1YI2Z

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yi2Z00
1VQ81 1KQSY 1KC82 1VQL1 1K731 3I551 3CD6Z 1VQ8Z 1S721 2OTJ1 3CCQ1 3I55Z 1VQ91 3CCU1 1Q811 3G4SZ 1M1K1 3CCEZ 2OTJZ 3CCQZ 3CCVZ 3CPWY 1K9M1 1Q7Y1 1VQ9Z 1Q862 3CCUZ 1W2BZ 3G71Z 1KC81 3CME1 1VQP1 2OTLZ 1VQ51 3CCRZ 1YIJZ 3G4S1 1KQSZ 1QVFY 1K8A2 3CC21 3CCE1 3CC41 3CMEZ 3CCSZ 1KD12 1VQN1 1VQPZ 1VQ41 1VQ5Z 1YJN1 3CCV1 3G6EZ 3G711 1YI21 3CC2Z 2OTL1 1Q822 3CC4Z 1YIJ1 3CCR1 1NJI1 1VQ4Z 1Q861 1YJNZ 1VQNZ 1QVGY 2QA41 3CCJ1 3CCMZ 3CCL1 3CCS1 1N8R2 1K732 1YI2Z 3CC71 1YIT1 3CPWZ 1QVGZ 2QEXZ 1M902 3G6E1 2QA4Z 3CCJZ 3CCLZ 3CC7Z 1YITZ 1VQ71 1YJW1 3CMAZ 1VQM1 1Q812 1QVFZ 3CCM1 2QEX1 1VQ7Z 1Q7Y2 1K9M2 1VQK1 1YJWZ 1VQMZ 1VQO1 1N8R1 1VQ61 3CMA1 1M901 1YHQ1 1YJ91 1JJ2Y 1VQKZ 1K8A1 1KD11 1VQOZ 1VQLZ 1VQ6Z 3I561 1JJ2Z 3OW2Y 3CXCY 1S72Z 1YHQZ 1YJ9Z 1W2BY 1M1K2 3OW2Z 1Q821 3CXCZ 3CD61 3I56Z 1NJI2
chains in the Genus database with same CATH superfamily
1Y1WI 3HOVI 2W03A 3IR7A 3EEDA 1K731 4AYBA 3I551 1JWHC 3CD6Z 3S1MI 3VMGA 2G2KA 2JIMA 2O4HA 2R92I 2O53A 3CCQ1 3F3PC 4DQYB 4XX2A 3I55Z 2JNYA 1Q811 1N2FA 3G4SZ 3S15I 3CCQZ 3KIHA 2NAPA 3CPWY 3J80f 1Q7Y1 1WIIA 3CCRZ 1YIJZ 4A3DI 2V45A 4BY1I 5IP7I 3CC21 3CC41 3CCSZ 2F4MA 1VQ41 1YJN1 3CCV1 3NH4A 1USPA 3D2LA 1Z01A 3G711 4NB8A 3CC2Z 3CC4Z 4RVDA 1VQ4Z 1YJNZ 3ESWA 3CCJ1 3GTMS 3CCL1 1N8R2 3TE5B 4E2WA 3CC71 1YIT1 1QVGZ 5T67A 3CCJZ 4NB9A 3CCLZ 2IZ4A 4E32A 3CC7Z 1YITZ 1VQ71 4NBDA 2BJOA 1Z02A 3GKQA 2NVXI 1QVFZ 1NUIA 1RO0A 3NDIA 2JIPA 3S14I 4NFRA 2I3CA 2QEX1 4S1TA 2IV2X 4E2XA 4MXUA 2QR1B 5A2Qf 1VQ7Z 1VQK1 3S2HI 4HGYA 1WCMI 1VQO1 2QLVB 1NP6A 1P9NA 4RVGA 4E30A 2VPZA 3CMA1 1M901 1VQKZ 4X6AI 4Y52I 1VQOZ 1VQLZ 2LIYA 3I07A 3I561 1JJ2Z 3OW2Y 4BY7I 4MD8A 3CXCZ 3FQMA 3I56Z 1K9M1 1L1OC 2OOYB 2AYDA 1KQSY 1KC82 4EWCA 3GTLI 2GTIA 3VB9A 2OTJ1 2F4OA 3S17I 2JR6A 2PK7A 3BG1B 1USPB 1VQ91 3CCEZ 2OTJZ 2JIQA 3BG0B 2M48A 4RS4A 4RV9A 2R93I 1VQ9Z 1Q862 2GTHA 1W2BZ 3NFZA 5FLMI 4RVHA 3JAMb 2PMZA 3J80b 3PO3S 1VQP1 2OTLZ 3VMIA 2OOXB 3J7A4 1Y1VS 3RZOI 1QXFA 3G4S1 3K7AI 4E31A 4TNUA 3PO2I 1KD12 2JA5I 2QKDA 1VQN1 1VQPZ 1ZB8A 3S1RI 4NBGA 2VF1A 