1YI2Z

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2Z00
1VQ51 3G4SZ 1S721 1Q811 1VQNZ 1YJNZ 1W2BZ 1YJWZ 3G4S1 3I56Z 3CCE1 3CC7Z 3CME1 1W2BY 1VQ91 1M1K2 1NJI2 1N8R1 3CMEZ 1YJ91 3CC4Z 3CC41 1Q7Y2 1M901 1K8A2 3CC2Z 1K732 1VQL1 1Q861 2OTJZ 1VQP1 1VQ7Z 2OTL1 1N8R2 3CC21 3G711 3CCRZ 2QA41 1VQMZ 1Q812 3CCJ1 1K9M2 3CCQZ 1VQ41 1VQ6Z 1VQN1 2QEXZ 1YI21 1YJ9Z 1YIJ1 1YIT1 3G6EZ 1YIJZ 3CC71 1KQSZ 3CCEZ 3CCQ1 1VQ4Z 1VQM1 1VQ71 1QVFZ 1K8A1 1K731 3CCL1 3CCV1 3CCM1 1VQ81 3OW2Z 1KC81 3CCSZ 1VQK1 1YITZ 1VQO1 1QVFY 1QVGZ 1VQKZ 1YJW1 3CCMZ 3I561 1VQPZ 1VQ5Z 1KC82 3OW2Y 3CXCZ 1VQLZ 3CCUZ 3CD6Z 1M1K1 1QVGY 1KQSY 3CCS1 1YHQ1 1M902 3G6E1 2QA4Z 1VQ9Z 3CCVZ 3I551 3CCLZ 1K9M1 3CPWZ 1YI2Z 3CCU1 1NJI1 3CCJZ 1KD11 3G71Z 3CCR1 3CMA1 2OTLZ 1S72Z 1Q821 1JJ2Y 2OTJ1 3CMAZ 1KD12 1Q7Y1 1Q822 1VQOZ 3CPWY 3I55Z 2QEX1 1JJ2Z 1VQ61 1Q862 3CD61 1VQ8Z 3CXCY 1YHQZ 1YJN1
chains in the Genus database with same CATH superfamily
3G4SZ 3D2LA 1Q811 1VQNZ 4A3BI 2JNYA 1NUIA 1L1OC 3EERA 1YJWZ 3LUSA 3I56Z 1USPA 3CC7Z 3NDJA 3BG0B 4MH4A 2K3RA 2GU2A 3H3VJ 1FDOA 2IZ3A 5T6BA 4HGZA 4A3JI 2V3VA 3D9XA 3NFZA 1Z02A 4RV9A 5C3EI 1VQP1 2HF1A 1RO0A 1VQ7Z 4NFRA 2JR6A 1VQMZ 1K9M2 2QEXZ 3HOXI 1YJ9Z 1YIT1 2IZ4A 1ZB8A 2H85A 2QRDB 4E2WA 1VQ4Z 3RZOI 1QVFZ 1LQLA 2JIRA 1WZNA 2DE6A 1YUKA 4Y7NI 4RVDA 3JAMf 3CCM1 2RT9A 4E2XA 4A3II 2VPYA 2LEXA 3GTLI 3GTPI 5A2Qb 4A3EI 4X6AI 3HOUI 3CCMZ 2VUMI 1TWHI 4NB8A 1ML8A 1RO4A 1I50I 5AN9F 3I4NI 1Z01A 4TNUA 4NBBA 3CCS1 1YHQ1 3GTMS 2O4HA 3HOYI 3FQMA 3HKZA 3CQZI 3HOWI 3CCVZ 3ESWA 3CCLZ 3VMGA 2Q51A 3CPWZ 1WCMI 2P28A 3MZLB 2NVQI 3S1RI 1JJ2Y 2QLVB 3J81f 2AKLA 2E7ZA 5A2Qf 3PO2I 3CPWY 4BBRI 1VQ61 3NH8A 4A3FI 2R93I 1WIIA 1S721 3RZDI 5IP7I 1WW9A 4DK1A 5D1OB 2LFUA 3HOVI 3G4S1 3VTNA 3IF8A 2RBLA 1VQ91 1RNIA 2V8JA 1N8R1 3CMEZ 1YJ91 5IT9f 3I4MI 3S1NI 5IP9I 1K732 2GTHA 3PO3I 1N8R2 2JIOA 1N2FA 2PMZA 3CCJ1 3CCQZ 3JAMb 1YI21 1YIJ1 4NBHA 3G6EZ 1YIJZ 3CC71 2WAQA 1FDIA 1Y1VS 2VPWA 3CCQ1 3F3FC 1I3QI 1K83I 4HGYA 3IR7A 3K7AI 3NDIA 3D6WA 4A3CI 3HOZI 1KC81 2GTIA 2NVXI 1VQK1 3GTOI 4NBGA 1X3ZA 2YU9I 2R92I 4XX2A 2ZAEB 3GCFA 3GTKI 4A3DI 4MRIA 1X0TA 