1YI2Z

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2Z00
3CCU1 3I561 1M902 3I551 1QVGY 1M1K2 3CMAZ 1S721 3CCV1 1VQNZ 1VQ4Z 3G6EZ 3CCJZ 3CCL1 1K732 2QA4Z 1JJ2Z 1VQ81 1YI2Z 1Q7Y1 3CC4Z 1K9M2 1W2BY 1QVGZ 3G71Z 1KD11 1YJN1 1K8A1 1N8R2 2OTJ1 2QEXZ 1YITZ 1VQ51 3CCSZ 3CCMZ 1YHQZ 1VQL1 2OTL1 1YJWZ 1Q861 1VQ61 1VQ9Z 1QVFY 1VQP1 3I55Z 3CC21 1VQKZ 1VQMZ 3CD61 1YJ9Z 3G4S1 1M901 1Q7Y2 1Q821 1VQ8Z 3CMA1 3CMEZ 1QVFZ 1KD12 1KC81 3G6E1 1YIJZ 1K8A2 1VQO1 1K731 1YI21 1NJI1 3CC41 3CCE1 1W2BZ 1VQ5Z 3G711 3CCQZ 3CCRZ 2QEX1 1YIT1 1VQ71 3CCUZ 3I56Z 3CXCY 3CCS1 3CCM1 3OW2Y 1Q811 3CC71 1VQLZ 3CPWY 1S72Z 3CCVZ 3CCLZ 1JJ2Y 3CC2Z 1YJW1 1M1K1 3CXCZ 3CD6Z 3OW2Z 1VQN1 1VQ41 3CCJ1 1KQSY 3CPWZ 2QA41 3G4SZ 1Q822 1YJNZ 2OTJZ 1VQK1 1VQM1 1KC82 1YJ91 1K9M1 1NJI2 1VQOZ 1N8R1 3CME1 3CCEZ 1KQSZ 1YIJ1 1Q862 1YHQ1 2OTLZ 1VQ6Z 1VQ7Z 1VQPZ 1Q812 3CCQ1 3CC7Z 3CCR1 1VQ91
chains in the Genus database with same CATH superfamily
3J80b 1FDIA 3S16I 1L1OC 2BJOA 3GTPI 5T64A 1WJ2A 2M6NA 2I3CA 2QA4Z 1TFIA 1TWFI 3I4MI 3S14I 3VB9A 1Y1VS 3EEDA 2YADA 2VPYA 2IZ3A 3I07A 3D9XA 5IT9f 3HKZA 4RVDA 1VQL1 3S1RI 4A3CI 1RLYA 3FQQA 1VQ9Z 3EERA 3GTQI 5IT9b 3CC21 1RO2A 3T4NB 2JMOA 1VQMZ 4E2WA 2E2JI 4NBBA 1LQLA 4DK1A 1Q7Y2 1USPA 2QREB 3D6WA 1KD12 2E2II 3G6E1 1TWAI 1K8A2 1K731 3CCE1 2IV2X 1VQ5Z 2DE6A 4MD7A 2O53A 4RVGA 3GCFA 1Z03A 2R93I 3CCRZ 2QEX1 1YIT1 2QRCB 3CCUZ 3Q87A 3CCM1 1Q811 3CC71 2NVTI 3U50C 1PFTA 1ZH1A 3KIHA 3HOXI 3S2HI 3CCLZ 1JJ2Y 5IP9I 3CXCZ 4NOZA 2KPIA 3OW2Z 5T6BA 1VQ41 1VQN1 3G4SZ 1YJNZ 2OTJZ 5C4XI 2V8KA 1X0TA 2YU9I 2WAQA 1YJ91 4DQYB 3VTNA 2DE7A 1VQOZ 2Q4ZA 2V45A 1YIJ1 3F3FC 5D1PA 2HU9A 2AKLA 2RPRA 4A93I 4A3DI 1VQPZ 3S1MI 5FLXf 3CCQ1 2GTIA 2RBLA 2QR1B 4A3II 3S2DI 3I551 2GTHA 4A3MI 2RHBA 2QKDA 1JJ2Z 2JUBA 1VQ81 1QF8A 3FKII 3CC4Z 2W03A 2Y0SA 3J80f 3IF8A 1N8R2 3I4NI 4AYBA 3CCSZ 2NVQI 4RS4A 1SFOI 2JR6A 2LFUA 2F4OA 1RQFA 3MZLB 1YJWZ 3LUSA 1Q861 1VQ61 4RVHA 2VPWA 4QTTA 4BY7I 1Y8CA 4MD9A 1VQKZ 4Y52I 3S1NI 2RIQA 3JAMf 4NBDA 1N2FA 2OOXB 5CM2M 3GTOI 2K5RA 2VPXA 3VMIA 4MD8A 3JAMb 5C44I 4BBRI 4NB9A 5FLMI 2QLVB 3HOZI 1VQ71 3TDHB 1AA6A 3I56Z 3CXCY 