1TFIA

A novel zn finger motif in the basal transcriptional machinery: three-dimensional nmr studies of the nucleic-acid binding domain of transcriptional elongation factor tfiis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL ELONGATION FACTOR SII
publication title Novel zinc finger motif in the basal transcriptional machinery: three-dimensional NMR studies of the nucleic acid binding domain of transcriptional elongation factor TFIIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1tfiA00
4MH4A 3GKQA 4A3EI 5CM2M 2JA8I 4BXXI 1N2FA 4BBRI 1WCMI 3I4MI 4A3FI 3RZOI 2AKLA 2JR6A 3S1MI 3I4NI 1SFOI 3VMGA 3GTOI 2PK7A 3D6WA 3S16I 2R92I 3VMIA 3RZDI 4X6AI 3HOYI 4QTTA 4XX2A 4A3JI 2P3YA 3VMHA 1K83I 2E2II 5IP9I 5FLMI 1PFTA 1Y1WI 3K7AI 1X3ZA 3PO3I 2K5RA 1TWCI 3S14I 3VB9A 3GTMI 1WW9A 3H3VJ 2E2JI 1TWHI 5C44I 3M4OI 2JNYA 1DL6A 1TFIA 3FKII 4A3BI 2JA7I 2VUMI 1X3WA 1TWAI 1I50I 4NB8A 3PO3S 3S1QI 3GTMS 4BY7I 2F4MA 3CQZI 4A3KI 3GTJI 3HOVI 2KPIA 4NOZA 5IP7I 1L1OC 3H0GI 4A93I 4NBAA 5C4JI 1RLYA 2NVYI 2JA5I 3GTPI 1R9TI 4Y52I 2NVQI 2BJOA 2RBLA 2F4OA 5C3EI 3PO2I 3U50C 3HOWI 3GTLI 3M3YI 1USPA 4BY1I 4A3LI 1NUIA 3S1NI 1ZB8A 3S15I 4NBGA 4QTUA 4BBSI 3EERA 4NBFA 1TWFI 2B63I 2YU9I 2J6AA 5C4XI 3Q87A 2R7ZI 4NBBA 1ML8A 1I6HI 1VLAA 2NVXI 3S2HI 3LUSA 1Y1VS 3GCFA 1I3QI 2E2HI 1RO4A 3GTKI 1LQLA 2HF1A 2DE6A 3I07A 4NBDA 1TWGI 2NVTI 1ZB9A 3GTQI 2R93I 3S17I 3HOXI 4A3CI 1QYPA 4NBCA 4A3II 4A3DI 4A3GI 1Y1VI 4A3MI 2JA6I 3ESWA 3HOZI 4Y7NI 3S1RI 2DE7A 4NBHA 3GTGI 3S2DI 1USPB 4NB9A 2DE5A 1YUAA 4NBEA 2JS4A 3HOUI
chains in the Genus database with same CATH superfamily
1Z03A 4MH4A 4BXXI 1N2FA 3CCRZ 2Q4ZA 2V45A 2LEXA 5T67A 3CC21 2PK7A 3D6WA 2QEXZ 1VQ41 3CCLZ 3S16I 1K9M2 2QR1B 3IFUA 3HOYI 4MD7A 4XX2A 4DGLA 3BG0B 2OOXB 1PFTA 3CC71 3PO3I 4NH1C 4S1TA 4NFRA 3NFZA 1YJ91 3H3VJ 2I3CA 1Z02A 3KIHA 1RNIA 3J7A4 4RVGA 1S72Z 2JA7I 2VF1A 1TWAI 3PO3S 1Q7Y2 3CCVZ 1K731 3EEDA 2KPIA 4NOZA 2VUGA 5IP7I 1JJ2Z 1WIIA 3CD6Z 4E2ZA 2QLVB 4NBAA 1QVGZ 4RVFA 1WJ2A 1RLYA 1VQLZ 2RHBA 3CCS1 3KIFA 3CC41 1R9TI 