2VUGA 1KC82 3CXCZ 4BY1I 1VQLZ 1ZH1A 1TWCI 1TWGI 1PFTA 5T67A 4MD8A 4E33A 1P9NA 2B63I 4A3LI 1RQFA 2E2JI 1TFIA 3EEDA 1JWHC 3T4NB 2Y0SA 5C4JI 3M4OI 4NBEA 2V8KA 2R6MA 4E30A 3G71Z 3CCR1 5FLMI 2M48A 4QTUA 2KPIA 4DGLA 1QYPA 1Q7Y1 4BBSI 1DL6A 3F3PC 1AA6A 4HH4A 2E9HA 3VMHA 1VQ8Z 3CXCY 5FLXf 2QRCB 2I3CA 1YHQZ 2P3YA 3I07A 2JIQA 2V45A 4CL1A 1W2BZ 2JA6I 4EWCA 2E2II 4A93I 2JIPA 2W03A 4RVHA 2JA8I 4E32A 1M1K2 3S2DI 4MD7A 2G2KA 1Q7Y2 1M901 2JUBA 1VLAA 3CC2Z 3S16I 1VQL1 1Q861 2OTJZ 1QF8A 2OTL1 2DE7A 2RIQA 1VQ41 1VQN1 2VPZA 2NVYI 2NAPA 2OOXB 3CCEZ 1VQM1 4E2ZA 4E2YA 1VQ71 4RS4A 3J80b 2W04A 1K8A1 1S7MA 2JMOA 1K731 3FQQA 3OW2Z 3GKQA 4NBFA 4NH1C 1QXFA 1VQO1 1YJW1 4A3MI 2QR1B 2OOYB 2JA7I 3M3YI 4Y52I 2O53A 3GTGI 3I561 2KI7B 3J80f 1ZB9A 3OW2Y 2JIMA 5D1OA 3QWUA 4BXXI 3PO3S 3CCUZ 2RPRA 1Z03A 2VPXA 3S1MI 1M902 3U50C 1VQ9Z 2F4MA 3GTJI 4RVFA 5IT9b 2RHBA 1USPB 5FLXb 3CCU1 1Y1VI 3CMA1 2OTLZ 3S15I 1S72Z 3S2HI 1Q821 1Y1WI 2OTJ1 2K5RA 3TDHB 1VQOZ 3I55Z 4A3KI 3CD61 1RO2A 2IV2X 3IX0A 1KRLA 3J7A4 1VQ51 2AYDA 1YJNZ 3MONA 3Q87A 1R9TI 4MD9A 4NBDA 2VF1A 3NH5A 3CCE1 2LIYA 4RVGA 2OZKA 3CME1 2HU9A 1W2BY 3S1QI 1NJI2 3CC4Z 2EGTA 2QKDA 3CC41 1K8A2 2JA5I 4A3GI 2WB1A 4DQYB 3KIHA 5D1PA 1Y8CA 3TE5B 1TWAI 3CC21 3G711 3CCRZ 2QA41 1VQ6Z 1Q812 3BG1B 4NOZA 2BJOA 1KQSZ 2NVTI 3IFUA 1YUAA 2E2HI 5CM2M 2F4OA 3CCL1 4NBAA 3CCV1 1SIWA 1WJ2A 3GTMI 1VQ81 1NP6A 4AYBA 3NH4A 3CCSZ 1YITZ 1QVFY 3P5JB 4QTTA 2PK7A 1QVGZ 1VQKZ 4MXUA 1TWFI 4NBCA 3GTQI 2R7ZI 1RLYA 3KIFA 1VQPZ 2YADA 1VQ5Z 3S14I 3VB9A 5C44I 4BY7I 3CD6Z 1M1K1 3FKII 1QVGY 5T64A 1KQSY 3MZKB 4E31A 1X3WA 2J6AA 3G6E1 2QA4Z 2PM9A 2DE5A 3I551 2JS4A 1K9M1 3VMIA 1YI2Z 2M6NA 2Q4ZA 4MONA 1I6HI 4NB9A 1NJI1 3CCJZ 1KD11 4S1TA 3CMAZ 1KD12 5LL6f 3S17I 5C4XI 2QREB 1Q822 1Q16A 3H0GI 2QEX1 1JJ2Z 3J81b 1Q862 1SFOI 1YJN1 2V8IA
chains in the Genus database with same CATH topology