3I4NI 2VUGA 3G6EZ 2R7ZI 1WJ2A 4BBSI 2P28A 3CCR1 1YIJ1 1VQNZ 1S7MA 2B63I 3GTPI 3JAMf 5C4JI 1TWFI 3CCMZ 3HOUI 3CCS1 1K732 1TWGI 3FQQA 2VPXA 5C4XI 3KIFA 2M6NA 2JIOA 3IX0A 3VTNA 3HOZI 3TDHB 4NOZA 3GTKI 1Q812 2NVTI 3H3VJ 1QYPA 1TWCI 3U50C 1ZB9A 5LL6f 5CM2M 2E9HA 1Q7Y2 3GTGI 2PM9A 5AN9F 1N8R1 5A2Qb 1VQ61 3HOYI 5IT9f 3VMHA 3CQZI 1YJ91 4RVFA 3GTJI 1YUKA 1ML8A 4A3EI 5C44I 1K8A1 2R6MA 5D1OA 1VQ6Z 2QRCB 4NBAA 1S72Z 4QTUA 3NH5A 5IP9I 1YJ9Z 1M1K2 4A3CI 3OW2Z 3Q87A 1Q821 2NVYI 3S1QI 3S2DI 1VQ81 1Y8CA 2IZ3A 2OZKA 3HKZA 4A3JI 1DL6A 1WZNA 2VPYA 5T64A 3GTQI 1VQL1 1I50I 1VQ8Z 4E33A 2EGTA 1RO2A 2K3RA 2AKLA 3I4MI 1TWHI 3D9XA 4HH4A 1KC81 5C3EI 2LEXA 2JA6I 1FDOA 2K5RA 1RLYA 2P3YA 4A3GI 1QVFY 3CCE1 4A3MI 3EERA 2DE5A 2VUMI 4A3BI 2J6AA 3H0GI 2QRDB 2ZAEB 1KRLA 4DK1A 2WB1A 1YI21 2OTL1 4MH4A 2RIQA 1NJI1 3S1NI 1Q861 1RQFA 2QA41 3S16I 5T6BA 3FKII 1YI2Z 2W04A 1QF8A 1RNIA 2HF1A 3T4NB 3CPWZ 2HU9A 4Y7NI 1YUAA 3G6E1 2QA4Z 5D1OB 1RO4A 4NH1C 4E2ZA 3CCM1 1X3ZA 4NBHA 1AA6A 3M3YI 1SIWA 2RT9A 3P5JB 1X0TA 4NBFA 3LUSA 1YHQ1 1K83I 4MD9A 5IT9b 1X3WA 2JA7I 2V8IA 3IF8A 2E2II 4QTTA 3GTOI 2DE6A 4HGZA 4MD7A 3M4OI 1YHQZ 1W2BY 2YU9I 1VLAA 3J81b 3GTMI 4E2YA 1PFTA 4A3KI 3RZDI 3MONA 1SFOI 1S721 1ZH1A 2JS4A 2JMOA 4NBEA 3GCFA 4BXXI 3CCU1 1WW9A 2QREB 4A93I 2Y0SA 1M1K1 2RPRA 4DGLA 3J81f 3CCVZ 1Q16A 2V8JA 4NBBA 2KPIA 3CCUZ 3G71Z 3CME1 2H85A 1VQ51 1I6HI 2JIRA 1R9TI 2RHBA 3NDJA 2E7ZA 1KQSZ 3QWUA 1K8A2 3CMEZ 1VQ5Z 2KI7B 4A3FI 1Z03A 3F3FC 1Q822 4A3LI 3MZLB 4NBCA 1QVGY 5FLXb 2V8KA 2Q51A 2YADA 3D6WA 2WAQA 2QEXZ 1LQLA 5D1PA 1M902 2DE7A 3HOXI 1FDIA 1YJW1 3CMAZ 2VPWA 1VQM1 3IFUA 2RBLA 2V3VA 5FLXf 4MONA 3NH8A 1K9M2 2LFUA 1YJWZ 1VQMZ 1I3QI 3PO3I 2JUBA 1TWAI 4A3II 2E2HI 1Y1VI 4CL1A 1JJ2Y 3MZKB 2Q4ZA 2GU2A 2JA8I 4BBRI 1KD11 4MRIA 1TFIA 3CXCY 3HOWI 2E2JI 3CD61 1NJI2 2NVQI
chains in the Genus database with same CATH topology
