Z;  3CC2 1;  1KQS Y;  3CCL 1;  3CCL Z;  1YJN Z;  1JJ2 Y;  3G6E 1;  1VQ8 1;  1YIJ Z;  1VQ4 1;  1W2B Y;  1VQ6 1;  3I55 Z;  3CME Z;  3CD6 Z;  3CME 1;  1YHQ Z;  3CD6 1;  3CCQ 1;  3CCM Z;  3OW2 Y;  1VQ9 1;  3CCS 1;  3CC7 1;  1YI2 Z;  1YJ9 Z;  3CCE Z;  1VQ8 Z;  3CCV 1;  1KC8 1;  1M1K 1;  1K8A 2;  3I56 1;  1VQ5 Z;  1S72 1;  1S72 Z;  2OTL 1;  1N8R 1;  1YJW 1;  1M90 2;  1YIT Z;  2QA4 1;  1VQL 1;  2OTJ Z;  1VQ7 Z;  1YJ9 1;  1YI2 1;  1VQK 1;  1VQK Z;  3I55 1;  3CMA Z;  3CMA 1;  3CCQ Z;  3G4S Z;  3CCR 1;  3G71 Z;  3CCM 1;  1VQN Z;  1VQL Z; 
#chains in the Genus database with same CATH topology
 1QF8 A;  2Y0S A;  2AYD A;  4BY1 I;  4Y52 I;  4DGL A;  4MXU A;  1K9M 2;  1KD1 1;  1TWH I;  4NB9 A;  1RLY A;  1K73 2;  1N8R 2;  2P3Y A;  2V8I A;  5CM2 M;  3CC7 Z;  3CCS Z;  4A3E I;  3VMI A;  4MRI A;  1SIW A;  1YUA A;  2VUG A;  3G6E Z;  5T67 A;  2VPX A;  4QTU A;  2PK7 A;  2BJO A;  1QXF A;  1KD1 2;  5C44 I;  3GTQ I;  1I6H I;  4A3G I;  1RO2 A;  1VQ9 Z;  2R93 I;  1QVF Y;  3S14 I;  3RZO I;  4E2Z A;  3LUS A;  3MZK B;  2QEX Z;  2NVX I;  1YHQ 1;  1Q7Y 1;  2IZ3 A;  1TWA I;  1R9T I;  1YJW Z;  3RZD I;  2PM9 A;  1FDO A;  1WW9 A;  3VMG A;  4E30 A;  4E32 A;  1TWC I;  2Q4Z A;  3CC2 1;  2V45 A;  1JJ2 Y;  1VQ8 1;  4RVD A;  4NBA A;  2JIP A;  3IX0 A;  4E2X A;  1VQ4 1;  2R92 I;  2QLV B;  3S1N I;  3I55 Z;  2IZ4 A;  3S2D I;  3CD6 Z;  2NVT I;  2V8J A;  5IP9 I;  3NH4 A;  2QRD B;  2JNY A;  2F4M A;  4CL1 A;  3NH8 A;  3GTM I;  2E9H A;  1KC8 1;  1M1K 1;  1VQ5 Z;  2RBL A;  1S72 1;  4DQY B;  1VQL 1;  1VQ7 Z;  1ML8 A;  4DK1 A;  1ZB9 A;  3CCQ Z;  2JIM A;  3U50 C;  3F3F C;  2VPY A;  3CCV Z;  1P9N A;  1LQL A;  4XX2 A;  3J7A 4;  2B63 I;  1Q81 1;  4MH4 A;  1Q86 2;  4HH4 A;  3GTO I;  5AN9 F;  3CCE 1;  2WB1 A;  3VB9 A;  4MD9 A;  3HOX I;  3GCF A;  2JUB A;  4S1T A;  4NBB A;  3NFZ A;  1W2B Z;  2JIQ A;  3Q87 A;  2LFU A;  1X3W A;  1Q82 1;  3CC2 Z;  3CXC Z;  3G71 1;  5IT9 f;  3MZL B;  3G4S 1;  3D2L A;  1VQN 1;  2EGT A;  2K5R A;  2JS4 A;  3CC4 Z;  5C3E I;  1X3Z A;  2E2I I;  1K9M 1;  4A3C I;  1Y8C A;  3T4N B;  3QWU A;  4A3I I;  1I3Q I;  1WCM I;  1YJN 1;  2E7Z A;  4Y7N I;  1K73 1;  4RV9 A;  1QVG Z;  3CPW Y;  3J80 f;  1VQM 1;  2I3C A;  4A3J I;  2VUM I;  3F3P C;  1ZB8 A;  2DE5 A;  5LL6 f;  3GTM S;  3CCL 1;  4RVF A;  4NFR A;  3GTL I;  1USP B;  1FDI A;  5FLX f;  1YIJ Z;  3GKQ A;  1JWH C;  1W2B Y;  3NH5 A;  3I4N I;  1QYP A;  2R7Z I;  3CD6 1;  1YHQ Z;  5D1O A;  4E2W A;  1AA6 A;  2JR6 A;  2RHB A;  5FLM I;  3I07 A;  1YI2 Z;  3CQZ I;  1VQ8 Z;  2GTI A;  3CCV 1;  2OOX B;  3VTN A;  2LIY A;  3J80 b;  2OTL 1;  1M90 2;  4HGY A;  1YJW 1;  4NBC A;  3IF8 A;  2OTJ Z;  1USP A;  1VQK 1;  4NB8 A;  3I55 1;  1NUI A;  3CMA Z;  2QRC B;  3FQM A;  3CCR 1;  3G71 Z;  1ZH1 A;  3CCM 1;  5FLX b;  1TFI A;  1Z02 A;  2R6M A;  2QA4 Z;  3CCJ 1;  2JMO A;  1Z01 A;  2K3R A;  3IR7 A;  3I56 Z;  1Q82 2;  1TWF I;  1K8A 1;  3HOW I;  3S1R I;  3CCU 1;  3ESW A;  1M90 1;  3S1Q I;  3HOZ I;  1NP6 A;  5T64 A;  1Y1W I;  1S7M A;  1RO4 A;  1KC8 2;  1M1K 2;  2QKD A;  3BG1 B;  4E31 A;  2QEX 1;  2YU9 I;  4A93 I;  1KQS Z;  2NVY I;  3PO3 S;  4MON A;  2RIQ A;  2OOY B;  3M4O I;  4A3B I;  1YIJ 1;  4RS4 A;  4BBS I;  2QRE B;  2M6N A;  2W04 A;  2NAP A;  2IV2 X;  3HOU I;  3JAM b;  2LEX A;  5T6B A;  1VQP 1;  4TNU A;  3MON A;  2H85 A;  2VF1 A;  1VQ4 Z;  1VQO 1;  2V8K A;  4RVG A;  3CPW Z;  1QVG Y;  1RNI A;  3H0G I;  2DE6 A;  2HF1 A;  2OTJ 1;  2RT9 A;  2J6A A;  1VQ6 Z;  1Q16 A;  4A3K I;  3EER A;  3OW2 Z;  2E2H I;  2WAQ A;  1DL6 A;  3CCL Z;  1Z03 A;  2HU9 A;  5C4J I;  3G6E 1;  4AYB A;  3TDH B;  1VLA A;  3J81 b;  4E33 A;  3BG0 B;  4E2Y A;  3CME Z;  3M3Y I;  2QR1 B;  3S2H I;  3JAM f;  3HOY I;  2Q51 A;  3OW2 Y;  1VQ9 1;  3H3V J;  1YJ9 Z;  3CCE Z;  2E2J I;  4A3D I;  2JIR A;  3S1M I;  2YAD A;  3K7A I;  2JA8 I;  3D6W A;  3IFU A;  1KRL A;  1WZN A;  2KPI A;  1S72 Z;  3GTP I;  1YI2 1;  1VQK Z;  2JA7 I;  2JA6 I;  4BBR I;  3NDI A;  1VQN Z;  4RVH A;  3TE5 B;  3J81 f;  1VQL Z;  3GTJ I;  2W03 A;  3CCJ Z;  1NJI 2;  2AKL A;  3P5J B;  4HGZ A;  4NOZ A;  1VQ5 1;  3CCR Z;  1Q7Y 2;  3S17 I;  2V3V A;  3CCU Z;  3KIH A;  1VQM Z;  4BY7 I;  1K83 I;  5D1P A;  1Y1V I;  1I50 I;  3CXC Y;  3I4M I;  2ZAE B;  2NVQ I;  3CC4 1;  5IT9 b;  1YIT 1;  5A2Q b;  2OTL Z;  3D9X A;  3PO3 I;  2O53 A;  4A3F I;  4EWC A;  5IP7 I;  2O4H A;  1JJ2 Z;  3HOV I;  1Q81 2;  1RO0 A;  2GTH A;  4NH1 C;  1VQP Z;  3NDJ A;  1YUK A;  1N2F A;  1NJI 1;  4NBD A;  2PMZ A;  1Q86 1;  3GTG I;  1VQO Z;  1SFO I;  4A3M I;  4NBH A;  1VQ7 1;  3GTK I;  1QVF Z;  2JA5 I;  3S15 I;  1KQS Y;  4BXX I;  2VPW A;  4MD8 A;  2M48 A;  4MD7 A;  3EED A;  1WII A;  2KI7 B;  1YJN Z;  4NBG A;  1WJ2 A;  2F4O A;  5A2Q f;  3S16 I;  4NBF