1YI2Z

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2Z00
1YI2Z 1YJW1 1YJN1 1VQK1 3CCSZ 1VQ5Z 1Q861 2QA41 1N8R2 2OTJ1 3G6EZ 1JJ2Y 3CD61 1VQ91 3I561 3CCR1 1KD11 1VQ4Z 3OW2Z 1Q821 1M902 1QVGY 1W2BZ 1VQOZ 1KD12 3CCJZ 3G711 3CME1 1YIJZ 1Q822 3CCL1 1VQL1 1YHQ1 3CCUZ 1M1K2 2OTL1 1YI21 3CCM1 3CCS1 3CCQZ 1VQ51 1Q7Y1 3CCVZ 1K9M1 1NJI1 3CXCY 3CCEZ 1VQMZ 3CMAZ 1KC81 1Q862 1JJ2Z 3I551 3CC7Z 1VQ8Z 1VQO1 1NJI2 1VQPZ 1K731 1YIJ1 3CCU1 3CC2Z 1KQSZ 1YITZ 3CCQ1 1VQ7Z 1YJWZ 1VQKZ 1QVFY 1S72Z 3G6E1 2QEXZ 3CPWZ 3CD6Z 1W2BY 3CCRZ 1VQM1 1VQ41 1Q7Y2 1VQ6Z 3CC71 1K9M2 1VQP1 1YJ9Z 1N8R1 3CCJ1 3G71Z 1VQNZ 3G4SZ 1YHQZ 1VQLZ 1KC82 3CC4Z 1QVGZ 1VQ71 3CCMZ 1YJNZ 1S721 1Q811 1M901 3CCV1 3OW2Y 2QEX1 1K732 2QA4Z 2OTJZ 1VQ9Z 3I56Z 1QVFZ 1VQ61 3CCE1 1Q812 3CMA1 1K8A1 1M1K1 3I55Z 1KQSY 1VQ81 3CXCZ 1YJ91 1VQN1 3G4S1 1K8A2 3CMEZ 3CC41 3CPWY 3CCLZ 3CC21 1YIT1 2OTLZ
chains in the Genus database with same CATH superfamily
1YJW1 3CCSZ 1VQ5Z 1N8R2 4A3GI 1X3ZA 2HF1A 1JJ2Y 2Y0SA 3HOWI 3S14I 4TNUA 4BY7I 4E31A 4DK1A 4MXUA 4MD8A 2Q4ZA 2IV2X 4A3LI 1KD12 2E7ZA 2F4MA 3CCJZ 2YADA 3CME1 2OOXB 3CCL1 1YHQ1 3CCUZ 2O53A 3CCQZ 3CCS1 1VQ51 3S1QI 1RO4A 1K9M1 4EWCA 1X0TA 4BBSI 2F4OA 2BJOA 1I3QI 3GTMS 2W03A 1WZNA 3CCEZ 2GU2A 3CC7Z 4A3KI 3S16I 1NJI2 4A3DI 4MRIA 1VLAA 3S1RI 3GTLI 3I07A 3CCU1 3CCQ1 2QRDB 5D1OB 1QVFY 3HOUI 4A3CI 1WCMI 1K83I 3H3VJ 3IF8A 3H0GI 4MD9A 1AA6A 3NH5A 3CC71 3NDIA 3GTGI 1YJ9Z 1N8R1 2R93I 1PFTA 3J81f 2R92I 2P3YA 4NBEA 5LL6f 4NFRA 2QKDA 3VMGA 1K732 4A3II 2RBLA 2QA4Z 3GTKI 4BY1I 2DE6A 3I56Z 1K8A1 2V3VA 5D1OA 2LIYA 2NVTI 1NP6A 1QXFA 1TWGI 1YJ91 2QREB 3HOVI 4RVDA 2DE5A 1YI2Z 1TFIA 1Z02A 2I3CA 2JIMA 4NB8A 2JA7I 2QA41 3G6EZ 3I561 3CCR1 4E33A 4NBFA 3LUSA 3MZLB 3OW2Z 2OOYB 1YUAA 3IX0A 5C44I 1M902 2KPIA 1QYPA 1WJ2A 1QVGY 3M3YI 3U50C 1W2BZ 1ML8A 4DGLA 5C3EI 4HGYA 1SIWA 3G711 1YIJZ 1Q822 3MONA 3J80b 1TWFI 1M1K2 1YI21 5A2Qb 3CCVZ 4CL1A 1L1OC 2V8KA 3CXCY 3S1MI 2G2KA 1Q862 1JJ2Z 2IZ4A 3MZKB 4NBBA 3I551 1VQ8Z 1R9TI 2V45A 2JIRA 2JA6I 1K731 1YIJ1 3VB9A 4RS4A 3HOZI 2W04A 1YITZ 3J81b 2YU9I 3GKQA 1VQKZ 2HU9A 3VMHA 3PO3S 1S72Z 4AYBA 4MD7A 