1JJ2Y 1QVGY 2NAPA 3CMA1 3HOWI 3GTLI 3M3YI 1USPA 2O4HA 1ZB8A 2YADA 4QTUA 3HKZA 4BBSI 2QKDA 4RVHA 3I561 2YU9I 4E30A 5C4XI 3CCMZ 3FQQA 3GCFA 3CXCZ 2OTL1 1LQLA 2VPXA 1VQ71 4E32A 2OTJ1 2R93I 1VQP1 1VQ5Z 1VQKZ 3CXCY 1P9NA 4E2XA 3S1RI 3TDHB 3GTGI 1Q821 2K3RA 1YI2Z 4NB9A 1K732 4DQYB 2GU2A 1VQ81 1QVFZ 3CCUZ 4NBEA 3J80b 1M1K1 2Y0SA 2JS4A 3CCJ1 3JAMb 2IZ3A 3G4S1 2PM9A 3GKQA 2PMZA 5CM2M 2JA8I 2KI7B 4BBRI 1QVFY 3I4MI 1YJW1 2E7ZA 2AKLA 3S1MI 4E31A 3MONA 3CMEZ 3G6E1 2JIOA 3IR7A 1YHQ1 3VMIA 2V8KA 1VQMZ 3NDIA 1VQO1 4QTTA 3OW2Z 1YJN1 2P3YA 1VQNZ 5IP9I 5LL6f 5FLMI 3K7AI 1TWCI 2OOYB 1M901 2OZKA 2JMOA 5IT9f 3OW2Y 3G71Z 2E2JI 3M4OI 1SIWA 4DK1A 2JNYA 1DL6A 1TFIA 3D9XA 4A3BI 3MZKB 1KC81 2H85A 4BY7I 4MRIA 2JIMA 3CQZI 2V8JA 3GTJI 3HOVI 1N8R2 1VQ4Z 1L1OC 1KQSY 4A93I 3NH8A 1RO0A 2NVYI 1Q16A 3CPWZ 3CC7Z 1YIT1 1NJI2 5T6BA 3CCEZ 2F4OA 3CCL1 1YJ9Z 3U50C 4RVDA 3CPWY 1FDOA 4A3LI 3EERA 2B63I 3TE5B 4MXUA 3Q87A 1I6HI 1ML8A 2GTHA 2JIQA 3P5JB 1I3QI 2O53A 2E2HI 3F3FC 1RQFA 2QREB 1TWGI 1ZB9A 1ZH1A 1KD11 2QA4Z 3S17I 2Q51A 4A3CI 2P28A 4A3DI 2QRCB 4TNUA 3F3PC 3CMAZ 4EWCA 1W2BZ 2HU9A 3HOZI 3J80f 4Y7NI 3JAMf 1USPB 2VPZA 2DE5A 1VQL1 1YUAA 1WZNA 5D1OA 1W2BY 4AYBA 3J81f 4MD8A 1VQ7Z 1KRLA 3RZOI 3I4NI 1SFOI 3VMGA 1VQPZ 2LIYA 3RZDI 2QRDB 4E33A 2E9HA 3NH5A 2G2KA 3VMHA 1K83I 2RT9A 1QF8A 2K5RA 4HH4A 3VB9A 1VQ51 1VQ8Z 3CCQ1 3T4NB 5C44I 3CCJZ 3I55Z 1YIJ1 3FKII 3NDJA 1K9M1 1Q811 2VUMI 1X3WA 1I50I 1VQ91 4NB8A 1JWHC 3S1QI 2EGTA 2W03A 2F4MA 1YJWZ 1Q861 2ZAEB 3H0GI 5A2Qb 5FLXb 1VQ6Z 2JA5I 4Y52I 4MD9A 2NVQI 2R6MA 1RO2A 5C3EI 3S1NI 1KQSZ 4NBGA 3NH4A 3CC2Z 4NBBA 1VQN1 3FQMA 3G711 1Y1VS 2GTIA 1Q822 4E2WA 3GTKI 2IV2X 3CCR1 2DE6A 1YITZ 2NVTI 1X0TA 1M1K2 3HOXI 2QEX1 1QYPA 4A3II 2WB1A 2JA6I 2DE7A 1Q812 2JUBA 4RV9A 4RS4A 1NP6A 3CCE1 1Q862 4CL1A 3HOUI 1S721 4A3EI 2W04A 5D1PA 3CCSZ 1Y8CA 3CCV1 3CC4Z 1M902 1WCMI 4A3FI 2JR6A 3MZLB 3QWUA 5IT9b 3GTOI 2JIPA 2R92I 3CD61 2V8IA 4X6AI 1KC82 4A3JI 2E2II 1Y1WI 1X3ZA 1K8A1 3S14I 3I56Z 3GTMI 2RPRA 1WW9A 2QA41 5D1OB 1TWHI 2JIRA 3IF8A 5AN9F 2OTLZ 5A2Qf 2V3VA 5FLXf 