1Y1WI 3HOVI 2W03A 3EEDA 1K731 4AYBA 3I551 1JWHC 3CD6Z 3S1MI 3VMGA 2G2KA 2O4HA 2R92I 2O53A 3CCQ1 3F3PC 4DQYB 4XX2A 3I55Z 2JNYA 1Q811 1N2FA 3G4SZ 3S15I 3CCQZ 3KIHA 3CPWY 3J80f 1Q7Y1 1WIIA 3CCRZ 1YIJZ 4A3DI 4BY1I 5IP7I 3CC21 3CC41 3CCSZ 2F4MA 1VQ41 1YJN1 3CCV1 3NH4A 1USPA 1Z01A 3G711 4NB8A 3CC2Z 3CC4Z 4RVDA 1VQ4Z 1YJNZ 3ESWA 3CCJ1 3GTMS 3CCL1 1N8R2 3TE5B 4E2WA 3CC71 1YIT1 1QVGZ 5T67A 3CCJZ 4NB9A 3CCLZ 2IZ4A 4E32A 3CC7Z 1YITZ 1VQ71 4NBDA 2BJOA 1Z02A 3GKQA 2NVXI 1QVFZ 1NUIA 1RO0A 3NDIA 3S14I 4NFRA 2I3CA 2QEX1 4S1TA 4E2XA 5A2Qf 4MXUA 2QR1B 1VQ7Z 1VQK1 3S2HI 4HGYA 1WCMI 1VQO1 2QLVB 1NP6A 1P9NA 4RVGA 4E30A 3CMA1 1M901 1VQKZ 4X6AI 4Y52I 1VQOZ 1VQLZ 2LIYA 3I07A 3I561 1JJ2Z 3OW2Y 4BY7I 4MD8A 3CXCZ 3FQMA 3I56Z 1K9M1 1L1OC 2OOYB 1KQSY 1KC82 4EWCA 3GTLI 2GTIA 3VB9A 2OTJ1 2F4OA 3S17I 2JR6A 2PK7A 3BG1B 1USPB 1VQ91 3CCEZ 2OTJZ 3BG0B 2M48A 4RS4A 4RV9A 2R93I 1VQ9Z 1Q862 2GTHA 1W2BZ 3NFZA 5FLMI 4RVHA 3JAMb 2PMZA 3J80b 3PO3S 1VQP1 2OTLZ 3VMIA 2OOXB 3J7A4 1Y1VS 3RZOI 3G4S1 3K7AI 4E31A 4TNUA 3PO2I 1KD12 2JA5I 2QKDA 1VQN1 1VQPZ 1ZB8A 3S1RI 4NBGA 2VF1A 3I4NI 2VUGA 3G6EZ 2R7ZI 4BBSI 2P28A 3CCR1 1YIJ1 1VQNZ 1S7MA 2B63I 3GTPI 3JAMf 5C4JI 1TWFI 3CCMZ 3HOUI 3CCS1 1K732 1TWGI 3FQQA 5C4XI 3KIFA 2M6NA 3IX0A 3VTNA 3HOZI 3TDHB 4NOZA 3GTKI 1Q812 2NVTI 3H3VJ 1QYPA 1TWCI 3U50C 1ZB9A 5LL6f 5CM2M 2E9HA 1Q7Y2 3GTGI 2PM9A 5AN9F 1N8R1 5A2Qb 1VQ61 3HOYI 5IT9f 3VMHA 3CQZI 1YJ91 4RVFA 3GTJI 1YUKA 1ML8A 4A3EI 5C44I 1K8A1 2R6MA 5D1OA 1VQ6Z 2QRCB 4NBAA 1S72Z 4QTUA 3NH5A 5IP9I 1YJ9Z 1M1K2 4A3CI 3OW2Z 3Q87A 1Q821 2NVYI 3S1QI 3S2DI 1VQ81 2OZKA 2IZ3A 3HKZA 1DL6A 4A3JI 5T64A 3GTQI 1VQL1 1I50I 1VQ8Z 4E33A 2EGTA 1RO2A 2K3RA 2AKLA 3I4MI 1TWHI 3D9XA 4HH4A 1KC81 5C3EI 2JA6I 2K5RA 1RLYA 2P3YA 4A3GI 1QVFY 3CCE1 4A3MI 3EERA 2DE5A 2VUMI 4A3BI 2J6AA 3H0GI 2QRDB 2ZAEB 1KRLA 4DK1A 2WB1A 1YI21 2OTL1 4MH4A 2RIQA 1NJI1 3S1NI 1Q861 1RQFA 2QA41 3S16I 5T6BA 3FKII 1YI2Z 2W04A 1QF8A 1RNIA 2HF1A 3T4NB 3CPWZ 2HU9A 4Y7NI 1YUAA 3G6E1 2QA4Z 5D1OB 1RO4A 4NH1C 4E2ZA 3CCM1 1X3ZA 4NBHA 3M3YI 2RT9A 3P5JB 1X0TA 4NBFA 3LUSA 1YHQ1 1K83I 4MD9A 5IT9b 1X3WA 2JA7I 2V8IA 3IF8A 2E2II 4QTTA 3GTOI 2DE6A 4HGZA 4MD7A 3M4OI 1YHQZ 1W2BY 2YU9I 1VLAA 3J81b 3GTMI 4E2YA 1PFTA 4A3KI 3RZDI 3MONA 1SFOI 1S721 1ZH1A 2JS4A 2JMOA 4NBEA 3GCFA 4BXXI 3CCU1 1WW9A 2QREB 4A93I 2Y0SA 1M1K1 2RPRA 4DGLA 3J81f 3CCVZ 2V8JA 4NBBA 