2JMOA 4NOZA 3QWUA 3CD6Z 1Z03A 4NH1C 4NBAA 3TDHB 3Q87A 1Q7Y2 3F3PC 2ZAEB 1Y1VI 3HOXI 2WB1A 3BG1B 2RHBA 3TE5B 3CCJ1 3J80f 2KI7B 4A3FI 2JS4A 1VQLZ 2RIQA 1KC82 5A2Qf 3F3FC 3CCMZ 5FLMI 1Z01A 2WAQA 1YJNZ 1S721 1Q811 1M901 1I50I 5T6BA 2NVXI 3FKII 4XX2A 2AKLA 3S2DI 1QVFZ 3CCE1 4A93I 2V8IA 1ZB8A 1M1K1 3T4NB 2IZ3A 3HKZA 3NH8A 4RVGA 4E2WA 4DQYB 5T67A 4A3JI 2OTLZ 4E30A 1YJN1 2K5RA 2OZKA 3I4NI 2QLVB 1Q861 4RVFA 2JIOA 2LEXA 4S1TA 1KD11 1VQ4Z 4NBCA 1X3WA 2PK7A 3GTMI 3J7A4 2OTL1 1N2FA 3D9XA 1Q7Y1 3M4OI 1USPB 3I4MI 1KRLA 1LQLA 3S1NI 5D1PA 1NJI1 3JAMb 2O4HA 5T64A 4E2ZA 3CMAZ 1KC81 3FQQA 5C4JI 2GTHA 4HH4A 1VQPZ 5IT9b 1WIIA 3P5JB 2R7ZI 3CC2Z 1KQSZ 2VUGA 4RVHA 5IP7I 1VQ7Z 1YJWZ 3RZDI 4A3EI 3G6E1 3CPWZ 3NFZA 2RT9A 3CQZI 4NBGA 1RNIA 1W2BY 4NBHA 2AYDA 1P9NA 1QF8A 1USPA 1VQP1 1RLYA 1FDOA 4MONA 3GTQI 2V8JA 1Y1WI 3IR7A 1VQNZ 3BG0B 3K7AI 1YHQZ 1VQ71 4A3MI 3CCV1 2OTJZ 3EEDA 2GTIA 3JAMf 4BBRI 1VQ9Z 1TWCI 4E32A 5C4XI 4A3BI 4RV9A 5IT9f 1VQ81 4QTTA 4BXXI 3GTPI 1VQN1 3EERA 2K3RA 1K8A2 3VMIA 1YIT1 5FLXb 1VQK1 2PM9A 3GTOI 2P28A 2OTJ1 1FDIA 3KIHA 3CD61 1VQ91 1SFOI 4X6AI 1WW9A 2JA5I 1Q821 2Q51A 3S2HI 2NVQI 1Q16A 2R6MA 3D6WA 2VPZA 2J6AA 1VQOZ 4QTUA 1Y8CA 2H85A 1VQL1 3CCM1 3D2LA 3PO2I 2M48A 3S15I 1TWAI 4Y7NI 3S17I 2B63I 3GCFA 1ZH1A 4MH4A 3NH4A 3PO3I 2E2HI 1VQMZ 1DL6A 2JUBA 1ZB9A 1VQO1 1I6HI 3VTNA 2VF1A 2VPYA 1JWHC 5FLXf 2VUMI 2PMZA 2QEXZ 3RZOI 1S7MA 1RQFA 1RO2A 3IFUA 3CCRZ 4NB9A 4HGZA 1VQM1 1VQ41 1TWHI 2JIQA 1VQ6Z 2RPRA 1RO0A 1K9M2 3NDJA 2LFUA 1NUIA 2M6NA 4NBDA 3ESWA 5CM2M 3G71Z 3FQMA 3KIFA 3G4SZ 3CC4Z 2EGTA 1QVGZ 2JR6A 5AN9F 2QR1B 2JIPA 2E2JI 2NAPA 3OW2Y 2QEX1 2E9HA 3HOYI 1Y1VS 5IP9I 1YUKA 2DE7A 1VQ61 1Q812 4E2YA 3CMA1 2E2II 3I55Z 1KQSY 4Y52I 3CXCZ 2NVYI 2JA8I 3GTJI 4E2XA 3G4S1 2VPWA 2VPXA 3CMEZ 2QRCB 3CC41 3CPWY 3CCLZ 3CC21 2JNYA
chains in the Genus database with same CATH topology