2JA5I 1S7MA 3OW2Y 1YUAA 3MZKB 1VQLZ 5D1OB 3MONA 3PO3I 1S72Z 2G2KA 4E32A 4BY1I 3CCVZ 1RO0A 1JWHC 2JS4A 1I3QI 3CC2Z 1KRLA 4E2XA 1M1K1 3CCJ1 3NFZA 3CPWZ 1WCMI 1P9NA 1X3WA 1VQM1 3S15I 1K9M1 3NH4A 2R7ZI 1Q16A 4QTUA 1QYPA 3CCEZ 2KI7B 1KQSZ 2K3RA 1YHQ1 2OTLZ 5T67A 4X6AI 2E7ZA 1Q812 3GTGI 3CC7Z 3CCR1 2LEXA 5IP7I 1RO4A 3HOVI 3CCU1 2P3YA 1M902 2HF1A 4HH4A 3CMAZ 2DE5A 4BBSI 2J6AA 1VQNZ 1VQ4Z 4A3BI 2M48A 3CCL1 2E9HA 3FQMA 1YI2Z 2JIRA 4MONA 3S17I 4MXUA 1W2BY 3K7AI 1QVGZ 3G71Z 4A3EI 1X3ZA 4DGLA 1YJN1 2OTJ1 2O4HA 3GTMI 1TWHI 4A3JI 1QXFA 2OOYB 3M4OI 1TWCI 1I50I 4NBCA 4NBEA 4EWCA 4E2YA 4E2ZA 3ESWA 4NH1C 1VQP1 1ZB9A 3I55Z 3CQZI 3GTLI 3CD61 3IX0A 1Q821 1VQ8Z 3CMEZ 1QVFZ 2V8JA 2VUGA 1KC81 2VPZA 1NJI1 3H0GI 3CC41 2PMZA 1W2BZ 2NVYI 3NDJA 1R9TI 2JA7I 3BG1B 2VF1A 3CCS1 1WW9A 3GKQA 1Z01A 2LIYA 3CPWY 3PO3S 3F3PC 2F4MA 1WIIA 1SIWA 1YJW1 2GU2A 1WZNA 3IFUA 5D1OA 2ZAEB 1KQSY 4A3FI 2QA41 2VUMI 3NH5A 3J81b 1VQK1 4E30A 3HOWI 4NB8A 1K83I 2RT9A 3VMGA 3D2LA 2JA6I 2EGTA 5C3EI 4NBHA 1VQ7Z 4HGZA 1DL6A 4MH4A 2JNYA 2PM9A 1VQ91 3I561 5C4JI 4MRIA 1QVGY 3H3VJ 4S1TA 3RZDI 1M1K2 4A3GI 1S721 3CCV1 4A3KI 3G6EZ 3CCJZ 1K732 1TWGI 2QRDB 3M3YI 1Q7Y1 2WB1A 1K9M2 2JA8I 1KD11 1Y1VI 2P28A 1K8A1 1FDOA 2QEXZ 1YITZ 3GTMS 1VQ51 4Y7NI 1Z02A 3RZOI 2R6MA 3CCMZ 5A2Qf 1YHQZ 4RV9A 4A3LI 2JIOA 1YUKA 1Y1WI 1VLAA 3HOYI 4RVFA 2OTL1 2IZ4A 2H85A 5A2Qb 2V8IA 1QVFY 1USPB 3P5JB 3BG0B 1RNIA 2B63I 1YJ9Z 3G4S1 1NP6A 1M901 2JIQA 3CMA1 3PO2I 2AYDA 1YIJZ 3QWUA 1VQO1 1YI21 2OZKA 3GTKI 3G711 4CL1A 3CCQZ 3TE5B 2PK7A 2JIPA 2Q51A 4NBGA 5LL6f 2NAPA 4NBAA 4XX2A 1NUIA 3NDIA 3IR7A 4BXXI 4E31A 3VMHA 2E2HI 2V3VA 2W04A 1ZB8A 3CD6Z 2NVXI 4TNUA 4E33A 1Q822 5FLXb 1KC82 2JIMA 1ML8A 2R92I 3NH8A 1NJI2 4HGYA 4NFRA 1N8R1 3CME1 4NBFA 1Q862 1I6HI 1VQ6Z 3HOUI 3S1QI 5AN9F 3J7A4 3J81f 3KIFA 3GTJI
chains in the Genus database with same CATH topology