2OTJZ 3GTMS 4A3KI 3CCM1 4HGZA 1Z01A 5C4JI 3GTPI 2WAQA 2M6NA 2BJOA 1VQK1 2RBLA 3CCQZ 1N8R1 3PO2I 2LFUA 3G4SZ 4BY1I 1NUIA 1YIJZ 1YI21 3S15I 2AYDA 1FDIA 1VQ9Z 1QXFA 1KD12 4NBFA 1YUKA 1TWFI 2J6AA 3G6EZ 3BG1B 3CCU1 1YHQZ 1NJI1 2RIQA 2R7ZI 3S2HI 1VLAA 2NVXI 3LUSA 1VQOZ 2VPWA 1YJNZ 3VTNA 1S7MA 3I551 1RO4A 2HF1A 3I07A 4NBDA 1Q7Y1 1K8A2 3D2LA 3CME1 3GTQI 3IX0A 4HGYA 4NBCA 4A3GI 1Y1VI 1VQM1 4E2YA 4A3MI 2M48A 3ESWA 5T64A 3J81b 4NBHA 3S2DI 1VQ61 1AA6A 2VPYA 2IZ4A 4MONA
chains in the Genus database with same CATH topology
1Z03A 4MH4A 4BXXI 1N2FA 3CCRZ 2Q4ZA 5T67A 3CC21 2PK7A 3D6WA 2QEXZ 1VQ41 3CCLZ 3S16I 1K9M2 2QR1B 3IFUA 3HOYI 4MD7A 4XX2A 4DGLA 3BG0B 2OOXB 1PFTA 3CC71 3PO3I 4NH1C 4S1TA 4NFRA 3NFZA 1YJ91 3H3VJ 2I3CA 1Z02A 3KIHA 1RNIA 3J7A4 4RVGA 1S72Z 2JA7I 2VF1A 1TWAI 3PO3S 1Q7Y2 3CCVZ 1K731 3EEDA 2KPIA 4NOZA 2VUGA 5IP7I 1JJ2Z 1WIIA 3CD6Z 4E2ZA 2QLVB 4NBAA 1QVGZ 4RVFA 1RLYA 1VQLZ 2RHBA 3CCS1 3KIFA 3CC41 1R9TI 1JJ2Y 1QVGY 3CMA1 3HOWI 3GTLI 3M3YI 1USPA 2O4HA 1ZB8A 2YADA 4QTUA 3HKZA 4BBSI 2QKDA 4RVHA 3I561 2YU9I 4E30A 5C4XI 3CCMZ 3FQQA 3GCFA 3CXCZ 2OTL1 1LQLA 1VQ71 4E32A 2OTJ1 2R93I 1VQP1 1VQ5Z 1VQKZ 3CXCY 1P9NA 4E2XA 3S1RI 3TDHB 3GTGI 1Q821 2K3RA 1YI2Z 4NB9A 1K732 4DQYB 2GU2A 1VQ81 1QVFZ 3CCUZ 4NBEA 3J80b 1M1K1 2Y0SA 2JS4A 3CCJ1 3JAMb 2IZ3A 3G4S1 2PM9A 3GKQA 2PMZA 5CM2M 2JA8I 2KI7B 4BBRI 1QVFY 3I4MI 1YJW1 2AKLA 3S1MI 4E31A 3MONA 3CMEZ 3G6E1 1YHQ1 3VMIA 2V8KA 1VQMZ 3NDIA 1VQO1 4QTTA 3OW2Z 1YJN1 2P3YA 1VQNZ 5IP9I 5LL6f 5FLMI 3K7AI 1TWCI 2OOYB 1M901 2OZKA 2JMOA 5IT9f 3OW2Y 3G71Z 2E2JI 3M4OI 4DK1A 2JNYA 1DL6A 1TFIA 3D9XA 4A3BI 3MZKB 1KC81 2H85A 4BY7I 4MRIA 3CQZI 2V8JA 3GTJI 3HOVI 1N8R2 1VQ4Z 1L1OC 1KQSY 4A93I 3NH8A 1RO0A 2NVYI 3CPWZ 3CC7Z 1YIT1 1NJI2 5T6BA 3CCEZ 2F4OA 3CCL1 1YJ9Z 3U50C 4RVDA 3CPWY 4A3LI 3EERA 2B63I 3TE5B 4MXUA 3Q87A 1I6HI 1ML8A 2GTHA 3P5JB 1I3QI 2O53A 2E2HI 3F3FC 1RQFA 2QREB 1TWGI 1ZB9A 1ZH1A 1KD11 2QA4Z 3S17I 2Q51A 4A3CI 2P28A 4A3DI 2QRCB 4TNUA 3F3PC 3CMAZ 4EWCA 1W2BZ 2HU9A 3HOZI 3J80f 4Y7NI 3JAMf 1USPB 2DE5A 1VQL1 1YUAA 