1YJW1 3CCSZ 1VQ5Z 1N8R2 4A3GI 1X3ZA 2HF1A 1JJ2Y 2Y0SA 3HOWI 3S14I 4TNUA 4BY7I 4E31A 4DK1A 4MXUA 4MD8A 2Q4ZA 4A3LI 1KD12 2F4MA 3CCJZ 2YADA 3CME1 2OOXB 3CCL1 1YHQ1 3CCUZ 2O53A 3CCQZ 3CCS1 1VQ51 3S1QI 1RO4A 1K9M1 4EWCA 1X0TA 4BBSI 2F4OA 2BJOA 1I3QI 3GTMS 2W03A 3CCEZ 2GU2A 3CC7Z 4A3KI 3S16I 1NJI2 4A3DI 4MRIA 1VLAA 3S1RI 3GTLI 3I07A 3CCU1 3CCQ1 2QRDB 5D1OB 1QVFY 3HOUI 4A3CI 1WCMI 1K83I 3H3VJ 3IF8A 3H0GI 4MD9A 3NH5A 3CC71 3NDIA 3GTGI 1YJ9Z 1N8R1 2R93I 1PFTA 3J81f 2R92I 2P3YA 4NBEA 5LL6f 4NFRA 2QKDA 3VMGA 1K732 4A3II 2RBLA 2QA4Z 3GTKI 4BY1I 2DE6A 3I56Z 1K8A1 5D1OA 2LIYA 2NVTI 1NP6A 1TWGI 1YJ91 2QREB 3HOVI 4RVDA 2DE5A 1YI2Z 1TFIA 1Z02A 2I3CA 4NB8A 2JA7I 2QA41 3G6EZ 3I561 3CCR1 4E33A 4NBFA 3LUSA 3MZLB 3OW2Z 2OOYB 1YUAA 3IX0A 5C44I 1M902 2KPIA 1QYPA 1QVGY 3M3YI 3U50C 1W2BZ 1ML8A 4DGLA 5C3EI 4HGYA 3G711 1YIJZ 1Q822 3MONA 3J80b 1TWFI 1M1K2 1YI21 5A2Qb 3CCVZ 4CL1A 1L1OC 2V8KA 3CXCY 3S1MI 2G2KA 1Q862 1JJ2Z 2IZ4A 3MZKB 4NBBA 3I551 1VQ8Z 1R9TI 2JA6I 1K731 1YIJ1 3VB9A 4RS4A 3HOZI 2W04A 1YITZ 3J81b 2YU9I 3GKQA 1VQKZ 2HU9A 3VMHA 3PO3S 1S72Z 4AYBA 4MD7A 2JMOA 4NOZA 3QWUA 3CD6Z 1Z03A 4NBAA 4NH1C 3TDHB 3Q87A 1Q7Y2 3F3PC 2ZAEB 1Y1VI 3HOXI 2WB1A 3BG1B 2RHBA 3TE5B 3CCJ1 3J80f 2KI7B 4A3FI 2JS4A 1VQLZ 2RIQA 1KC82 5A2Qf 3F3FC 3CCMZ 5FLMI 1Z01A 2WAQA 1YJNZ 1S721 1Q811 1M901 1I50I 5T6BA 2NVXI 3FKII 4XX2A 2AKLA 3S2DI 1QVFZ 3CCE1 4A93I 2V8IA 1ZB8A 1M1K1 3T4NB 2IZ3A 3HKZA 3NH8A 4RVGA 4E2WA 4DQYB 5T67A 4A3JI 2OTLZ 4E30A 1YJN1 2K5RA 2OZKA 3I4NI 2QLVB 1Q861 4RVFA 4S1TA 1KD11 1VQ4Z 4NBCA 1X3WA 2PK7A 3GTMI 3J7A4 2OTL1 1N2FA 3D9XA 1Q7Y1 3M4OI 1USPB 3I4MI 1KRLA 1LQLA 3S1NI 5D1PA 1NJI1 3JAMb 2O4HA 5T64A 4E2ZA 3CMAZ 1KC81 3FQQA 5C4JI 2GTHA 4HH4A 1VQPZ 5IT9b 1WIIA 3P5JB 2R7ZI 3CC2Z 1KQSZ 2VUGA 4RVHA 5IP7I 1VQ7Z 1YJWZ 3RZDI 4A3EI 3G6E1 3CPWZ 3NFZA 2RT9A 3CQZI 4NBGA 1RNIA 1W2BY 4NBHA 1P9NA 1QF8A 1USPA 1VQP1 1RLYA 4MONA 3GTQI 2V8JA 1Y1WI 1VQNZ 3BG0B 3K7AI 1YHQZ 1VQ71 4A3MI 3CCV1 2OTJZ 3EEDA 2GTIA 3JAMf 4BBRI 1VQ9Z 1TWCI 4E32A 5C4XI 4A3BI 4RV9A 5IT9f 1VQ81 4QTTA 4BXXI 3GTPI 1VQN1 3EERA 2K3RA 1K8A2 3VMIA 1YIT1 5FLXb 1VQK1 2PM9A 3GTOI 2P28A 2OTJ1 3KIHA 3CD61 1VQ91 1SFOI 4X6AI 1WW9A 2JA5I 1Q821 2Q51A 3S2HI 2NVQI 2R6MA 3D6WA 2J6AA 1VQOZ 4QTUA 2H85A 1VQL1 3CCM1 3PO2I 2M48A 3S15I 1TWAI 4Y7NI 3S17I 2B63I 3GCFA 1ZH1A 4MH4A 3NH4A 3PO3I 2E2HI 1VQMZ 1DL6A 2JUBA 1ZB9A 