3J80b 3S16I 1L1OC 2BJOA 3GTPI 5T64A 2M6NA 2I3CA 2QA4Z 1TFIA 1TWFI 3I4MI 3S14I 3VB9A 1Y1VS 3EEDA 2YADA 2IZ3A 3I07A 3D9XA 5IT9f 3HKZA 4RVDA 1VQL1 3S1RI 4A3CI 1RLYA 3FQQA 1VQ9Z 3EERA 3GTQI 5IT9b 3CC21 1RO2A 3T4NB 2JMOA 1VQMZ 4E2WA 2E2JI 4NBBA 1LQLA 4DK1A 1Q7Y2 1USPA 2QREB 3D6WA 1KD12 2E2II 3G6E1 1TWAI 1K8A2 1K731 3CCE1 1VQ5Z 2DE6A 4MD7A 2O53A 4RVGA 3GCFA 1Z03A 2R93I 3CCRZ 2QEX1 1YIT1 2QRCB 3CCUZ 3Q87A 3CCM1 1Q811 3CC71 2NVTI 3U50C 1PFTA 1ZH1A 3KIHA 3HOXI 3S2HI 3CCLZ 1JJ2Y 5IP9I 3CXCZ 4NOZA 2KPIA 3OW2Z 5T6BA 1VQ41 1VQN1 3G4SZ 1YJNZ 2OTJZ 5C4XI 2V8KA 1X0TA 2YU9I 2WAQA 1YJ91 4DQYB 3VTNA 2DE7A 1VQOZ 2Q4ZA 1YIJ1 3F3FC 5D1PA 2HU9A 2AKLA 2RPRA 4A93I 4A3DI 1VQPZ 3S1MI 5FLXf 3CCQ1 2GTIA 2RBLA 2QR1B 4A3II 3S2DI 3I551 2GTHA 4A3MI 2RHBA 2QKDA 1JJ2Z 2JUBA 1VQ81 1QF8A 3FKII 3CC4Z 2W03A 2Y0SA 3J80f 3IF8A 1N8R2 3I4NI 4AYBA 3CCSZ 2NVQI 4RS4A 1SFOI 2JR6A 2LFUA 2F4OA 1RQFA 3MZLB 1YJWZ 3LUSA 1Q861 1VQ61 4RVHA 4QTTA 4BY7I 4MD9A 1VQKZ 4Y52I 3S1NI 2RIQA 3JAMf 4NBDA 1N2FA 2OOXB 5CM2M 3GTOI 2K5RA 3VMIA 4MD8A 3JAMb 5C44I 4BBRI 4NB9A 5FLMI 2QLVB 3HOZI 1VQ71 3TDHB 2JA5I 3I56Z 3CXCY 1S7MA 3OW2Y 1YUAA 3MZKB 1VQLZ 5D1OB 3MONA 3PO3I 1S72Z 2G2KA 4E32A 4BY1I 3CCVZ 1RO0A 1JWHC 2JS4A 1I3QI 3CC2Z 1KRLA 4E2XA 1M1K1 3CCJ1 3NFZA 3CPWZ 1WCMI 1P9NA 1X3WA 1VQM1 3S15I 1K9M1 3NH4A 2R7ZI 4QTUA 3CCEZ 1QYPA 2KI7B 1KQSZ 2K3RA 1YHQ1 2OTLZ 5T67A 4X6AI 1Q812 3GTGI 3CC7Z 3CCR1 5IP7I 1RO4A 3HOVI 3CCU1 2P3YA 1M902 2HF1A 4HH4A 3CMAZ 2DE5A 4BBSI 2J6AA 1VQNZ 1VQ4Z 4A3BI 2M48A 3CCL1 2E9HA 3FQMA 1YI2Z 4MONA 3S17I 4MXUA 1W2BY 3K7AI 1QVGZ 3G71Z 4A3EI 1X3ZA 4DGLA 1YJN1 2OTJ1 2O4HA 3GTMI 1TWHI 4A3JI 2OOYB 3M4OI 1TWCI 1I50I 4NBCA 4NBEA 4EWCA 4E2YA 4E2ZA 3ESWA 4NH1C 1VQP1 1ZB9A 3I55Z 3CQZI 3GTLI 3CD61 3IX0A 1Q821 1VQ8Z 3CMEZ 1QVFZ 2V8JA 2VUGA 1KC81 1NJI1 3H0GI 3CC41 2PMZA 1W2BZ 2NVYI 3NDJA 1R9TI 2JA7I 3BG1B 2VF1A 3CCS1 1WW9A 3GKQA 1Z01A 2LIYA 3CPWY 3PO3S 3F3PC 2F4MA 1WIIA 1YJW1 2GU2A 3IFUA 5D1OA 2ZAEB 1KQSY 4A3FI 2QA41 2VUMI 3NH5A 3J81b 1VQK1 4E30A 3HOWI 4NB8A 1K83I 2RT9A 3VMGA 2JA6I 2EGTA 5C3EI 4NBHA 1VQ7Z 4HGZA 1DL6A 4MH4A 2JNYA 2PM9A 1VQ91 3I561 5C4JI 4MRIA 1QVGY 3H3VJ 4S1TA 3RZDI 1M1K2 4A3GI 1S721 3CCV1 4A3KI 3G6EZ 3CCJZ 1K732 1TWGI 2QRDB 3M3YI 1Q7Y1 2WB1A 1K9M2 2JA8I 1KD11 1Y1VI 2P28A 1K8A1 2QEXZ 1YITZ 3GTMS 1VQ51 4Y7NI 1Z02A 3RZOI 2R6MA 3CCMZ 5A2Qf 1YHQZ 4RV9A 4A3LI 1Y1WI 