3G4SZ 1Q811 1VQNZ 4A3BI 2JNYA 1NUIA 1L1OC 3EERA 1YJWZ 3LUSA 3I56Z 1USPA 3CC7Z 3NDJA 3BG0B 4MH4A 2K3RA 2GU2A 3H3VJ 2IZ3A 5T6BA 4HGZA 4A3JI 3D9XA 3NFZA 1Z02A 4RV9A 5C3EI 1VQP1 2HF1A 1RO0A 1VQ7Z 4NFRA 2JR6A 1VQMZ 1K9M2 2QEXZ 3HOXI 1YJ9Z 1YIT1 2IZ4A 1ZB8A 2H85A 2QRDB 4E2WA 1VQ4Z 3RZOI 1QVFZ 1LQLA 2DE6A 1YUKA 4Y7NI 4RVDA 3JAMf 3CCM1 2RT9A 4E2XA 4A3II 3GTLI 3GTPI 5A2Qb 4A3EI 4X6AI 3HOUI 3CCMZ 2VUMI 1TWHI 4NB8A 1ML8A 1RO4A 1I50I 5AN9F 3I4NI 1Z01A 4TNUA 4NBBA 3CCS1 1YHQ1 3GTMS 2O4HA 3HOYI 3FQMA 3HKZA 3CQZI 3HOWI 3CCVZ 3ESWA 3CCLZ 3VMGA 2Q51A 3CPWZ 1WCMI 2P28A 3MZLB 2NVQI 3S1RI 1JJ2Y 2QLVB 3J81f 2AKLA 5A2Qf 3PO2I 3CPWY 4BBRI 1VQ61 3NH8A 4A3FI 2R93I 1WIIA 1S721 3RZDI 5IP7I 1WW9A 4DK1A 5D1OB 2LFUA 3HOVI 3G4S1 3VTNA 3IF8A 2RBLA 1VQ91 1RNIA 2V8JA 1N8R1 3CMEZ 1YJ91 5IT9f 3I4MI 3S1NI 5IP9I 1K732 2GTHA 3PO3I 1N8R2 1N2FA 2PMZA 3CCJ1 3CCQZ 3JAMb 1YI21 1YIJ1 4NBHA 3G6EZ 1YIJZ 3CC71 2WAQA 1Y1VS 3CCQ1 3F3FC 1I3QI 1K83I 4HGYA 3K7AI 3NDIA 3D6WA 4A3CI 3HOZI 1KC81 2GTIA 2NVXI 1VQK1 3GTOI 4NBGA 1X3ZA 2YU9I 2R92I 4XX2A 2ZAEB 3GCFA 3GTKI 4A3DI 4MRIA 1X0TA 2VUGA 1KC82 3CXCZ 4BY1I 1VQLZ 1ZH1A 1TWCI 1TWGI 1PFTA 5T67A 4MD8A 4E33A 1P9NA 2B63I 4A3LI 1RQFA 2E2JI 1TFIA 3EEDA 1JWHC 3T4NB 2Y0SA 5C4JI 3M4OI 4NBEA 2V8KA 2R6MA 4E30A 3G71Z 3CCR1 5FLMI 2M48A 4QTUA 2KPIA 4DGLA 1QYPA 1Q7Y1 4BBSI 1DL6A 3F3PC 4HH4A 2E9HA 3VMHA 1VQ8Z 3CXCY 5FLXf 2QRCB 2I3CA 1YHQZ 2P3YA 3I07A 4CL1A 1W2BZ 2JA6I 4EWCA 2E2II 4A93I 2W03A 4RVHA 2JA8I 4E32A 1M1K2 3S2DI 4MD7A 2G2KA 1Q7Y2 1M901 2JUBA 1VLAA 3CC2Z 3S16I 1VQL1 1Q861 2OTJZ 1QF8A 2OTL1 2DE7A 2RIQA 1VQ41 1VQN1 2NVYI 2OOXB 3CCEZ 1VQM1 4E2ZA 4E2YA 1VQ71 4RS4A 3J80b 2W04A 1K8A1 1S7MA 2JMOA 1K731 3FQQA 3OW2Z 3GKQA 4NBFA 4NH1C 1VQO1 1YJW1 4A3MI 2QR1B 2OOYB 2JA7I 3M3YI 4Y52I 2O53A 3GTGI 3I561 2KI7B 1ZB9A 5D1OA 3OW2Y 3J80f 3QWUA 4BXXI 3PO3S 3CCUZ 2RPRA 1Z03A 3S1MI 1M902 3U50C 1VQ9Z 2F4MA 3GTJI 4RVFA 5IT9b 2RHBA 1USPB 5FLXb 3CCU1 1Y1VI 3CMA1 2OTLZ 3S15I 1S72Z 3S2HI 1Q821 1Y1WI 2OTJ1 2K5RA 3TDHB 1VQOZ 3I55Z 4A3KI 3CD61 1RO2A 3IX0A 1KRLA 3J7A4 1VQ51 1YJNZ 3MONA 3Q87A 1R9TI 4MD9A 4NBDA 2VF1A 3NH5A 3CCE1 2LIYA 4RVGA 2OZKA 3CME1 2HU9A 1W2BY 3S1QI 1NJI2 3CC4Z 2EGTA 2QKDA 3CC41 1K8A2 2JA5I 4A3GI 2WB1A 4DQYB 3KIHA 5D1PA 3TE5B 1TWAI 3CC21 3G711 3CCRZ 2QA41 1VQ6Z 1Q812 3BG1B 4NOZA 2BJOA 1KQSZ 2NVTI 3IFUA 1YUAA 2E2HI 5CM2M 2F4OA 3CCL1 4NBAA 