2KPIA 3CCUZ 3G71Z 3CME1 2H85A 1VQ51 1I6HI 1R9TI 2RHBA 3NDJA 1KQSZ 3QWUA 1K8A2 3CMEZ 1VQ5Z 2KI7B 4A3FI 1Z03A 3F3FC 1Q822 4A3LI 3MZLB 4NBCA 1QVGY 5FLXb 2V8KA 2Q51A 2YADA 3D6WA 2WAQA 2QEXZ 1LQLA 5D1PA 1M902 2DE7A 3HOXI 1YJW1 3CMAZ 1VQM1 3IFUA 2RBLA 5FLXf 4MONA 3NH8A 1K9M2 2LFUA 1YJWZ 1VQMZ 1I3QI 3PO3I 2JUBA 1TWAI 4A3II 2E2HI 1Y1VI 4CL1A 1JJ2Y 3MZKB 2Q4ZA 2GU2A 2JA8I 4BBRI 1KD11 4MRIA 1TFIA 3CXCY 3HOWI 2E2JI 3CD61 1NJI2 2NVQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 1;  1KQS Y;  1KC8 2;  1VQL 1;  1K73 1;  3I55 1;  3CD6 Z;  1VQ8 Z;  1S72 1;  2OTJ 1;  3CCQ 1;  3I55 Z;  1VQ9 1;  3CCU 1;  1Q81 1;  3G4S Z;  1M1K 1;  3CCE Z;  2OTJ Z;  3CCQ Z;  3CCV Z;  3CPW Y;  1K9M 1;  1Q7Y 1;  1VQ9 Z;  1Q86 2;  3CCU Z;  1W2B Z;  3G71 Z;  1KC8 1;  3CME 1;  1VQP 1;  2OTL Z;  1VQ5 1;  3CCR Z;  1YIJ Z;  3G4S 1;  1KQS Z;  1QVF Y;  1K8A 2;  3CC2 1;  3CCE 1;  3CC4 1;  3CME Z;  3CCS Z;  1KD1 2;  1VQN 1;  1VQP Z;  1VQ4 1;  1VQ5 Z;  1YJN 1;  3CCV 1;  3G6E Z;  3G71 1;  1YI2 1;  3CC2 Z;  2OTL 1;  1Q82 2;  3CC4 Z;  1YIJ 1;  3CCR 1;  1NJI 1;  1VQ4 Z;  1Q86 1;  1YJN Z;  1VQN Z;  1QVG Y;  2QA4 1;  3CCJ 1;  3CCM Z;  3CCL 1;  3CCS 1;  1N8R 2;  1K73 2;  1YI2 Z;  3CC7 1;  1YIT 1;  3CPW Z;  1QVG Z;  2QEX Z;  1M90 2;  3G6E 1;  2QA4 Z;  3CCJ Z;  3CCL Z;  3CC7 Z;  1YIT Z;  1VQ7 1;  1YJW 1;  3CMA Z;  1VQM 1;  1Q81 2;  1QVF Z;  3CCM 1;  2QEX 1;  1VQ7 Z;  1Q7Y 2;  1K9M 2;  1VQK 1;  1YJW Z;  1VQM Z;  1VQO 1;  1N8R 1;  1VQ6 1;  3CMA 1;  1M90 1;  1YHQ 1;  1YJ9 1;  1JJ2 Y;  1VQK Z;  1K8A 1;  1KD1 1;  1VQO Z;  1VQL Z;  1VQ6 Z;  3I56 1;  1JJ2 Z;  3OW2 Y;  3CXC Y;  1S72 Z;  1YHQ Z;  1YJ9 Z;  1W2B Y;  1M1K 2;  3OW2 Z;  1Q82 1;  3CXC Z;  3CD6 1;  3I56 Z;  1NJI 2; 
#chains in the Genus database with same CATH topology
 1Y1W I;  3HOV I;  2W03 A;  3IR7 A;  3EED A;  1K73 1;  4AYB A;  3I55 1;  1JWH C;  3CD6 Z;  3S1M I;  3VMG A;  2G2K A;  2JIM A;  2O4H A;  2R92 I;  2O53 A;  3CCQ 1;  3F3P C;  4DQY B;  4XX2 A;  3I55 Z;  2JNY A;  1Q81 1;  1N2F A;  3G4S Z;  3S15 I;  3CCQ Z;  3KIH A;  2NAP A;  3CPW Y;  3J80 f;  1Q7Y 1;  1WII A;  3CCR Z;  