5D1OA 1W2BY 4AYBA 3J81f 4MD8A 1VQ7Z 1KRLA 3RZOI 3I4NI 1SFOI 3VMGA 1VQPZ 2LIYA 3RZDI 2QRDB 4E33A 2E9HA 3NH5A 2G2KA 3VMHA 1K83I 2RT9A 1QF8A 2K5RA 4HH4A 3VB9A 1VQ51 1VQ8Z 3CCQ1 3T4NB 5C44I 3CCJZ 3I55Z 1YIJ1 3FKII 3NDJA 1K9M1 1Q811 2VUMI 1X3WA 1I50I 1VQ91 4NB8A 1JWHC 3S1QI 2EGTA 2W03A 2F4MA 1YJWZ 1Q861 2ZAEB 3H0GI 5A2Qb 5FLXb 1VQ6Z 2JA5I 4Y52I 4MD9A 2NVQI 2R6MA 1RO2A 5C3EI 3S1NI 1KQSZ 4NBGA 3NH4A 3CC2Z 4NBBA 1VQN1 3FQMA 3G711 1Y1VS 2GTIA 1Q822 4E2WA 3GTKI 3CCR1 2DE6A 1YITZ 2NVTI 1X0TA 1M1K2 3HOXI 2QEX1 1QYPA 4A3II 2WB1A 2JA6I 2DE7A 1Q812 2JUBA 4RV9A 4RS4A 1NP6A 3CCE1 1Q862 4CL1A 3HOUI 1S721 4A3EI 2W04A 5D1PA 3CCSZ 3CCV1 3CC4Z 1M902 1WCMI 4A3FI 2JR6A 3MZLB 3QWUA 5IT9b 3GTOI 2R92I 3CD61 2V8IA 4X6AI 1KC82 4A3JI 2E2II 1Y1WI 1X3ZA 1K8A1 3S14I 3I56Z 3GTMI 2RPRA 1WW9A 2QA41 5D1OB 1TWHI 3IF8A 5AN9F 2OTLZ 5A2Qf 5FLXf 2OTJZ 3GTMS 4A3KI 3CCM1 4HGZA 1Z01A 5C4JI 3GTPI 2WAQA 2M6NA 2BJOA 1VQK1 2RBLA 3CCQZ 1N8R1 3PO2I 2LFUA 3G4SZ 4BY1I 1NUIA 1YIJZ 1YI21 3S15I 1VQ9Z 1KD12 4NBFA 1YUKA 1TWFI 2J6AA 3G6EZ 3BG1B 3CCU1 1YHQZ 1NJI1 2RIQA 2R7ZI 3S2HI 1VLAA 2NVXI 3LUSA 1VQOZ 1YJNZ 3VTNA 1S7MA 3I551 1RO4A 2HF1A 3I07A 4NBDA 1Q7Y1 1K8A2 3CME1 3GTQI 3IX0A 4HGYA 4NBCA 4A3GI 1Y1VI 1VQM1 4E2YA 4A3MI 2M48A 3ESWA 5T64A 3J81b 4NBHA 3S2DI 1VQ61 2IZ4A 4MONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  3GKQ A;  4A3E I;  5CM2 M;  2JA8 I;  4BXX I;  1N2F A;  4BBR I;  1WCM I;  3I4M I;  4A3F I;  3RZO I;  2AKL A;  2JR6 A;  3S1M I;  3I4N I;  1SFO I;  3VMG A;  3GTO I;  2PK7 A;  3D6W A;  3S16 I;  2R92 I;  3VMI A;  3RZD I;  4X6A I;  3HOY I;  4QTT A;  4XX2 A;  4A3J I;  2P3Y A;  3VMH A;  1K83 I;  2E2I I;  5IP9 I;  5FLM I;  1PFT A;  1Y1W I;  3K7A I;  1X3Z A;  3PO3 I;  2K5R A;  1TWC I;  3S14 I;  3VB9 A;  3GTM I;  1WW9 A;  3H3V J;  2E2J I;  1TWH I;  5C44 I;  3M4O I;  2JNY A;  1DL6 A;  1TFI A;  3FKI I;  4A3B I;  2JA7 I;  2VUM I;  1X3W A;  1TWA I;  1I50 I;  4NB8 A;  3PO3 S;  3S1Q I;  3GTM S;  4BY7 I;  2F4M A;  3CQZ I;  4A3K I;  3GTJ I;  3HOV I;  2KPI A;  4NOZ A;  5IP7 I;  1L1O