3CCV1 3GTMI 1VQ81 1NP6A 4AYBA 3NH4A 3CCSZ 1YITZ 1QVFY 3P5JB 4QTTA 2PK7A 1QVGZ 1VQKZ 4MXUA 1TWFI 4NBCA 3GTQI 2R7ZI 1RLYA 3KIFA 1VQPZ 2YADA 1VQ5Z 3S14I 3VB9A 5C44I 4BY7I 3CD6Z 1M1K1 3FKII 1QVGY 5T64A 1KQSY 3MZKB 4E31A 1X3WA 2J6AA 3G6E1 2QA4Z 2PM9A 2DE5A 3I551 2JS4A 1K9M1 3VMIA 1YI2Z 2M6NA 2Q4ZA 4MONA 1I6HI 4NB9A 1NJI1 3CCJZ 1KD11 4S1TA 3CMAZ 1KD12 5LL6f 3S17I 5C4XI 2QREB 1Q822 3H0GI 2QEX1 1JJ2Z 3J81b 1Q862 1SFOI 1YJN1 2V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 1;  3G4S Z;  1S72 1;  1Q81 1;  1VQN Z;  1YJN Z;  1W2B Z;  1YJW Z;  3G4S 1;  3I56 Z;  3CCE 1;  3CC7 Z;  3CME 1;  1W2B Y;  1VQ9 1;  1M1K 2;  1NJI 2;  1N8R 1;  3CME Z;  1YJ9 1;  3CC4 Z;  3CC4 1;  1Q7Y 2;  1M90 1;  1K8A 2;  3CC2 Z;  1K73 2;  1VQL 1;  1Q86 1;  2OTJ Z;  1VQP 1;  1VQ7 Z;  2OTL 1;  1N8R 2;  3CC2 1;  3G71 1;  3CCR Z;  2QA4 1;  1VQM Z;  1Q81 2;  3CCJ 1;  1K9M 2;  3CCQ Z;  1VQ4 1;  1VQ6 Z;  1VQN 1;  2QEX Z;  1YI2 1;  1YJ9 Z;  1YIJ 1;  1YIT 1;  3G6E Z;  1YIJ Z;  3CC7 1;  1KQS Z;  3CCE Z;  3CCQ 1;  1VQ4 Z;  1VQM 1;  1VQ7 1;  1QVF Z;  1K8A 1;  1K73 1;  3CCL 1;  3CCV 1;  3CCM 1;  1VQ8 1;  3OW2 Z;  1KC8 1;  3CCS Z;  1VQK 1;  1YIT Z;  1VQO 1;  1QVF Y;  1QVG Z;  1VQK Z;  1YJW 1;  3CCM Z;  3I56 1;  1VQP Z;  1VQ5 Z;  1KC8 2;  3OW2 Y;  3CXC Z;  1VQL Z;  3CCU Z;  3CD6 Z;  1M1K 1;  1QVG Y;  1KQS Y;  3CCS 1;  1YHQ 1;  1M90 2;  3G6E 1;  2QA4 Z;  1VQ9 Z;  3CCV Z;  3I55 1;  3CCL Z;  1K9M 1;  3CPW Z;  1YI2 Z;  3CCU 1;  1NJI 1;  3CCJ Z;  1KD1 1;  3G71 Z;  3CCR 1;  3CMA 1;  2OTL Z;  1S72 Z;  1Q82 1;  1JJ2 Y;  2OTJ 1;  3CMA Z;  1KD1 2;  1Q7Y 1;  1Q82 2;  1VQO Z;  3CPW Y;  3I55 Z;  2QEX 1;  1JJ2 Z;  1VQ6 1;  1Q86 2;  3CD6 1;  1VQ8 Z;  3CXC Y;  1YHQ Z;  1YJN 1; 
#chains in the Genus database with same CATH topology
 3G4S Z;  3D2L A;  1Q81 1;  1VQN Z;  4A3B I;  2JNY A;  1NUI A;  1L1O C;  3EER A;  1YJW Z;  3LUS A;  3I56 Z;  1USP A;  3CC7 Z;  3NDJ A;  3BG0 B;  4MH4 A;  2K3R A;  2GU2 A;  3H3V J;  1FDO A;  2IZ3 A;  5T6B A;  4HGZ A;  4A3J I;  2V3V A;  3D9X A;  3NFZ A;  1Z02 A;  4RV9 A;  5C3E I;  1VQP 1;  2HF1 A;  1RO0 A;  1VQ7 Z;  4NFR