1YIJ Z;  4A3D I;  2V45 A;  4BY1 I;  5IP7 I;  3CC2 1;  3CC4 1;  3CCS Z;  2F4M A;  1VQ4 1;  1YJN 1;  3CCV 1;  3NH4 A;  1USP A;  3D2L A;  1Z01 A;  3G71 1;  4NB8 A;  3CC2 Z;  3CC4 Z;  4RVD A;  1VQ4 Z;  1YJN Z;  3ESW A;  3CCJ 1;  3GTM S;  3CCL 1;  1N8R 2;  3TE5 B;  4E2W A;  3CC7 1;  1YIT 1;  1QVG Z;  5T67 A;  3CCJ Z;  4NB9 A;  3CCL Z;  2IZ4 A;  4E32 A;  3CC7 Z;  1YIT Z;  1VQ7 1;  4NBD A;  2BJO A;  1Z02 A;  3GKQ A;  2NVX I;  1QVF Z;  1NUI A;  1RO0 A;  3NDI A;  2JIP A;  3S14 I;  4NFR A;  2I3C A;  2QEX 1;  4S1T A;  2IV2 X;  4E2X A;  4MXU A;  2QR1 B;  5A2Q f;  1VQ7 Z;  1VQK 1;  3S2H I;  4HGY A;  1WCM I;  1VQO 1;  2QLV B;  1NP6 A;  1P9N A;  4RVG A;  4E30 A;  2VPZ A;  3CMA 1;  1M90 1;  1VQK Z;  4X6A I;  4Y52 I;  1VQO Z;  1VQL Z;  2LIY A;  3I07 A;  3I56 1;  1JJ2 Z;  3OW2 Y;  4BY7 I;  4MD8 A;  3CXC Z;  3FQM A;  3I56 Z;  1K9M 1;  1L1O C;  2OOY B;  2AYD A;  1KQS Y;  1KC8 2;  4EWC A;  3GTL I;  2GTI A;  3VB9 A;  2OTJ 1;  2F4O A;  3S17 I;  2JR6 A;  2PK7 A;  3BG1 B;  1USP B;  1VQ9 1;  3CCE Z;  2OTJ Z;  2JIQ A;  3BG0 B;  2M48 A;  4RS4 A;  4RV9 A;  2R93 I;  1VQ9 Z;  1Q86 2;  2GTH A;  1W2B Z;  3NFZ A;  5FLM I;  4RVH A;  3JAM b;  2PMZ A;  3J80 b;  3PO3 S;  1VQP 1;  2OTL Z;  3VMI A;  2OOX B;  3J7A 4;  1Y1V S;  3RZO I;  1QXF A;  3G4S 1;  3K7A I;  4E31 A;  4TNU A;  3PO2 I;  1KD1 2;  2JA5 I;  2QKD A;  1VQN 1;  1VQP Z;  1ZB8 A;  3S1R I;  4NBG A;  2VF1 A;  3I4N I;  2VUG A;  3G6E Z;  2R7Z I;  1WJ2 A;  4BBS I;  2P28 A;  3CCR 1;  1YIJ 1;  1VQN Z;  1S7M A;  2B63 I;  3GTP I;  3JAM f;  5C4J I;  1TWF I;  3CCM Z;  3HOU I;  3CCS 1;  1K73 2;  1TWG I;  3FQQ A;  2VPX A;  5C4X I;  3KIF A;  2M6N A;  2JIO A;  3IX0 A;  3VTN A;  3HOZ I;  3TDH B;  4NOZ A;  3GTK I;  1Q81 2;  2NVT I;  3H3V J;  1QYP A;  1TWC I;  3U50 C;  1ZB9 A;  5LL6 f;  5CM2 M;  2E9H A;  1Q7Y 2;  3GTG I;  2PM9 A;  5AN9 F;  1N8R 1;  5A2Q b;  1VQ6 1;  3HOY I;  5IT9 f;  3VMH A;  3CQZ I;  1YJ9 1;  4RVF A;  3GTJ I;  1YUK A;  1ML8 A;  4A3E I;  5C44 I;  1K8A 1;  2R6M A;  5D1O A;  1VQ6 Z;  2QRC B;  4NBA A;  1S72 Z;  4QTU A;  3NH5 A;  5IP9 I;  1YJ9 Z;  1M1K 2;  4A3C I;  