C;  3H0G I;  4A93 I;  4NBA A;  5C4J I;  1RLY A;  2NVY I;  2JA5 I;  3GTP I;  1R9T I;  4Y52 I;  2NVQ I;  2BJO A;  2RBL A;  2F4O A;  5C3E I;  3PO2 I;  3U50 C;  3HOW I;  3GTL I;  3M3Y I;  1USP A;  4BY1 I;  4A3L I;  1NUI A;  3S1N I;  1ZB8 A;  3S15 I;  4NBG A;  4QTU A;  4BBS I;  3EER A;  4NBF A;  1TWF I;  2B63 I;  2YU9 I;  2J6A A;  5C4X I;  3Q87 A;  2R7Z I;  4NBB A;  1ML8 A;  1I6H I;  1VLA A;  2NVX I;  3S2H I;  3LUS A;  1Y1V S;  3GCF A;  1I3Q I;  2E2H I;  1RO4 A;  3GTK I;  1LQL A;  2HF1 A;  2DE6 A;  3I07 A;  4NBD A;  1TWG I;  2NVT I;  1ZB9 A;  3GTQ I;  2R93 I;  3S17 I;  3HOX I;  4A3C I;  1QYP A;  4NBC A;  4A3I I;  4A3D I;  4A3G I;  1Y1V I;  4A3M I;  2JA6 I;  3ESW A;  3HOZ I;  4Y7N I;  3S1R I;  2DE7 A;  4NBH A;  3GTG I;  3S2D I;  1USP B;  4NB9 A;  2DE5 A;  1YUA A;  4NBE A;  2JS4 A;  3HOU I; 
#chains in the Genus database with same CATH topology
 1Z03 A;  4MH4 A;  4BXX I;  1N2F A;  3CCR Z;  2Q4Z A;  2V45 A;  2LEX A;  5T67 A;  3CC2 1;  2PK7 A;  3D6W A;  2QEX Z;  1VQ4 1;  3CCL Z;  3S16 I;  1K9M 2;  2QR1 B;  3IFU A;  3HOY I;  4MD7 A;  4XX2 A;  4DGL A;  3BG0 B;  2OOX B;  1PFT A;  3CC7 1;  3PO3 I;  4NH1 C;  4S1T A;  4NFR A;  3NFZ A;  1YJ9 1;  3H3V J;  2I3C A;  1Z02 A;  3KIH A;  1RNI A;  3J7A 4;  4RVG A;  1S72 Z;  2JA7 I;  2VF1 A;  1TWA I;  3PO3 S;  1Q7Y 2;  3CCV Z;  1K73 1;  3EED A;  2KPI A;  4NOZ A;  2VUG A;  5IP7 I;  1JJ2 Z;  1WII A;  3CD6 Z;  4E2Z A;  2QLV B;  4NBA A;  1QVG Z;  4RVF A;  1WJ2 A;  1RLY A;  1VQL Z;  2RHB A;  3CCS 1;  3KIF A;  3CC4 1;  1R9T I;  1JJ2 Y;  1QVG Y;  2NAP A;  3CMA 1;  3HOW I;  3GTL I;  3M3Y I;  1USP A;  2O4H A;  1ZB8 A;  2YAD A;  4QTU A;  3HKZ A;  4BBS I;  2QKD A;  4RVH A;  3I56 1;  2YU9 I;  4E30 A;  5C4X I;  3CCM Z;  3FQQ A;  3GCF A;  3CXC Z;  2OTL 1;  1LQL A;  2VPX A;  1VQ7 1;  4E32 A;  2OTJ 1;  2R93 I;  1VQP 1;  1VQ5 Z;  1VQK Z;  3CXC Y;  1P9N A;  4E2X A;  3S1R I;  3TDH B;  3GTG I;  1Q82 1;  2K3R A;  1YI2 Z;  4NB9 A;  1K73 2;  4DQY B;  2GU2 A;  1VQ8 1;  1QVF Z;  3CCU Z;  4NBE A;  3J80 b;  1M1K 1;  2Y0S A;  2JS4 