A;  2JR6 A;  1VQM Z;  1K9M 2;  2QEX Z;  3HOX I;  1YJ9 Z;  1YIT 1;  2IZ4 A;  1ZB8 A;  2H85 A;  2QRD B;  4E2W A;  1VQ4 Z;  3RZO I;  1QVF Z;  1LQL A;  2JIR A;  1WZN A;  2DE6 A;  1YUK A;  4Y7N I;  4RVD A;  3JAM f;  3CCM 1;  2RT9 A;  4E2X A;  4A3I I;  2VPY A;  2LEX A;  3GTL I;  3GTP I;  5A2Q b;  4A3E I;  4X6A I;  3HOU I;  3CCM Z;  2VUM I;  1TWH I;  4NB8 A;  1ML8 A;  1RO4 A;  1I50 I;  5AN9 F;  3I4N I;  1Z01 A;  4TNU A;  4NBB A;  3CCS 1;  1YHQ 1;  3GTM S;  2O4H A;  3HOY I;  3FQM A;  3HKZ A;  3CQZ I;  3HOW I;  3CCV Z;  3ESW A;  3CCL Z;  3VMG A;  2Q51 A;  3CPW Z;  1WCM I;  2P28 A;  3MZL B;  2NVQ I;  3S1R I;  1JJ2 Y;  2QLV B;  3J81 f;  2AKL A;  2E7Z A;  5A2Q f;  3PO2 I;  3CPW Y;  4BBR I;  1VQ6 1;  3NH8 A;  4A3F I;  2R93 I;  1WII A;  1S72 1;  3RZD I;  5IP7 I;  1WW9 A;  4DK1 A;  5D1O B;  2LFU A;  3HOV I;  3G4S 1;  3VTN A;  3IF8 A;  2RBL A;  1VQ9 1;  1RNI A;  2V8J A;  1N8R 1;  3CME Z;  1YJ9 1;  5IT9 f;  3I4M I;  3S1N I;  5IP9 I;  1K73 2;  2GTH A;  3PO3 I;  1N8R 2;  2JIO A;  1N2F A;  2PMZ A;  3CCJ 1;  3CCQ Z;  3JAM b;  1YI2 1;  1YIJ 1;  4NBH A;  3G6E Z;  1YIJ Z;  3CC7 1;  2WAQ A;  1FDI A;  1Y1V S;  2VPW A;  3CCQ 1;  3F3F C;  1I3Q I;  1K83 I;  4HGY A;  3IR7 A;  3K7A I;  3NDI A;  3D6W A;  4A3C I;  3HOZ I;  1KC8 1;  2GTI A;  2NVX I;  1VQK 1;  3GTO I;  4NBG A;  1X3Z A;  2YU9 I;  2R92 I;  4XX2 A;  2ZAE B;  3GCF A;  3GTK I;  4A3D I;  4MRI A;  1X0T A;  2VUG A;  1KC8 2;  3CXC Z;  4BY1 I;  1VQL Z;  1ZH1 A;  1TWC I;  1TWG I;  1PFT A;  5T67 A;  4MD8 A;  4E33 A;  1P9N A;  2B63 I;  4A3L I;  1RQF A;  2E2J I;  1TFI A;  3EED A;  1JWH C;  3T4N B;  2Y0S A;  5C4J I;  3M4O I;  4NBE A;  2V8K A;  2R6M A;  4E30 A;  3G71 Z;  3CCR 1;  5FLM I;  2M48 A;  4QTU A;  2KPI A;  4DGL A;  1QYP A;  1Q7Y 1;  4BBS I;  1DL6 A;  3F3P C;  1AA6 A;  4HH4 A;  2E9H A;  3VMH A;  1VQ8 Z;  3CXC Y;  5FLX f;  2QRC B;  2I3C A;  1YHQ Z;  2P3Y A;  3I07 A;  2JIQ A;  2V45 A;  4CL1 A;  1W2B Z;  2JA6 I;  4EWC A;  2E2I I;  4A93 I;  2JIP A;  2W03 A;  4RVH A;  2JA8 I;  4E32 A;  1M1K 2;  3S2D I;  4MD7 A;  2G2K A;  1Q7Y 2;  1M90 1;  2JUB A;  1VLA A;  