A;  2RPR A;  4X6A I;  2OZK A;  1VQ6 1;  3FKI I;  3CME 1;  1RQF A;  3CCQ 1;  1PFT A;  3CCM Z;  5C4X I;  3CCS 1;  3CC7 1;  2GU2 A;  2G2K A;  3KIF A;  2DE7 A;  1X0T A;  1K8A 2;  3I56 1;  2JIO A;  1N8R 1;  1YIT Z;  1L1O C;  3FQQ A;  2QA4 1;  2VPZ A;  1YJ9 1;  1Y1V S;  4NBE A;  3CMA 1;  3G4S Z;  3VMH A;  3HKZ A;  4A3L I;  2P28 A;  5D1O B;  1TWG I;  3PO2 I;  4QTT A; 
#chains in the Genus database with same CATH homology
 1QF8 A;  2Y0S A;  4BY1 I;  4Y52 I;  4DGL A;  4MXU A;  1K9M 2;  1KD1 1;  1TWH I;  4NB9 A;  1RLY A;  1K73 2;  1N8R 2;  2P3Y A;  2V8I A;  5CM2 M;  3CC7 Z;  3CCS Z;  4A3E I;  3VMI A;  4MRI A;  1YUA A;  2VUG A;  3G6E Z;  5T67 A;  4QTU A;  2PK7 A;  2BJO A;  1KD1 2;  5C44 I;  3GTQ I;  1I6H I;  4A3G I;  1RO2 A;  1VQ9 Z;  2R93 I;  1QVF Y;  3S14 I;  3RZO I;  4E2Z A;  3LUS A;  3MZK B;  2QEX Z;  2NVX I;  1YHQ 1;  1Q7Y 1;  2IZ3 A;  1TWA I;  1R9T I;  1YJW Z;  3RZD I;  2PM9 A;  1WW9 A;  3VMG A;  4E30 A;  4E32 A;  1TWC I;  2Q4Z A;  3CC2 1;  1JJ2 Y;  1VQ8 1;  4RVD A;  4NBA A;  3IX0 A;  4E2X A;  1VQ4 1;  2R92 I;  2QLV B;  3S1N I;  3I55 Z;  2IZ4 A;  3S2D I;  3CD6 Z;  2NVT I;  2V8J A;  5IP9 I;  3NH4 A;  2QRD B;  2JNY A;  2F4M A;  4CL1 A;  3NH8 A;  3GTM I;  2E9H A;  1KC8 1;  1M1K 1;  1VQ5 Z;  2RBL A;  1S72 1;  4DQY B;  1VQL 1;  1VQ7 Z;  1ML8 A;  4DK1 A;  1ZB9 A;  3CCQ Z;  3U50 C;  3F3F C;  3CCV Z;  1P9N A;  1LQL A;  4XX2 A;  3J7A 4;  2B63 I;  1Q81 1;  4MH4 A;  1Q86 2;  4HH4 A;  3GTO I;  5AN9 F;  3CCE 1;  2WB1 A;  3VB9 A;  4MD9 A;  3HOX I;  3GCF A;  2JUB A;  4S1T A;  4NBB A;  3NFZ A;  1W2B Z;  3Q87 A;  2LFU A;  1X3W A;  1Q82 1;  3CC2 Z;  3CXC Z;  3G71 1;  5IT9 f;  3MZL B;  3G4S 1;  1VQN 1;  2EGT A;  2K5R A;  2JS4 A;  3CC4 Z;  5C3E I;  1X3Z A;  2E2I I;  1K9M 1;  4A3C I;  3T4N B;  3QWU A;  4A3I I;  1I3Q I;  1WCM I;  1YJN 1;  4Y7N I;  1K73 1;  4RV9 A;  1QVG Z;  3CPW Y;  3J80 f;  1VQM 1;  2I3C A;  4A3J I;  2VUM I;  3F3P C;  1ZB8 A;  2DE5 A;  5LL6 f;  3GTM S;  3CCL 1;  4RVF A;  4NFR A;  3GTL I;  1USP B;  5FLX f;  1YIJ Z;  3GKQ A;  1JWH C;  1W2B Y;  3NH5 A;  3I4N I;  1QYP A;  2R7Z I;  3CD6 1;  4E2W A;  5D1O A;  1YHQ Z;  2JR6 A;  2RHB A;  5FLM I;  3I07 A;  1YI2 Z;  3CQZ I;  1VQ8 Z;  2GTI A;  3CCV 1;  2OOX B;  3VTN A;  2LIY A;  3J80 b;  2OTL 1;  1M90 2;  4HGY A;  1YJW 1;  4NBC A;  3IF8 A;  2OTJ Z;  1USP A;  1VQK 1;  4NB8 