A;  3CCJ 1;  3JAM b;  2IZ3 A;  3G4S 1;  2PM9 A;  3GKQ A;  2PMZ A;  5CM2 M;  2JA8 I;  2KI7 B;  4BBR I;  1QVF Y;  3I4M I;  1YJW 1;  2E7Z A;  2AKL A;  3S1M I;  4E31 A;  3MON A;  3CME Z;  3G6E 1;  2JIO A;  3IR7 A;  1YHQ 1;  3VMI A;  2V8K A;  1VQM Z;  3NDI A;  1VQO 1;  4QTT A;  3OW2 Z;  1YJN 1;  2P3Y A;  1VQN Z;  5IP9 I;  5LL6 f;  5FLM I;  3K7A I;  1TWC I;  2OOY B;  1M90 1;  2OZK A;  2JMO A;  5IT9 f;  3OW2 Y;  3G71 Z;  2E2J I;  3M4O I;  1SIW A;  4DK1 A;  2JNY A;  1DL6 A;  1TFI A;  3D9X A;  4A3B I;  3MZK B;  1KC8 1;  2H85 A;  4BY7 I;  4MRI A;  2JIM A;  3CQZ I;  2V8J A;  3GTJ I;  3HOV I;  1N8R 2;  1VQ4 Z;  1L1O C;  1KQS Y;  4A93 I;  3NH8 A;  1RO0 A;  2NVY I;  1Q16 A;  3CPW Z;  3CC7 Z;  1YIT 1;  1NJI 2;  5T6B A;  3CCE Z;  2F4O A;  3CCL 1;  1YJ9 Z;  3U50 C;  4RVD A;  3CPW Y;  1FDO A;  4A3L I;  3EER A;  2B63 I;  3TE5 B;  4MXU A;  3Q87 A;  1I6H I;  1ML8 A;  2GTH A;  2JIQ A;  3P5J B;  1I3Q I;  2O53 A;  2E2H I;  3F3F C;  1RQF A;  2QRE B;  1TWG I;  1ZB9 A;  1ZH1 A;  1KD1 1;  2QA4 Z;  3S17 I;  2Q51 A;  4A3C I;  2P28 A;  4A3D I;  2QRC B;  4TNU A;  3F3P C;  3CMA Z;  4EWC A;  1W2B Z;  2HU9 A;  3HOZ I;  3J80 f;  4Y7N I;  3JAM f;  1USP B;  2VPZ A;  2DE5 A;  1VQL 1;  1YUA A;  1WZN A;  5D1O A;  1W2B Y;  4AYB A;  3J81 f;  4MD8 A;  1VQ7 Z;  1KRL A;  3RZO I;  3I4N I;  1SFO I;  3VMG A;  1VQP Z;  2LIY A;  3RZD I;  2QRD B;  4E33 A;  2E9H A;  3NH5 A;  2G2K A;  3VMH A;  1K83 I;  2RT9 A;  1QF8 A;  2K5R A;  4HH4 A;  3VB9 A;  1VQ5 1;  1VQ8 Z;  3CCQ 1;  3T4N B;  5C44 I;  3CCJ Z;  3I55 Z;  1YIJ 1;  3FKI I;  3NDJ A;  1K9M 1;  1Q81 1;  2VUM I;  1X3W A;  1I50 I;  1VQ9 1;  4NB8 A;  1JWH C;  3S1Q I;  2EGT A;  2W03 A;  2F4M A;  1YJW Z;  1Q86 1;  2ZAE B;  3H0G I;  5A2Q b;  5FLX b;  1VQ6 Z;  2JA5 I;  4Y52 I;  4MD9 A;  2NVQ I;  2R6M A;  1RO2 A;  5C3E I;  3S1N I;  1KQS Z;  4NBG A;  3NH4 A;  3CC2 Z;  4NBB A;  1VQN 1;  3FQM A;  3G71 1;  1Y1V S;  2GTI A;  1Q82 2;  4E2W A;  3GTK I;  2IV2 X;  3CCR 1;  2DE6 A;  1YIT Z;  2NVT I;  1X0T A;  1M1K 2;  3HOX I;  2QEX 1;  1QYP A;  