3CC2 Z;  3S16 I;  1VQL 1;  1Q86 1;  2OTJ Z;  1QF8 A;  2OTL 1;  2DE7 A;  2RIQ A;  1VQ4 1;  1VQN 1;  2VPZ A;  2NVY I;  2NAP A;  2OOX B;  3CCE Z;  1VQM 1;  4E2Z A;  4E2Y A;  1VQ7 1;  4RS4 A;  3J80 b;  2W04 A;  1K8A 1;  1S7M A;  2JMO A;  1K73 1;  3FQQ A;  3OW2 Z;  3GKQ A;  4NBF A;  4NH1 C;  1QXF A;  1VQO 1;  1YJW 1;  4A3M I;  2QR1 B;  2OOY B;  2JA7 I;  3M3Y I;  4Y52 I;  2O53 A;  3GTG I;  3I56 1;  2KI7 B;  3J80 f;  1ZB9 A;  3OW2 Y;  2JIM A;  5D1O A;  3QWU A;  4BXX I;  3PO3 S;  3CCU Z;  2RPR A;  1Z03 A;  2VPX A;  3S1M I;  1M90 2;  3U50 C;  1VQ9 Z;  2F4M A;  3GTJ I;  4RVF A;  5IT9 b;  2RHB A;  1USP B;  5FLX b;  3CCU 1;  1Y1V I;  3CMA 1;  2OTL Z;  3S15 I;  1S72 Z;  3S2H I;  1Q82 1;  1Y1W I;  2OTJ 1;  2K5R A;  3TDH B;  1VQO Z;  3I55 Z;  4A3K I;  3CD6 1;  1RO2 A;  2IV2 X;  3IX0 A;  1KRL A;  3J7A 4;  1VQ5 1;  2AYD A;  1YJN Z;  3MON A;  3Q87 A;  1R9T I;  4MD9 A;  4NBD A;  2VF1 A;  3NH5 A;  3CCE 1;  2LIY A;  4RVG A;  2OZK A;  3CME 1;  2HU9 A;  1W2B Y;  3S1Q I;  1NJI 2;  3CC4 Z;  2EGT A;  2QKD A;  3CC4 1;  1K8A 2;  2JA5 I;  4A3G I;  2WB1 A;  4DQY B;  3KIH A;  5D1P A;  1Y8C A;  3TE5 B;  1TWA I;  3CC2 1;  3G71 1;  3CCR Z;  2QA4 1;  1VQ6 Z;  1Q81 2;  3BG1 B;  4NOZ A;  2BJO A;  1KQS Z;  2NVT I;  3IFU A;  1YUA A;  2E2H I;  5CM2 M;  2F4O A;  3CCL 1;  4NBA A;  3CCV 1;  1SIW A;  1WJ2 A;  3GTM I;  1VQ8 1;  1NP6 A;  4AYB A;  3NH4 A;  3CCS Z;  1YIT Z;  1QVF Y;  3P5J B;  4QTT A;  2PK7 A;  1QVG Z;  1VQK Z;  4MXU A;  1TWF I;  4NBC A;  3GTQ I;  2R7Z I;  1RLY A;  3KIF A;  1VQP Z;  2YAD A;  1VQ5 Z;  3S14 I;  3VB9 A;  5C44 I;  4BY7 I;  3CD6 Z;  1M1K 1;  3FKI I;  1QVG Y;  5T64 A;  1KQS Y;  3MZK B;  4E31 A;  1X3W A;  2J6A A;  3G6E 1;  2QA4 Z;  2PM9 A;  2DE5 A;  3I55 1;  2JS4 A;  1K9M 1;  3VMI A;  1YI2 Z;  2M6N A;  2Q4Z A;  4MON A;  1I6H I;  4NB9 A;  1NJI 1;  3CCJ Z;  1KD1 1;  4S1T A;  3CMA Z;  1KD1 2;  5LL6 f;  3S17 I;  5C4X I;  2QRE B;  1Q82 2;  1Q16 A;  3H0G I;  2QEX 1;  1JJ2 Z;  3J81 b;  1Q86 2;  1SFO I;  1YJN 1;  2V8I A; 
#chains in the Genus database with same CATH homology