3OW2 Z;  3Q87 A;  1Q82 1;  2NVY I;  3S1Q I;  3S2D I;  1VQ8 1;  1Y8C A;  2IZ3 A;  2OZK A;  3HKZ A;  4A3J I;  1DL6 A;  1WZN A;  2VPY A;  5T64 A;  3GTQ I;  1VQL 1;  1I50 I;  1VQ8 Z;  4E33 A;  2EGT A;  1RO2 A;  2K3R A;  2AKL A;  3I4M I;  1TWH I;  3D9X A;  4HH4 A;  1KC8 1;  5C3E I;  2LEX A;  2JA6 I;  1FDO A;  2K5R A;  1RLY A;  2P3Y A;  4A3G I;  1QVF Y;  3CCE 1;  4A3M I;  3EER A;  2DE5 A;  2VUM I;  4A3B I;  2J6A A;  3H0G I;  2QRD B;  2ZAE B;  1KRL A;  4DK1 A;  2WB1 A;  1YI2 1;  2OTL 1;  4MH4 A;  2RIQ A;  1NJI 1;  3S1N I;  1Q86 1;  1RQF A;  2QA4 1;  3S16 I;  5T6B A;  3FKI I;  1YI2 Z;  2W04 A;  1QF8 A;  1RNI A;  2HF1 A;  3T4N B;  3CPW Z;  2HU9 A;  4Y7N I;  1YUA A;  3G6E 1;  2QA4 Z;  5D1O B;  1RO4 A;  4NH1 C;  4E2Z A;  3CCM 1;  1X3Z A;  4NBH A;  1AA6 A;  3M3Y I;  1SIW A;  2RT9 A;  3P5J B;  1X0T A;  4NBF A;  3LUS A;  1YHQ 1;  1K83 I;  4MD9 A;  5IT9 b;  1X3W A;  2JA7 I;  2V8I A;  3IF8 A;  2E2I I;  4QTT A;  3GTO I;  2DE6 A;  4HGZ A;  4MD7 A;  3M4O I;  1YHQ Z;  1W2B Y;  2YU9 I;  1VLA A;  3J81 b;  3GTM I;  4E2Y A;  1PFT A;  4A3K I;  3RZD I;  3MON A;  1SFO I;  1S72 1;  1ZH1 A;  2JS4 A;  2JMO A;  4NBE A;  3GCF A;  4BXX I;  3CCU 1;  1WW9 A;  2QRE B;  4A93 I;  2Y0S A;  1M1K 1;  2RPR A;  4DGL A;  3J81 f;  3CCV Z;  1Q16 A;  2V8J A;  4NBB A;  2KPI A;  3CCU Z;  3G71 Z;  3CME 1;  2H85 A;  1VQ5 1;  1I6H I;  2JIR A;  1R9T I;  2RHB A;  3NDJ A;  2E7Z A;  1KQS Z;  3QWU A;  1K8A 2;  3CME Z;  1VQ5 Z;  2KI7 B;  4A3F I;  1Z03 A;  3F3F C;  1Q82 2;  4A3L I;  3MZL B;  4NBC A;  1QVG Y;  5FLX b;  2V8K A;  2Q51 A;  2YAD A;  3D6W A;  2WAQ A;  2QEX Z;  1LQL A;  5D1P A;  1M90 2;  2DE7 A;  3HOX I;  1FDI A;  1YJW 1;  3CMA Z;  2VPW A;  1VQM 1;  3IFU A;  2RBL A;  2V3V A;  5FLX f;  4MON A;  3NH8 A;  1K9M 2;  2LFU A;  1YJW Z;  1VQM Z;  1I3Q I;  3PO3 I;  2JUB A;  1TWA I;  4A3I I;  2E2H I;  1Y1V I;  4CL1 A;  1JJ2 Y;  3MZK B;  2Q4Z A;  2GU2 A;  2JA8 I;  4BBR I;  1KD1 1;  4MRI A;  1TFI A;  3CXC Y;  3HOW I;  2E2J I;  3CD6 1;  1NJI 2;  2NVQ I; 
#chains in the Genus database with same CATH homology