1YUKA 1VLAA 3HOYI 4RVFA 2OTL1 2IZ4A 2H85A 5A2Qb 2V8IA 1QVFY 1USPB 3P5JB 3BG0B 1RNIA 2B63I 1YJ9Z 3G4S1 1NP6A 1M901 3CMA1 3PO2I 1YIJZ 3QWUA 1VQO1 1YI21 2OZKA 3GTKI 3G711 4CL1A 3CCQZ 3TE5B 2PK7A 2Q51A 4NBGA 5LL6f 4NBAA 4XX2A 1NUIA 3NDIA 4BXXI 4E31A 3VMHA 2E2HI 2W04A 1ZB8A 3CD6Z 2NVXI 4TNUA 4E33A 1Q822 5FLXb 1KC82 1ML8A 2R92I 3NH8A 1NJI2 4HGYA 4NFRA 1N8R1 3CME1 4NBFA 1Q862 1I6HI 1VQ6Z 3HOUI 3S1QI 5AN9F 3J7A4 3J81f 3KIFA 3GTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU 1;  3I56 1;  1M90 2;  3I55 1;  1QVG Y;  1M1K 2;  3CMA Z;  1S72 1;  3CCV 1;  1VQN Z;  1VQ4 Z;  3G6E Z;  3CCJ Z;  3CCL 1;  1K73 2;  2QA4 Z;  1JJ2 Z;  1VQ8 1;  1YI2 Z;  1Q7Y 1;  3CC4 Z;  1K9M 2;  1W2B Y;  1QVG Z;  3G71 Z;  1KD1 1;  1YJN 1;  1K8A 1;  1N8R 2;  2OTJ 1;  2QEX Z;  1YIT Z;  1VQ5 1;  3CCS Z;  3CCM Z;  1YHQ Z;  1VQL 1;  2OTL 1;  1YJW Z;  1Q86 1;  1VQ6 1;  1VQ9 Z;  1QVF Y;  1VQP 1;  3I55 Z;  3CC2 1;  1VQK Z;  1VQM Z;  3CD6 1;  1YJ9 Z;  3G4S 1;  1M90 1;  1Q7Y 2;  1Q82 1;  1VQ8 Z;  3CMA 1;  3CME Z;  1QVF Z;  1KD1 2;  1KC8 1;  3G6E 1;  1YIJ Z;  1K8A 2;  1VQO 1;  1K73 1;  1YI2 1;  1NJI 1;  3CC4 1;  3CCE 1;  1W2B Z;  1VQ5 Z;  3G71 1;  3CCQ Z;  3CCR Z;  2QEX 1;  1YIT 1;  1VQ7 1;  3CCU Z;  3I56 Z;  3CXC Y;  3CCS 1;  3CCM 1;  3OW2 Y;  1Q81 1;  3CC7 1;  1VQL Z;  3CPW Y;  1S72 Z;  3CCV Z;  3CCL Z;  1JJ2 Y;  3CC2 Z;  1YJW 1;  1M1K 1;  3CXC Z;  3CD6 Z;  3OW2 Z;  1VQN 1;  1VQ4 1;  3CCJ 1;  1KQS Y;  3CPW Z;  2QA4 1;  3G4S Z;  1Q82 2;  1YJN Z;  2OTJ Z;  1VQK 1;  1VQM 1;  1KC8 2;  1YJ9 1;  1K9M 1;  1NJI 2;  1VQO Z;  1N8R 1;  3CME 1;  3CCE Z;  1KQS Z;  1YIJ 1;  1Q86 2;  1YHQ 1;  2OTL Z;  1VQ6 Z;  1VQ7 Z;  1VQP Z;  1Q81 2;  3CCQ 1;  3CC7 Z;  3CCR 1;  1VQ9 1; 
#chains in the Genus database with same CATH topology
 3J80 b;  1FDI A;  3S16 I;  1L1O C;  2BJO A;  3GTP I;  5T64 A;  1WJ2 A;  2M6N A;  2I3C A;  2QA4 Z;  1TFI A;  1TWF I;  3I4M I;  3S14 I;  3VB9 A;  1Y1V S;  3EED A;  2YAD A;  2VPY A;  2IZ3 A;  3I07 A;  3D9X A;  5IT9 f;  3HKZ A;  4RVD A;  1VQL 1;  3S1R I;  4A3C I;  1RLY A;  3FQQ A;  1VQ9 Z;  3EER A;  3GTQ I;  5IT9 b;  3CC2 