4A3I I;  2WB1 A;  2JA6 I;  2DE7 A;  1Q81 2;  2JUB A;  4RV9 A;  4RS4 A;  1NP6 A;  3CCE 1;  1Q86 2;  4CL1 A;  3HOU I;  1S72 1;  4A3E I;  2W04 A;  5D1P A;  3CCS Z;  1Y8C A;  3CCV 1;  3CC4 Z;  1M90 2;  1WCM I;  4A3F I;  2JR6 A;  3MZL B;  3QWU A;  5IT9 b;  3GTO I;  2JIP A;  2R92 I;  3CD6 1;  2V8I A;  4X6A I;  1KC8 2;  4A3J I;  2E2I I;  1Y1W I;  1X3Z A;  1K8A 1;  3S14 I;  3I56 Z;  3GTM I;  2RPR A;  1WW9 A;  2QA4 1;  5D1O B;  1TWH I;  2JIR A;  3IF8 A;  5AN9 F;  2OTL Z;  5A2Q f;  2V3V A;  5FLX f;  2OTJ Z;  3GTM S;  4A3K I;  3CCM 1;  4HGZ A;  1Z01 A;  5C4J I;  3GTP I;  2WAQ A;  2M6N A;  2BJO A;  1VQK 1;  2RBL A;  3CCQ Z;  1N8R 1;  3PO2 I;  2LFU A;  3G4S Z;  4BY1 I;  1NUI A;  1YIJ Z;  1YI2 1;  3S15 I;  2AYD A;  1FDI A;  1VQ9 Z;  1QXF A;  1KD1 2;  4NBF A;  1YUK A;  1TWF I;  2J6A A;  3G6E Z;  3BG1 B;  3CCU 1;  1YHQ Z;  1NJI 1;  2RIQ A;  2R7Z I;  3S2H I;  1VLA A;  2NVX I;  3LUS A;  1VQO Z;  2VPW A;  1YJN Z;  3VTN A;  1S7M A;  3I55 1;  1RO4 A;  2HF1 A;  3I07 A;  4NBD A;  1Q7Y 1;  1K8A 2;  3D2L A;  3CME 1;  3GTQ I;  3IX0 A;  4HGY A;  4NBC A;  4A3G I;  1Y1V I;  1VQM 1;  4E2Y A;  4A3M I;  2M48 A;  3ESW A;  5T64 A;  3J81 b;  4NBH A;  3S2D I;  1VQ6 1;  1AA6 A;  2VPY A;  2IZ4 A;  4MON A; 
#chains in the Genus database with same CATH homology
 1Z03 A;  4MH4 A;  4BXX I;  1N2F A;  3CCR Z;  2Q4Z A;  5T67 A;  3CC2 1;  2PK7 A;  3D6W A;  2QEX Z;  1VQ4 1;  3CCL Z;  3S16 I;  1K9M 2;  2QR1 B;  3IFU A;  3HOY I;  4MD7 A;  4XX2 A;  4DGL A;  3BG0 B;  2OOX B;  1PFT A;  3CC7 1;  3PO3 I;  4NH1 C;  4S1T A;  4NFR A;  3NFZ A;  1YJ9 1;  3H3V J;  2I3C A;  1Z02 A;  3KIH A;  1RNI A;  3J7A 4;  4RVG A;  1S72 Z;  2JA7 I;  2VF1 A;  1TWA I;  3PO3 S;  1Q7Y 2;  3CCV Z;  1K73 1;  3EED A;  2KPI A;  4NOZ A;  2VUG A;  5IP7 I;  1JJ2 Z;  1WII A;  3CD6 Z;  4E2Z A;  2QLV B;  4NBA A;  1QVG Z;  4RVF A;  1RLY A;  1VQL Z;  2RHB A;  3CCS 1;  3KIF A;  3CC4 1;  1R9T I;  1JJ2 Y;  1QVG Y;  3CMA 1;  3HOW I;  3GTL I;  3M3Y I;  1USP A;  2O4H A;  1ZB8 A;  2YAD A;  4QTU A;  3HKZ A;  4BBS I;  2QKD