 3G4S Z;  1Q81 1;  1VQN Z;  4A3B I;  2JNY A;  1NUI A;  1L1O C;  3EER A;  1YJW Z;  3LUS A;  3I56 Z;  1USP A;  3CC7 Z;  3NDJ A;  3BG0 B;  4MH4 A;  2K3R A;  2GU2 A;  3H3V J;  2IZ3 A;  5T6B A;  4HGZ A;  4A3J I;  3D9X A;  3NFZ A;  1Z02 A;  4RV9 A;  5C3E I;  1VQP 1;  2HF1 A;  1RO0 A;  1VQ7 Z;  4NFR A;  2JR6 A;  1VQM Z;  1K9M 2;  2QEX Z;  3HOX I;  1YJ9 Z;  1YIT 1;  2IZ4 A;  1ZB8 A;  2H85 A;  2QRD B;  4E2W A;  1VQ4 Z;  3RZO I;  1QVF Z;  1LQL A;  2DE6 A;  1YUK A;  4Y7N I;  4RVD A;  3JAM f;  3CCM 1;  2RT9 A;  4E2X A;  4A3I I;  3GTL I;  3GTP I;  5A2Q b;  4A3E I;  4X6A I;  3HOU I;  3CCM Z;  2VUM I;  1TWH I;  4NB8 A;  1ML8 A;  1RO4 A;  1I50 I;  5AN9 F;  3I4N I;  1Z01 A;  4TNU A;  4NBB A;  3CCS 1;  1YHQ 1;  3GTM S;  2O4H A;  3HOY I;  3FQM A;  3HKZ A;  3CQZ I;  3HOW I;  3CCV Z;  3ESW A;  3CCL Z;  3VMG A;  2Q51 A;  3CPW Z;  1WCM I;  2P28 A;  3MZL B;  2NVQ I;  3S1R I;  1JJ2 Y;  2QLV B;  3J81 f;  2AKL A;  5A2Q f;  3PO2 I;  3CPW Y;  4BBR I;  1VQ6 1;  3NH8 A;  4A3F I;  2R93 I;  1WII A;  1S72 1;  3RZD I;  5IP7 I;  1WW9 A;  4DK1 A;  5D1O B;  2LFU A;  3HOV I;  3G4S 1;  3VTN A;  3IF8 A;  2RBL A;  1VQ9 1;  1RNI A;  2V8J A;  1N8R 1;  3CME Z;  1YJ9 1;  5IT9 f;  3I4M I;  3S1N I;  5IP9 I;  1K73 2;  2GTH A;  3PO3 I;  1N8R 2;  1N2F A;  2PMZ A;  3CCJ 1;  3CCQ Z;  3JAM b;  1YI2 1;  1YIJ 1;  4NBH A;  3G6E Z;  1YIJ Z;  3CC7 1;  2WAQ A;  1Y1V S;  3CCQ 1;  3F3F C;  1I3Q I;  1K83 I;  4HGY A;  3K7A I;  3NDI A;  3D6W A;  4A3C I;  3HOZ I;  1KC8 1;  2GTI A;  2NVX I;  1VQK 1;  3GTO I;  4NBG A;  1X3Z A;  2YU9 I;  2R92 I;  4XX2 A;  2ZAE B;  3GCF A;  3GTK I;  4A3D I;  4MRI A;  1X0T A;  2VUG A;  1KC8 2;  3CXC Z;  4BY1 I;  1VQL Z;  1ZH1 A;  1TWC I;  1TWG I;  1PFT A;  5T67 A;  4MD8 A;  4E33 A;  1P9N A;  2B63 I;  4A3L I;  1RQF A;  2E2J I;  1TFI A;  3EED A;  1JWH C;  3T4N B;  2Y0S A;  5C4J I;  3M4O I;  4NBE A;  2V8K A;  2R6M A;  4E30 A;  3G71 Z;  3CCR 1;  5FLM I;  2M48 A;  4QTU A;  2KPI A;  4DGL A;  1QYP A;  1Q7Y 1;  4BBS I;  1DL6 A;  3F3P C;  4HH4 A;  2E9H A;  3VMH A;  1VQ8 Z;  3CXC Y;  5FLX f;  2QRC B;  2I3C A;  1YHQ Z;  2P3Y A;  3I07 A;  4CL1 A;  1W2B Z;  2JA6 