1;  1RO2 A;  3T4N B;  2JMO A;  1VQM Z;  4E2W A;  2E2J I;  4NBB A;  1LQL A;  4DK1 A;  1Q7Y 2;  1USP A;  2QRE B;  3D6W A;  1KD1 2;  2E2I I;  3G6E 1;  1TWA I;  1K8A 2;  1K73 1;  3CCE 1;  2IV2 X;  1VQ5 Z;  2DE6 A;  4MD7 A;  2O53 A;  4RVG A;  3GCF A;  1Z03 A;  2R93 I;  3CCR Z;  2QEX 1;  1YIT 1;  2QRC B;  3CCU Z;  3Q87 A;  3CCM 1;  1Q81 1;  3CC7 1;  2NVT I;  3U50 C;  1PFT A;  1ZH1 A;  3KIH A;  3HOX I;  3S2H I;  3CCL Z;  1JJ2 Y;  5IP9 I;  3CXC Z;  4NOZ A;  2KPI A;  3OW2 Z;  5T6B A;  1VQ4 1;  1VQN 1;  3G4S Z;  1YJN Z;  2OTJ Z;  5C4X I;  2V8K A;  1X0T A;  2YU9 I;  2WAQ A;  1YJ9 1;  4DQY B;  3VTN A;  2DE7 A;  1VQO Z;  2Q4Z A;  2V45 A;  1YIJ 1;  3F3F C;  5D1P A;  2HU9 A;  2AKL A;  2RPR A;  4A93 I;  4A3D I;  1VQP Z;  3S1M I;  5FLX f;  3CCQ 1;  2GTI A;  2RBL A;  2QR1 B;  4A3I I;  3S2D I;  3I55 1;  2GTH A;  4A3M I;  2RHB A;  2QKD A;  1JJ2 Z;  2JUB A;  1VQ8 1;  1QF8 A;  3FKI I;  3CC4 Z;  2W03 A;  2Y0S A;  3J80 f;  3IF8 A;  1N8R 2;  3I4N I;  4AYB A;  3CCS Z;  2NVQ I;  4RS4 A;  1SFO I;  2JR6 A;  2LFU A;  2F4O A;  1RQF A;  3MZL B;  1YJW Z;  3LUS A;  1Q86 1;  1VQ6 1;  4RVH A;  2VPW A;  4QTT A;  4BY7 I;  1Y8C A;  4MD9 A;  1VQK Z;  4Y52 I;  3S1N I;  2RIQ A;  3JAM f;  4NBD A;  1N2F A;  2OOX B;  5CM2 M;  3GTO I;  2K5R A;  2VPX A;  3VMI A;  4MD8 A;  3JAM b;  5C44 I;  4BBR I;  4NB9 A;  5FLM I;  2QLV B;  3HOZ I;  1VQ7 1;  3TDH B;  1AA6 A;  3I56 Z;  3CXC Y;  2JA5 I;  1S7M A;  3OW2 Y;  1YUA A;  3MZK B;  1VQL Z;  5D1O B;  3MON A;  3PO3 I;  1S72 Z;  2G2K A;  4E32 A;  4BY1 I;  3CCV Z;  1RO0 A;  1JWH C;  2JS4 A;  1I3Q I;  3CC2 Z;  1KRL A;  4E2X A;  1M1K 1;  3CCJ 1;  3NFZ A;  3CPW Z;  1WCM I;  1P9N A;  1X3W A;  1VQM 1;  3S15 I;  1K9M 1;  3NH4 A;  2R7Z I;  1Q16 A;  4QTU A;  1QYP A;  3CCE Z;  2KI7 B;  1KQS Z;  2K3R A;  1YHQ 1;  2OTL Z;  5T67 A;  4X6A I;  2E7Z A;  1Q81 2;  3GTG I;  3CC7 Z;  3CCR 1;  2LEX A;  5IP7 I;  1RO4 A;  3HOV I;  3CCU 1;  2P3Y A;  1M90 2;  2HF1 A;  4HH4 A;  3CMA Z;  2DE5 A;  4BBS I;  2J6A A;  1VQN Z;  1VQ4 Z;  4A3B I;  2M48 A;  3CCL 1;  2E9H A;  3FQM A;  1YI2 Z;  2JIR A;  4MON A;  3S17 I;  