1VQO1 1I6HI 3VTNA 2VF1A 1JWHC 5FLXf 2VUMI 2PMZA 2QEXZ 3RZOI 1S7MA 1RQFA 1RO2A 3IFUA 3CCRZ 4NB9A 4HGZA 1VQM1 1VQ41 1TWHI 1VQ6Z 2RPRA 1RO0A 1K9M2 3NDJA 2LFUA 1NUIA 2M6NA 4NBDA 3ESWA 5CM2M 3G71Z 3FQMA 3KIFA 3G4SZ 3CC4Z 2EGTA 1QVGZ 2JR6A 5AN9F 2QR1B 2E2JI 3OW2Y 2QEX1 2E9HA 3HOYI 1Y1VS 5IP9I 1YUKA 2DE7A 1VQ61 1Q812 4E2YA 3CMA1 2E2II 3I55Z 1KQSY 4Y52I 3CXCZ 2NVYI 2JA8I 3GTJI 4E2XA 3G4S1 3CMEZ 2QRCB 3CC41 3CPWY 3CCLZ 3CC21 2JNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Z;  1YJW 1;  1YJN 1;  1VQK 1;  3CCS Z;  1VQ5 Z;  1Q86 1;  2QA4 1;  1N8R 2;  2OTJ 1;  3G6E Z;  1JJ2 Y;  3CD6 1;  1VQ9 1;  3I56 1;  3CCR 1;  1KD1 1;  1VQ4 Z;  3OW2 Z;  1Q82 1;  1M90 2;  1QVG Y;  1W2B Z;  1VQO Z;  1KD1 2;  3CCJ Z;  3G71 1;  3CME 1;  1YIJ Z;  1Q82 2;  3CCL 1;  1VQL 1;  1YHQ 1;  3CCU Z;  1M1K 2;  2OTL 1;  1YI2 1;  3CCM 1;  3CCS 1;  3CCQ Z;  1VQ5 1;  1Q7Y 1;  3CCV Z;  1K9M 1;  1NJI 1;  3CXC Y;  3CCE Z;  1VQM Z;  3CMA Z;  1KC8 1;  1Q86 2;  1JJ2 Z;  3I55 1;  3CC7 Z;  1VQ8 Z;  1VQO 1;  1NJI 2;  1VQP Z;  1K73 1;  1YIJ 1;  3CCU 1;  3CC2 Z;  1KQS Z;  1YIT Z;  3CCQ 1;  1VQ7 Z;  1YJW Z;  1VQK Z;  1QVF Y;  1S72 Z;  3G6E 1;  2QEX Z;  3CPW Z;  3CD6 Z;  1W2B Y;  3CCR Z;  1VQM 1;  1VQ4 1;  1Q7Y 2;  1VQ6 Z;  3CC7 1;  1K9M 2;  1VQP 1;  1YJ9 Z;  1N8R 1;  3CCJ 1;  3G71 Z;  1VQN Z;  3G4S Z;  1YHQ Z;  1VQL Z;  1KC8 2;  3CC4 Z;  1QVG Z;  1VQ7 1;  3CCM Z;  1YJN Z;  1S72 1;  1Q81 1;  1M90 1;  3CCV 1;  3OW2 Y;  2QEX 1;  1K73 2;  2QA4 Z;  2OTJ Z;  1VQ9 Z;  3I56 Z;  1QVF Z;  1VQ6 1;  3CCE 1;  1Q81 2;  3CMA 1;  1K8A 1;  1M1K 1;  3I55 Z;  1KQS Y;  1VQ8 1;  3CXC Z;  1YJ9 1;  1VQN 1;  3G4S 1;  1K8A 2;  3CME Z;  3CC4 1;  3CPW Y;  3CCL Z;  3CC2 1;  1YIT 1;  2OTL Z; 
#chains in the Genus database with same CATH topology
 1YJW 1;  3CCS Z;  1VQ5 Z;  1N8R 2;  4A3G I;  1X3Z A;  2HF1 A;  1JJ2 Y;  2Y0S A;  3HOW I;  3S14 I;  4TNU A;  4BY7 I;  4E31 A;  4DK1 A;  4MXU A;  4MD8 A;  2Q4Z A;  2IV2 X;  4A3L I;  1KD1 2;  2E7Z A;  2F4M A;  3CCJ Z;  2YAD A;  3CME 1;  2OOX B;  3CCL 1;  1YHQ 1;  3CCU Z;  2O53 A;  3CCQ Z;  3CCS 1;  1VQ5 1;  3S1Q I;  1RO4 