 1Y1W I;  3HOV I;  2W03 A;  3EED A;  1K73 1;  4AYB A;  3I55 1;  1JWH C;  3CD6 Z;  3S1M I;  3VMG A;  2G2K A;  2O4H A;  2R92 I;  2O53 A;  3CCQ 1;  3F3P C;  4DQY B;  4XX2 A;  3I55 Z;  2JNY A;  1Q81 1;  1N2F A;  3G4S Z;  3S15 I;  3CCQ Z;  3KIH A;  3CPW Y;  3J80 f;  1Q7Y 1;  1WII A;  3CCR Z;  1YIJ Z;  4A3D I;  4BY1 I;  5IP7 I;  3CC2 1;  3CC4 1;  3CCS Z;  2F4M A;  1VQ4 1;  1YJN 1;  3CCV 1;  3NH4 A;  1USP A;  1Z01 A;  3G71 1;  4NB8 A;  3CC2 Z;  3CC4 Z;  4RVD A;  1VQ4 Z;  1YJN Z;  3ESW A;  3CCJ 1;  3GTM S;  3CCL 1;  1N8R 2;  3TE5 B;  4E2W A;  3CC7 1;  1YIT 1;  1QVG Z;  5T67 A;  3CCJ Z;  4NB9 A;  3CCL Z;  2IZ4 A;  4E32 A;  3CC7 Z;  1YIT Z;  1VQ7 1;  4NBD A;  2BJO A;  1Z02 A;  3GKQ A;  2NVX I;  1QVF Z;  1NUI A;  1RO0 A;  3NDI A;  3S14 I;  4NFR A;  2I3C A;  2QEX 1;  4S1T A;  4E2X A;  5A2Q f;  4MXU A;  2QR1 B;  1VQ7 Z;  1VQK 1;  3S2H I;  4HGY A;  1WCM I;  1VQO 1;  2QLV B;  1NP6 A;  1P9N A;  4RVG A;  4E30 A;  3CMA 1;  1M90 1;  1VQK Z;  4X6A I;  4Y52 I;  1VQO Z;  1VQL Z;  2LIY A;  3I07 A;  3I56 1;  1JJ2 Z;  3OW2 Y;  4BY7 I;  4MD8 A;  3CXC Z;  3FQM A;  3I56 Z;  1K9M 1;  1L1O C;  2OOY B;  1KQS Y;  1KC8 2;  4EWC A;  3GTL I;  2GTI A;  3VB9 A;  2OTJ 1;  2F4O A;  3S17 I;  2JR6 A;  2PK7 A;  3BG1 B;  1USP B;  1VQ9 1;  3CCE Z;  2OTJ Z;  3BG0 B;  2M48 A;  4RS4 A;  4RV9 A;  2R93 I;  1VQ9 Z;  1Q86 2;  2GTH A;  1W2B Z;  3NFZ A;  5FLM I;  4RVH A;  3JAM b;  2PMZ A;  3J80 b;  3PO3 S;  1VQP 1;  2OTL Z;  3VMI A;  2OOX B;  3J7A 4;  1Y1V S;  3RZO I;  3G4S 1;  3K7A I;  4E31 A;  4TNU A;  3PO2 I;  1KD1 2;  2JA5 I;  2QKD A;  1VQN 1;  1VQP Z;  1ZB8 A;  3S1R I;  4NBG A;  2VF1 A;  3I4N I;  2VUG A;  3G6E Z;  2R7Z I;  4BBS I;  2P28 A;  3CCR 1;  1YIJ 1;  1VQN Z;  1S7M A;  2B63 I;  3GTP I;  3JAM f;  5C4J I;  1TWF I;  3CCM Z;  3HOU I;  3CCS 1;  1K73 2;  1TWG I;  3FQQ A;  5C4X I;  3KIF A;  2M6N A;  3IX0 A;  3VTN A;  3HOZ I;  3TDH B;  4NOZ A;  3GTK I;  1Q81 2;  2NVT I;  3H3V J;  1QYP A;  1TWC I;  3U50 C;  1ZB9 A;  5LL6 f;  5CM2 M;  2E9H A;  1Q7Y 2;  3GTG I;  2PM9 A;  5AN9 F;  1N8R 1;  5A2Q b;  1VQ6 1;  3HOY I;  5IT9 f;  3VMH A;  3CQZ I;  1YJ9 1;  4RVF A;  3GTJ I;  