4MXU A;  1W2B Y;  3K7A I;  1QVG Z;  3G71 Z;  4A3E I;  1X3Z A;  4DGL A;  1YJN 1;  2OTJ 1;  2O4H A;  3GTM I;  1TWH I;  4A3J I;  1QXF A;  2OOY B;  3M4O I;  1TWC I;  1I50 I;  4NBC A;  4NBE A;  4EWC A;  4E2Y A;  4E2Z A;  3ESW A;  4NH1 C;  1VQP 1;  1ZB9 A;  3I55 Z;  3CQZ I;  3GTL I;  3CD6 1;  3IX0 A;  1Q82 1;  1VQ8 Z;  3CME Z;  1QVF Z;  2V8J A;  2VUG A;  1KC8 1;  2VPZ A;  1NJI 1;  3H0G I;  3CC4 1;  2PMZ A;  1W2B Z;  2NVY I;  3NDJ A;  1R9T I;  2JA7 I;  3BG1 B;  2VF1 A;  3CCS 1;  1WW9 A;  3GKQ A;  1Z01 A;  2LIY A;  3CPW Y;  3PO3 S;  3F3P C;  2F4M A;  1WII A;  1SIW A;  1YJW 1;  2GU2 A;  1WZN A;  3IFU A;  5D1O A;  2ZAE B;  1KQS Y;  4A3F I;  2QA4 1;  2VUM I;  3NH5 A;  3J81 b;  1VQK 1;  4E30 A;  3HOW I;  4NB8 A;  1K83 I;  2RT9 A;  3VMG A;  3D2L A;  2JA6 I;  2EGT A;  5C3E I;  4NBH A;  1VQ7 Z;  4HGZ A;  1DL6 A;  4MH4 A;  2JNY A;  2PM9 A;  1VQ9 1;  3I56 1;  5C4J I;  4MRI A;  1QVG Y;  3H3V J;  4S1T A;  3RZD I;  1M1K 2;  4A3G I;  1S72 1;  3CCV 1;  4A3K I;  3G6E Z;  3CCJ Z;  1K73 2;  1TWG I;  2QRD B;  3M3Y I;  1Q7Y 1;  2WB1 A;  1K9M 2;  2JA8 I;  1KD1 1;  1Y1V I;  2P28 A;  1K8A 1;  1FDO A;  2QEX Z;  1YIT Z;  3GTM S;  1VQ5 1;  4Y7N I;  1Z02 A;  3RZO I;  2R6M A;  3CCM Z;  5A2Q f;  1YHQ Z;  4RV9 A;  4A3L I;  2JIO A;  1YUK A;  1Y1W I;  1VLA A;  3HOY I;  4RVF A;  2OTL 1;  2IZ4 A;  2H85 A;  5A2Q b;  2V8I A;  1QVF Y;  1USP B;  3P5J B;  3BG0 B;  1RNI A;  2B63 I;  1YJ9 Z;  3G4S 1;  1NP6 A;  1M90 1;  2JIQ A;  3CMA 1;  3PO2 I;  2AYD A;  1YIJ Z;  3QWU A;  1VQO 1;  1YI2 1;  2OZK A;  3GTK I;  3G71 1;  4CL1 A;  3CCQ Z;  3TE5 B;  2PK7 A;  2JIP A;  2Q51 A;  4NBG A;  5LL6 f;  2NAP A;  4NBA A;  4XX2 A;  1NUI A;  3NDI A;  3IR7 A;  4BXX I;  4E31 A;  3VMH A;  2E2H I;  2V3V A;  2W04 A;  1ZB8 A;  3CD6 Z;  2NVX I;  4TNU A;  4E33 A;  1Q82 2;  5FLX b;  1KC8 2;  2JIM A;  1ML8 A;  2R92 I;  3NH8 A;  1NJI 2;  4HGY A;  4NFR A;  1N8R 1;  3CME 1;  4NBF A;  1Q86 2;  1I6H I;  1VQ6 Z;  3HOU I;  3S1Q I;  5AN9 F;  3J7A 4;  3J81 f;  3KIF A;  3GTJ I; 
#chains in the Genus database with same CATH homology