A;  1K9M 1;  4EWC A;  1X0T A;  4BBS I;  2F4O A;  2BJO A;  1I3Q I;  3GTM S;  2W03 A;  1WZN A;  3CCE Z;  2GU2 A;  3CC7 Z;  4A3K I;  3S16 I;  1NJI 2;  4A3D I;  4MRI A;  1VLA A;  3S1R I;  3GTL I;  3I07 A;  3CCU 1;  3CCQ 1;  2QRD B;  5D1O B;  1QVF Y;  3HOU I;  4A3C I;  1WCM I;  1K83 I;  3H3V J;  3IF8 A;  3H0G I;  4MD9 A;  1AA6 A;  3NH5 A;  3CC7 1;  3NDI A;  3GTG I;  1YJ9 Z;  1N8R 1;  2R93 I;  1PFT A;  3J81 f;  2R92 I;  2P3Y A;  4NBE A;  5LL6 f;  4NFR A;  2QKD A;  3VMG A;  1K73 2;  4A3I I;  2RBL A;  2QA4 Z;  3GTK I;  4BY1 I;  2DE6 A;  3I56 Z;  1K8A 1;  2V3V A;  5D1O A;  2LIY A;  2NVT I;  1NP6 A;  1QXF A;  1TWG I;  1YJ9 1;  2QRE B;  3HOV I;  4RVD A;  2DE5 A;  1YI2 Z;  1TFI A;  1Z02 A;  2I3C A;  2JIM A;  4NB8 A;  2JA7 I;  2QA4 1;  3G6E Z;  3I56 1;  3CCR 1;  4E33 A;  4NBF A;  3LUS A;  3MZL B;  3OW2 Z;  2OOY B;  1YUA A;  3IX0 A;  5C44 I;  1M90 2;  2KPI A;  1QYP A;  1WJ2 A;  1QVG Y;  3M3Y I;  3U50 C;  1W2B Z;  1ML8 A;  4DGL A;  5C3E I;  4HGY A;  1SIW A;  3G71 1;  1YIJ Z;  1Q82 2;  3MON A;  3J80 b;  1TWF I;  1M1K 2;  1YI2 1;  5A2Q b;  3CCV Z;  4CL1 A;  1L1O C;  2V8K A;  3CXC Y;  3S1M I;  2G2K A;  1Q86 2;  1JJ2 Z;  2IZ4 A;  3MZK B;  4NBB A;  3I55 1;  1VQ8 Z;  1R9T I;  2V45 A;  2JIR A;  2JA6 I;  1K73 1;  1YIJ 1;  3VB9 A;  4RS4 A;  3HOZ I;  2W04 A;  1YIT Z;  3J81 b;  2YU9 I;  3GKQ A;  1VQK Z;  2HU9 A;  3VMH A;  3PO3 S;  1S72 Z;  4AYB A;  4MD7 A;  2JMO A;  4NOZ A;  3QWU A;  3CD6 Z;  1Z03 A;  4NH1 C;  4NBA A;  3TDH B;  3Q87 A;  1Q7Y 2;  3F3P C;  2ZAE B;  1Y1V I;  3HOX I;  2WB1 A;  3BG1 B;  2RHB A;  3TE5 B;  3CCJ 1;  3J80 f;  2KI7 B;  4A3F I;  2JS4 A;  1VQL Z;  2RIQ A;  1KC8 2;  5A2Q f;  3F3F C;  3CCM Z;  5FLM I;  1Z01 A;  2WAQ A;  1YJN Z;  1S72 1;  1Q81 1;  1M90 1;  1I50 I;  5T6B A;  2NVX I;  3FKI I;  4XX2 A;  2AKL A;  3S2D I;  1QVF Z;  3CCE 1;  4A93 I;  2V8I A;  1ZB8 A;  1M1K 1;  3T4N B;  2IZ3 A;  3HKZ A;  3NH8 A;  4RVG A;  4E2W A;  4DQY B;  5T67 A;  4A3J I;  2OTL Z;  4E30 A;  1YJN 1;  2K5R A;  2OZK A;  3I4N I;  2QLV B;  1Q86 1;  4RVF A;  2JIO A;  2LEX A;  4S1T A;  1KD1 1;  1VQ4 Z;  4NBC A;  