1YUK A;  1ML8 A;  4A3E I;  5C44 I;  1K8A 1;  2R6M A;  5D1O A;  1VQ6 Z;  2QRC B;  4NBA A;  1S72 Z;  4QTU A;  3NH5 A;  5IP9 I;  1YJ9 Z;  1M1K 2;  4A3C I;  3OW2 Z;  3Q87 A;  1Q82 1;  2NVY I;  3S1Q I;  3S2D I;  1VQ8 1;  2OZK A;  2IZ3 A;  3HKZ A;  1DL6 A;  4A3J I;  5T64 A;  3GTQ I;  1VQL 1;  1I50 I;  1VQ8 Z;  4E33 A;  2EGT A;  1RO2 A;  2K3R A;  2AKL A;  3I4M I;  1TWH I;  3D9X A;  4HH4 A;  1KC8 1;  5C3E I;  2JA6 I;  2K5R A;  1RLY A;  2P3Y A;  4A3G I;  1QVF Y;  3CCE 1;  4A3M I;  3EER A;  2DE5 A;  2VUM I;  4A3B I;  2J6A A;  3H0G I;  2QRD B;  2ZAE B;  1KRL A;  4DK1 A;  2WB1 A;  1YI2 1;  2OTL 1;  4MH4 A;  2RIQ A;  1NJI 1;  3S1N I;  1Q86 1;  1RQF A;  2QA4 1;  3S16 I;  5T6B A;  3FKI I;  1YI2 Z;  2W04 A;  1QF8 A;  1RNI A;  2HF1 A;  3T4N B;  3CPW Z;  2HU9 A;  4Y7N I;  1YUA A;  3G6E 1;  2QA4 Z;  5D1O B;  1RO4 A;  4NH1 C;  4E2Z A;  3CCM 1;  1X3Z A;  4NBH A;  3M3Y I;  2RT9 A;  3P5J B;  1X0T A;  4NBF A;  3LUS A;  1YHQ 1;  1K83 I;  4MD9 A;  5IT9 b;  1X3W A;  2JA7 I;  2V8I A;  3IF8 A;  2E2I I;  4QTT A;  3GTO I;  2DE6 A;  4HGZ A;  4MD7 A;  3M4O I;  1YHQ Z;  1W2B Y;  2YU9 I;  1VLA A;  3J81 b;  3GTM I;  4E2Y A;  1PFT A;  4A3K I;  3RZD I;  3MON A;  1SFO I;  1S72 1;  1ZH1 A;  2JS4 A;  2JMO A;  4NBE A;  3GCF A;  4BXX I;  3CCU 1;  1WW9 A;  2QRE B;  4A93 I;  2Y0S A;  1M1K 1;  2RPR A;  4DGL A;  3J81 f;  3CCV Z;  2V8J A;  4NBB A;  2KPI A;  3CCU Z;  3G71 Z;  3CME 1;  2H85 A;  1VQ5 1;  1I6H I;  1R9T I;  2RHB A;  3NDJ A;  1KQS Z;  3QWU A;  1K8A 2;  3CME Z;  1VQ5 Z;  2KI7 B;  4A3F I;  1Z03 A;  3F3F C;  1Q82 2;  4A3L I;  3MZL B;  4NBC A;  1QVG Y;  5FLX b;  2V8K A;  2Q51 A;  2YAD A;  3D6W A;  2WAQ A;  2QEX Z;  1LQL A;  5D1P A;  1M90 2;  2DE7 A;  3HOX I;  1YJW 1;  3CMA Z;  1VQM 1;  3IFU A;  2RBL A;  5FLX f;  4MON A;  3NH8 A;  1K9M 2;  2LFU A;  1YJW Z;  1VQM Z;  1I3Q I;  3PO3 I;  2JUB A;  1TWA I;  4A3I I;  2E2H I;  1Y1V I;  4CL1 A;  1JJ2 Y;  3MZK B;  2Q4Z A;  2GU2 A;  2JA8 I;  4BBR I;  1KD1 1;  4MRI A;  1TFI A;  3CXC Y;  3HOW I;  2E2J I;  3CD6 1;  1NJI 2;  2NVQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...