A;  3I55 1;  1NUI A;  3CMA Z;  2QRC B;  3FQM A;  3CCR 1;  3G71 Z;  1ZH1 A;  3CCM 1;  5FLX b;  1TFI A;  1Z02 A;  2R6M A;  2QA4 Z;  3CCJ 1;  2JMO A;  1Z01 A;  2K3R A;  3I56 Z;  1Q82 2;  1TWF I;  1K8A 1;  3HOW I;  3S1R I;  3CCU 1;  3ESW A;  1M90 1;  3S1Q I;  3HOZ I;  1NP6 A;  5T64 A;  1Y1W I;  1S7M A;  1RO4 A;  1KC8 2;  1M1K 2;  2QKD A;  3BG1 B;  4E31 A;  2QEX 1;  2YU9 I;  4A93 I;  1KQS Z;  2NVY I;  3PO3 S;  4MON A;  2RIQ A;  2OOY B;  3M4O I;  4A3B I;  1YIJ 1;  4RS4 A;  4BBS I;  2QRE B;  2M6N A;  2W04 A;  3HOU I;  3JAM b;  5T6B A;  1VQP 1;  4TNU A;  3MON A;  2H85 A;  2VF1 A;  1VQ4 Z;  1VQO 1;  2V8K A;  4RVG A;  3CPW Z;  1QVG Y;  1RNI A;  3H0G I;  2DE6 A;  2HF1 A;  2OTJ 1;  2RT9 A;  2J6A A;  1VQ6 Z;  4A3K I;  3EER A;  3OW2 Z;  2E2H I;  2WAQ A;  1DL6 A;  3CCL Z;  1Z03 A;  2HU9 A;  5C4J I;  3G6E 1;  4AYB A;  3TDH B;  1VLA A;  3J81 b;  4E33 A;  3BG0 B;  4E2Y A;  3CME Z;  3M3Y I;  2QR1 B;  3S2H I;  3JAM f;  3HOY I;  2Q51 A;  3OW2 Y;  1VQ9 1;  3H3V J;  1YJ9 Z;  3CCE Z;  2E2J I;  4A3D I;  3S1M I;  2YAD A;  3K7A I;  2JA8 I;  3D6W A;  3IFU A;  1KRL A;  2KPI A;  1S72 Z;  3GTP I;  1YI2 1;  1VQK Z;  2JA7 I;  2JA6 I;  4BBR I;  3NDI A;  1VQN Z;  4RVH A;  3TE5 B;  3J81 f;  1VQL Z;  3GTJ I;  2W03 A;  3CCJ Z;  1NJI 2;  2AKL A;  3P5J B;  4HGZ A;  4NOZ A;  1VQ5 1;  3CCR Z;  1Q7Y 2;  3S17 I;  3CCU Z;  3KIH A;  1VQM Z;  4BY7 I;  1K83 I;  5D1P A;  1Y1V I;  1I50 I;  3CXC Y;  3I4M I;  2ZAE B;  2NVQ I;  3CC4 1;  5IT9 b;  1YIT 1;  5A2Q b;  2OTL Z;  3D9X A;  3PO3 I;  2O53 A;  4A3F I;  4EWC A;  5IP7 I;  2O4H A;  1JJ2 Z;  3HOV I;  1Q81 2;  1RO0 A;  2GTH A;  4NH1 C;  1VQP Z;  3NDJ A;  1YUK A;  1N2F A;  1NJI 1;  4NBD A;  2PMZ A;  1Q86 1;  3GTG I;  1VQO Z;  1SFO I;  4A3M I;  4NBH A;  1VQ7 1;  3GTK I;  1QVF Z;  2JA5 I;  3S15 I;  1KQS Y;  4BXX I;  4MD8 A;  2M48 A;  4MD7 A;  3EED A;  1WII A;  2KI7 B;  1YJN Z;  4NBG A;  2F4O A;  5A2Q f;  3S16 I;  4NBF A;  2RPR A;  4X6A I;  2OZK A;  1VQ6 1;  3FKI I;  3CME 1;  1RQF A;  3CCQ 1;  1PFT A;  3CCM Z;  5C4X I;  3CCS 1;  3CC7 1;  2GU2 A;  2G2K A;  3KIF A;  2DE7 A;  1X0T A;  1K8A 2;  3I56 1;  1N8R 1;  1YIT Z;  1L1O C;  3FQQ A;  2QA4 1;  1YJ9 1;  1Y1V S;  4NBE A;  3CMA 1;  3G4S Z;  3VMH A;  3HKZ A;  4A3L I;  2P28 A;  5D1O B;  1TWG I;  3PO2 I;  4QTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...