1X3W A;  2PK7 A;  3GTM I;  3J7A 4;  2OTL 1;  1N2F A;  3D9X A;  1Q7Y 1;  3M4O I;  1USP B;  3I4M I;  1KRL A;  1LQL A;  3S1N I;  5D1P A;  1NJI 1;  3JAM b;  2O4H A;  5T64 A;  4E2Z A;  3CMA Z;  1KC8 1;  3FQQ A;  5C4J I;  2GTH A;  4HH4 A;  1VQP Z;  5IT9 b;  1WII A;  3P5J B;  2R7Z I;  3CC2 Z;  1KQS Z;  2VUG A;  4RVH A;  5IP7 I;  1VQ7 Z;  1YJW Z;  3RZD I;  4A3E I;  3G6E 1;  3CPW Z;  3NFZ A;  2RT9 A;  3CQZ I;  4NBG A;  1RNI A;  1W2B Y;  4NBH A;  2AYD A;  1P9N A;  1QF8 A;  1USP A;  1VQP 1;  1RLY A;  1FDO A;  4MON A;  3GTQ I;  2V8J A;  1Y1W I;  3IR7 A;  1VQN Z;  3BG0 B;  3K7A I;  1YHQ Z;  1VQ7 1;  4A3M I;  3CCV 1;  2OTJ Z;  3EED A;  2GTI A;  3JAM f;  4BBR I;  1VQ9 Z;  1TWC I;  4E32 A;  5C4X I;  4A3B I;  4RV9 A;  5IT9 f;  1VQ8 1;  4QTT A;  4BXX I;  3GTP I;  1VQN 1;  3EER A;  2K3R A;  1K8A 2;  3VMI A;  1YIT 1;  5FLX b;  1VQK 1;  2PM9 A;  3GTO I;  2P28 A;  2OTJ 1;  1FDI A;  3KIH A;  3CD6 1;  1VQ9 1;  1SFO I;  4X6A I;  1WW9 A;  2JA5 I;  1Q82 1;  2Q51 A;  3S2H I;  2NVQ I;  1Q16 A;  2R6M A;  3D6W A;  2VPZ A;  2J6A A;  1VQO Z;  4QTU A;  1Y8C A;  2H85 A;  1VQL 1;  3CCM 1;  3D2L A;  3PO2 I;  2M48 A;  3S15 I;  1TWA I;  4Y7N I;  3S17 I;  2B63 I;  3GCF A;  1ZH1 A;  4MH4 A;  3NH4 A;  3PO3 I;  2E2H I;  1VQM Z;  1DL6 A;  2JUB A;  1ZB9 A;  1VQO 1;  1I6H I;  3VTN A;  2VF1 A;  2VPY A;  1JWH C;  5FLX f;  2VUM I;  2PMZ A;  2QEX Z;  3RZO I;  1S7M A;  1RQF A;  1RO2 A;  3IFU A;  3CCR Z;  4NB9 A;  4HGZ A;  1VQM 1;  1VQ4 1;  1TWH I;  2JIQ A;  1VQ6 Z;  2RPR A;  1RO0 A;  1K9M 2;  3NDJ A;  2LFU A;  1NUI A;  2M6N A;  4NBD A;  3ESW A;  5CM2 M;  3G71 Z;  3FQM A;  3KIF A;  3G4S Z;  3CC4 Z;  2EGT A;  1QVG Z;  2JR6 A;  5AN9 F;  2QR1 B;  2JIP A;  2E2J I;  2NAP A;  3OW2 Y;  2QEX 1;  2E9H A;  3HOY I;  1Y1V S;  5IP9 I;  1YUK A;  2DE7 A;  1VQ6 1;  1Q81 2;  4E2Y A;  3CMA 1;  2E2I I;  3I55 Z;  1KQS Y;  4Y52 I;  3CXC Z;  2NVY I;  2JA8 I;  3GTJ I;  4E2X A;  3G4S 1;  2VPW A;  2VPX A;  3CME Z;  2QRC B;  3CC4 1;  3CPW Y;  3CCL Z;  3CC2 1;  2JNY A; 
#chains in the Genus database with same CATH homology