 3J80 b;  3S16 I;  1L1O C;  2BJO A;  3GTP I;  5T64 A;  2M6N A;  2I3C A;  2QA4 Z;  1TFI A;  1TWF I;  3I4M I;  3S14 I;  3VB9 A;  1Y1V S;  3EED A;  2YAD A;  2IZ3 A;  3I07 A;  3D9X A;  5IT9 f;  3HKZ A;  4RVD A;  1VQL 1;  3S1R I;  4A3C I;  1RLY A;  3FQQ A;  1VQ9 Z;  3EER A;  3GTQ I;  5IT9 b;  3CC2 1;  1RO2 A;  3T4N B;  2JMO A;  1VQM Z;  4E2W A;  2E2J I;  4NBB A;  1LQL A;  4DK1 A;  1Q7Y 2;  1USP A;  2QRE B;  3D6W A;  1KD1 2;  2E2I I;  3G6E 1;  1TWA I;  1K8A 2;  1K73 1;  3CCE 1;  1VQ5 Z;  2DE6 A;  4MD7 A;  2O53 A;  4RVG A;  3GCF A;  1Z03 A;  2R93 I;  3CCR Z;  2QEX 1;  1YIT 1;  2QRC B;  3CCU Z;  3Q87 A;  3CCM 1;  1Q81 1;  3CC7 1;  2NVT I;  3U50 C;  1PFT A;  1ZH1 A;  3KIH A;  3HOX I;  3S2H I;  3CCL Z;  1JJ2 Y;  5IP9 I;  3CXC Z;  4NOZ A;  2KPI A;  3OW2 Z;  5T6B A;  1VQ4 1;  1VQN 1;  3G4S Z;  1YJN Z;  2OTJ Z;  5C4X I;  2V8K A;  1X0T A;  2YU9 I;  2WAQ A;  1YJ9 1;  4DQY B;  3VTN A;  2DE7 A;  1VQO Z;  2Q4Z A;  1YIJ 1;  3F3F C;  5D1P A;  2HU9 A;  2AKL A;  2RPR A;  4A93 I;  4A3D I;  1VQP Z;  3S1M I;  5FLX f;  3CCQ 1;  2GTI A;  2RBL A;  2QR1 B;  4A3I I;  3S2D I;  3I55 1;  2GTH A;  4A3M I;  2RHB A;  2QKD A;  1JJ2 Z;  2JUB A;  1VQ8 1;  1QF8 A;  3FKI I;  3CC4 Z;  2W03 A;  2Y0S A;  3J80 f;  3IF8 A;  1N8R 2;  3I4N I;  4AYB A;  3CCS Z;  2NVQ I;  4RS4 A;  1SFO I;  2JR6 A;  2LFU A;  2F4O A;  1RQF A;  3MZL B;  1YJW Z;  3LUS A;  1Q86 1;  1VQ6 1;  4RVH A;  4QTT A;  4BY7 I;  4MD9 A;  1VQK Z;  4Y52 I;  3S1N I;  2RIQ A;  3JAM f;  4NBD A;  1N2F A;  2OOX B;  5CM2 M;  3GTO I;  2K5R A;  3VMI A;  4MD8 A;  3JAM b;  5C44 I;  4BBR I;  4NB9 A;  5FLM I;  2QLV B;  3HOZ I;  1VQ7 1;  3TDH B;  2JA5 I;  3I56 Z;  3CXC Y;  1S7M A;  3OW2 Y;  1YUA A;  3MZK B;  1VQL Z;  5D1O B;  3MON A;  3PO3 I;  1S72 Z;  2G2K A;  4E32 A;  4BY1 I;  3CCV Z;  1RO0 A;  1JWH C;  2JS4 A;  1I3Q I;  3CC2 Z;  1KRL A;  4E2X A;  1M1K 1;  3CCJ 1;  3NFZ A;  3CPW Z;  1WCM I;  1P9N A;  1X3W A;  1VQM 1;  3S15 I;  1K9M 1;  3NH4 A;  2R7Z I;  4QTU A;  3CCE Z;  1QYP A;  2KI7 B;  1KQS Z;  2K3R A;  1YHQ 1;  2OTL Z;  5T67 A;  4X6A I;  1Q81 2;  3GTG I;  3CC7 Z;  3CCR 1;  5IP7 I;  1RO4 A;  3HOV I;  3CCU 