I;  4EWC A;  2E2I I;  4A93 I;  2W03 A;  4RVH A;  2JA8 I;  4E32 A;  1M1K 2;  3S2D I;  4MD7 A;  2G2K A;  1Q7Y 2;  1M90 1;  2JUB A;  1VLA A;  3CC2 Z;  3S16 I;  1VQL 1;  1Q86 1;  2OTJ Z;  1QF8 A;  2OTL 1;  2DE7 A;  2RIQ A;  1VQ4 1;  1VQN 1;  2NVY I;  2OOX B;  3CCE Z;  1VQM 1;  4E2Z A;  4E2Y A;  1VQ7 1;  4RS4 A;  3J80 b;  2W04 A;  1K8A 1;  1S7M A;  2JMO A;  1K73 1;  3FQQ A;  3OW2 Z;  3GKQ A;  4NBF A;  4NH1 C;  1VQO 1;  1YJW 1;  4A3M I;  2QR1 B;  2OOY B;  2JA7 I;  3M3Y I;  4Y52 I;  2O53 A;  3GTG I;  3I56 1;  2KI7 B;  1ZB9 A;  5D1O A;  3OW2 Y;  3J80 f;  3QWU A;  4BXX I;  3PO3 S;  3CCU Z;  2RPR A;  1Z03 A;  3S1M I;  1M90 2;  3U50 C;  1VQ9 Z;  2F4M A;  3GTJ I;  4RVF A;  5IT9 b;  2RHB A;  1USP B;  5FLX b;  3CCU 1;  1Y1V I;  3CMA 1;  2OTL Z;  3S15 I;  1S72 Z;  3S2H I;  1Q82 1;  1Y1W I;  2OTJ 1;  2K5R A;  3TDH B;  1VQO Z;  3I55 Z;  4A3K I;  3CD6 1;  1RO2 A;  3IX0 A;  1KRL A;  3J7A 4;  1VQ5 1;  1YJN Z;  3MON A;  3Q87 A;  1R9T I;  4MD9 A;  4NBD A;  2VF1 A;  3NH5 A;  3CCE 1;  2LIY A;  4RVG A;  2OZK A;  3CME 1;  2HU9 A;  1W2B Y;  3S1Q I;  1NJI 2;  3CC4 Z;  2EGT A;  2QKD A;  3CC4 1;  1K8A 2;  2JA5 I;  4A3G I;  2WB1 A;  4DQY B;  3KIH A;  5D1P A;  3TE5 B;  1TWA I;  3CC2 1;  3G71 1;  3CCR Z;  2QA4 1;  1VQ6 Z;  1Q81 2;  3BG1 B;  4NOZ A;  2BJO A;  1KQS Z;  2NVT I;  3IFU A;  1YUA A;  2E2H I;  5CM2 M;  2F4O A;  3CCL 1;  4NBA A;  3CCV 1;  3GTM I;  1VQ8 1;  1NP6 A;  4AYB A;  3NH4 A;  3CCS Z;  1YIT Z;  1QVF Y;  3P5J B;  4QTT A;  2PK7 A;  1QVG Z;  1VQK Z;  4MXU A;  1TWF I;  4NBC A;  3GTQ I;  2R7Z I;  1RLY A;  3KIF A;  1VQP Z;  2YAD A;  1VQ5 Z;  3S14 I;  3VB9 A;  5C44 I;  4BY7 I;  3CD6 Z;  1M1K 1;  3FKI I;  1QVG Y;  5T64 A;  1KQS Y;  3MZK B;  4E31 A;  1X3W A;  2J6A A;  3G6E 1;  2QA4 Z;  2PM9 A;  2DE5 A;  3I55 1;  2JS4 A;  1K9M 1;  3VMI A;  1YI2 Z;  2M6N A;  2Q4Z A;  4MON A;  1I6H I;  4NB9 A;  1NJI 1;  3CCJ Z;  1KD1 1;  4S1T A;  3CMA Z;  1KD1 2;  5LL6 f;  3S17 I;  5C4X I;  2QRE B;  1Q82 2;  3H0G I;  2QEX 1;  1JJ2 Z;  3J81 b;  1Q86 2;  1SFO I;  1YJN 1;  2V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...