 1YJW 1;  3CCS Z;  1VQ5 Z;  1N8R 2;  4A3G I;  1X3Z A;  2HF1 A;  1JJ2 Y;  2Y0S A;  3HOW I;  3S14 I;  4TNU A;  4BY7 I;  4E31 A;  4DK1 A;  4MXU A;  4MD8 A;  2Q4Z A;  4A3L I;  1KD1 2;  2F4M A;  3CCJ Z;  2YAD A;  3CME 1;  2OOX B;  3CCL 1;  1YHQ 1;  3CCU Z;  2O53 A;  3CCQ Z;  3CCS 1;  1VQ5 1;  3S1Q I;  1RO4 A;  1K9M 1;  4EWC A;  1X0T A;  4BBS I;  2F4O A;  2BJO A;  1I3Q I;  3GTM S;  2W03 A;  3CCE Z;  2GU2 A;  3CC7 Z;  4A3K I;  3S16 I;  1NJI 2;  4A3D I;  4MRI A;  1VLA A;  3S1R I;  3GTL I;  3I07 A;  3CCU 1;  3CCQ 1;  2QRD B;  5D1O B;  1QVF Y;  3HOU I;  4A3C I;  1WCM I;  1K83 I;  3H3V J;  3IF8 A;  3H0G I;  4MD9 A;  3NH5 A;  3CC7 1;  3NDI A;  3GTG I;  1YJ9 Z;  1N8R 1;  2R93 I;  1PFT A;  3J81 f;  2R92 I;  2P3Y A;  4NBE A;  5LL6 f;  4NFR A;  2QKD A;  3VMG A;  1K73 2;  4A3I I;  2RBL A;  2QA4 Z;  3GTK I;  4BY1 I;  2DE6 A;  3I56 Z;  1K8A 1;  5D1O A;  2LIY A;  2NVT I;  1NP6 A;  1TWG I;  1YJ9 1;  2QRE B;  3HOV I;  4RVD A;  2DE5 A;  1YI2 Z;  1TFI A;  1Z02 A;  2I3C A;  4NB8 A;  2JA7 I;  2QA4 1;  3G6E Z;  3I56 1;  3CCR 1;  4E33 A;  4NBF A;  3LUS A;  3MZL B;  3OW2 Z;  2OOY B;  1YUA A;  3IX0 A;  5C44 I;  1M90 2;  2KPI A;  1QYP A;  1QVG Y;  3M3Y I;  3U50 C;  1W2B Z;  1ML8 A;  4DGL A;  5C3E I;  4HGY A;  3G71 1;  1YIJ Z;  1Q82 2;  3MON A;  3J80 b;  1TWF I;  1M1K 2;  1YI2 1;  5A2Q b;  3CCV Z;  4CL1 A;  1L1O C;  2V8K A;  3CXC Y;  3S1M I;  2G2K A;  1Q86 2;  1JJ2 Z;  2IZ4 A;  3MZK B;  4NBB A;  3I55 1;  1VQ8 Z;  1R9T I;  2JA6 I;  1K73 1;  1YIJ 1;  3VB9 A;  4RS4 A;  3HOZ I;  2W04 A;  1YIT Z;  3J81 b;  2YU9 I;  3GKQ A;  1VQK Z;  2HU9 A;  3VMH A;  3PO3 S;  1S72 Z;  4AYB A;  4MD7 A;  2JMO A;  4NOZ A;  3QWU A;  3CD6 Z;  1Z03 A;  4NBA A;  4NH1 C;  3TDH B;  3Q87 A;  1Q7Y 2;  3F3P C;  2ZAE B;  1Y1V I;  3HOX I;  2WB1 A;  3BG1 B;  2RHB A;  3TE5 B;  3CCJ 1;  3J80 f;  2KI7 B;  4A3F I;  2JS4 A;  1VQL Z;  2RIQ A;  1KC8 2;  5A2Q f;  3F3F C;  3CCM Z;  5FLM I;  1Z01 A;  2WAQ A;  1YJN Z;  1S72 1;  1Q81 1;  1M90 1;  1I50 I;  5T6B A;  2NVX I;  3FKI I;  4XX2 A;  2AKL A;  3S2D I;  1QVF Z;  3CCE 1;  4A93 I;  2V8I A;  1ZB8 A;  1M1K 1;  3T4N B;  2IZ3 A;  3HKZ A;  3NH8 