1;  2P3Y A;  1M90 2;  2HF1 A;  4HH4 A;  3CMA Z;  2DE5 A;  4BBS I;  2J6A A;  1VQN Z;  1VQ4 Z;  4A3B I;  2M48 A;  3CCL 1;  2E9H A;  3FQM A;  1YI2 Z;  4MON A;  3S17 I;  4MXU A;  1W2B Y;  3K7A I;  1QVG Z;  3G71 Z;  4A3E I;  1X3Z A;  4DGL A;  1YJN 1;  2OTJ 1;  2O4H A;  3GTM I;  1TWH I;  4A3J I;  2OOY B;  3M4O I;  1TWC I;  1I50 I;  4NBC A;  4NBE A;  4EWC A;  4E2Y A;  4E2Z A;  3ESW A;  4NH1 C;  1VQP 1;  1ZB9 A;  3I55 Z;  3CQZ I;  3GTL I;  3CD6 1;  3IX0 A;  1Q82 1;  1VQ8 Z;  3CME Z;  1QVF Z;  2V8J A;  2VUG A;  1KC8 1;  1NJI 1;  3H0G I;  3CC4 1;  2PMZ A;  1W2B Z;  2NVY I;  3NDJ A;  1R9T I;  2JA7 I;  3BG1 B;  2VF1 A;  3CCS 1;  1WW9 A;  3GKQ A;  1Z01 A;  2LIY A;  3CPW Y;  3PO3 S;  3F3P C;  2F4M A;  1WII A;  1YJW 1;  2GU2 A;  3IFU A;  5D1O A;  2ZAE B;  1KQS Y;  4A3F I;  2QA4 1;  2VUM I;  3NH5 A;  3J81 b;  1VQK 1;  4E30 A;  3HOW I;  4NB8 A;  1K83 I;  2RT9 A;  3VMG A;  2JA6 I;  2EGT A;  5C3E I;  4NBH A;  1VQ7 Z;  4HGZ A;  1DL6 A;  4MH4 A;  2JNY A;  2PM9 A;  1VQ9 1;  3I56 1;  5C4J I;  4MRI A;  1QVG Y;  3H3V J;  4S1T A;  3RZD I;  1M1K 2;  4A3G I;  1S72 1;  3CCV 1;  4A3K I;  3G6E Z;  3CCJ Z;  1K73 2;  1TWG I;  2QRD B;  3M3Y I;  1Q7Y 1;  2WB1 A;  1K9M 2;  2JA8 I;  1KD1 1;  1Y1V I;  2P28 A;  1K8A 1;  2QEX Z;  1YIT Z;  3GTM S;  1VQ5 1;  4Y7N I;  1Z02 A;  3RZO I;  2R6M A;  3CCM Z;  5A2Q f;  1YHQ Z;  4RV9 A;  4A3L I;  1Y1W I;  1YUK A;  1VLA A;  3HOY I;  4RVF A;  2OTL 1;  2IZ4 A;  2H85 A;  5A2Q b;  2V8I A;  1QVF Y;  1USP B;  3P5J B;  3BG0 B;  1RNI A;  2B63 I;  1YJ9 Z;  3G4S 1;  1NP6 A;  1M90 1;  3CMA 1;  3PO2 I;  1YIJ Z;  3QWU A;  1VQO 1;  1YI2 1;  2OZK A;  3GTK I;  3G71 1;  4CL1 A;  3CCQ Z;  3TE5 B;  2PK7 A;  2Q51 A;  4NBG A;  5LL6 f;  4NBA A;  4XX2 A;  1NUI A;  3NDI A;  4BXX I;  4E31 A;  3VMH A;  2E2H I;  2W04 A;  1ZB8 A;  3CD6 Z;  2NVX I;  4TNU A;  4E33 A;  1Q82 2;  5FLX b;  1KC8 2;  1ML8 A;  2R92 I;  3NH8 A;  1NJI 2;  4HGY A;  4NFR A;  1N8R 1;  3CME 1;  4NBF A;  1Q86 2;  1I6H I;  1VQ6 Z;  3HOU I;  3S1Q I;  5AN9 F;  3J7A 4;  3J81 f;  3KIF A;  3GTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...