A;  4RVG A;  4E2W A;  4DQY B;  5T67 A;  4A3J I;  2OTL Z;  4E30 A;  1YJN 1;  2K5R A;  2OZK A;  3I4N I;  2QLV B;  1Q86 1;  4RVF A;  4S1T A;  1KD1 1;  1VQ4 Z;  4NBC A;  1X3W A;  2PK7 A;  3GTM I;  3J7A 4;  2OTL 1;  1N2F A;  3D9X A;  1Q7Y 1;  3M4O I;  1USP B;  3I4M I;  1KRL A;  1LQL A;  3S1N I;  5D1P A;  1NJI 1;  3JAM b;  2O4H A;  5T64 A;  4E2Z A;  3CMA Z;  1KC8 1;  3FQQ A;  5C4J I;  2GTH A;  4HH4 A;  1VQP Z;  5IT9 b;  1WII A;  3P5J B;  2R7Z I;  3CC2 Z;  1KQS Z;  2VUG A;  4RVH A;  5IP7 I;  1VQ7 Z;  1YJW Z;  3RZD I;  4A3E I;  3G6E 1;  3CPW Z;  3NFZ A;  2RT9 A;  3CQZ I;  4NBG A;  1RNI A;  1W2B Y;  4NBH A;  1P9N A;  1QF8 A;  1USP A;  1VQP 1;  1RLY A;  4MON A;  3GTQ I;  2V8J A;  1Y1W I;  1VQN Z;  3BG0 B;  3K7A I;  1YHQ Z;  1VQ7 1;  4A3M I;  3CCV 1;  2OTJ Z;  3EED A;  2GTI A;  3JAM f;  4BBR I;  1VQ9 Z;  1TWC I;  4E32 A;  5C4X I;  4A3B I;  4RV9 A;  5IT9 f;  1VQ8 1;  4QTT A;  4BXX I;  3GTP I;  1VQN 1;  3EER A;  2K3R A;  1K8A 2;  3VMI A;  1YIT 1;  5FLX b;  1VQK 1;  2PM9 A;  3GTO I;  2P28 A;  2OTJ 1;  3KIH A;  3CD6 1;  1VQ9 1;  1SFO I;  4X6A I;  1WW9 A;  2JA5 I;  1Q82 1;  2Q51 A;  3S2H I;  2NVQ I;  2R6M A;  3D6W A;  2J6A A;  1VQO Z;  4QTU A;  2H85 A;  1VQL 1;  3CCM 1;  3PO2 I;  2M48 A;  3S15 I;  1TWA I;  4Y7N I;  3S17 I;  2B63 I;  3GCF A;  1ZH1 A;  4MH4 A;  3NH4 A;  3PO3 I;  2E2H I;  1VQM Z;  1DL6 A;  2JUB A;  1ZB9 A;  1VQO 1;  1I6H I;  3VTN A;  2VF1 A;  1JWH C;  5FLX f;  2VUM I;  2PMZ A;  2QEX Z;  3RZO I;  1S7M A;  1RQF A;  1RO2 A;  3IFU A;  3CCR Z;  4NB9 A;  4HGZ A;  1VQM 1;  1VQ4 1;  1TWH I;  1VQ6 Z;  2RPR A;  1RO0 A;  1K9M 2;  3NDJ A;  2LFU A;  1NUI A;  2M6N A;  4NBD A;  3ESW A;  5CM2 M;  3G71 Z;  3FQM A;  3KIF A;  3G4S Z;  3CC4 Z;  2EGT A;  1QVG Z;  2JR6 A;  5AN9 F;  2QR1 B;  2E2J I;  3OW2 Y;  2QEX 1;  2E9H A;  3HOY I;  1Y1V S;  5IP9 I;  1YUK A;  2DE7 A;  1VQ6 1;  1Q81 2;  4E2Y A;  3CMA 1;  2E2I I;  3I55 Z;  1KQS Y;  4Y52 I;  3CXC Z;  2NVY I;  2JA8 I;  3GTJ I;  4E2X A;  3G4S 1;  3CME Z;  2QRC B;  3CC4 1;  3CPW Y;  3CCL Z;  3CC2 1;  2JNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...