A;  4RVH A;  3I56 1;  2YU9 I;  4E30 A;  5C4X I;  3CCM Z;  3FQQ A;  3GCF A;  3CXC Z;  2OTL 1;  1LQL A;  1VQ7 1;  4E32 A;  2OTJ 1;  2R93 I;  1VQP 1;  1VQ5 Z;  1VQK Z;  3CXC Y;  1P9N A;  4E2X A;  3S1R I;  3TDH B;  3GTG I;  1Q82 1;  2K3R A;  1YI2 Z;  4NB9 A;  1K73 2;  4DQY B;  2GU2 A;  1VQ8 1;  1QVF Z;  3CCU Z;  4NBE A;  3J80 b;  1M1K 1;  2Y0S A;  2JS4 A;  3CCJ 1;  3JAM b;  2IZ3 A;  3G4S 1;  2PM9 A;  3GKQ A;  2PMZ A;  5CM2 M;  2JA8 I;  2KI7 B;  4BBR I;  1QVF Y;  3I4M I;  1YJW 1;  2AKL A;  3S1M I;  4E31 A;  3MON A;  3CME Z;  3G6E 1;  1YHQ 1;  3VMI A;  2V8K A;  1VQM Z;  3NDI A;  1VQO 1;  4QTT A;  3OW2 Z;  1YJN 1;  2P3Y A;  1VQN Z;  5IP9 I;  5LL6 f;  5FLM I;  3K7A I;  1TWC I;  2OOY B;  1M90 1;  2OZK A;  2JMO A;  5IT9 f;  3OW2 Y;  3G71 Z;  2E2J I;  3M4O I;  4DK1 A;  2JNY A;  1DL6 A;  1TFI A;  3D9X A;  4A3B I;  3MZK B;  1KC8 1;  2H85 A;  4BY7 I;  4MRI A;  3CQZ I;  2V8J A;  3GTJ I;  3HOV I;  1N8R 2;  1VQ4 Z;  1L1O C;  1KQS Y;  4A93 I;  3NH8 A;  1RO0 A;  2NVY I;  3CPW Z;  3CC7 Z;  1YIT 1;  1NJI 2;  5T6B A;  3CCE Z;  2F4O A;  3CCL 1;  1YJ9 Z;  3U50 C;  4RVD A;  3CPW Y;  4A3L I;  3EER A;  2B63 I;  3TE5 B;  4MXU A;  3Q87 A;  1I6H I;  1ML8 A;  2GTH A;  3P5J B;  1I3Q I;  2O53 A;  2E2H I;  3F3F C;  1RQF A;  2QRE B;  1TWG I;  1ZB9 A;  1ZH1 A;  1KD1 1;  2QA4 Z;  3S17 I;  2Q51 A;  4A3C I;  2P28 A;  4A3D I;  2QRC B;  4TNU A;  3F3P C;  3CMA Z;  4EWC A;  1W2B Z;  2HU9 A;  3HOZ I;  3J80 f;  4Y7N I;  3JAM f;  1USP B;  2DE5 A;  1VQL 1;  1YUA A;  5D1O A;  1W2B Y;  4AYB A;  3J81 f;  4MD8 A;  1VQ7 Z;  1KRL A;  3RZO I;  3I4N I;  1SFO I;  3VMG A;  1VQP Z;  2LIY A;  3RZD I;  2QRD B;  4E33 A;  2E9H A;  3NH5 A;  2G2K A;  3VMH A;  1K83 I;  2RT9 A;  1QF8 A;  2K5R A;  4HH4 A;  3VB9 A;  1VQ5 1;  1VQ8 Z;  3CCQ 1;  3T4N B;  5C44 I;  3CCJ Z;  3I55 Z;  1YIJ 1;  3FKI I;  3NDJ A;  1K9M 1;  1Q81 1;  2VUM I;  1X3W A;  1I50 I;  1VQ9 1;  4NB8 A;  1JWH C;  3S1Q I;  2EGT A;  2W03 A;  2F4M A;  1YJW Z;  1Q86 1;  2ZAE B;  3H0G I;  5A2Q b;  5FLX b;  1VQ6 Z;  2JA5 I;  4Y52 I;  4MD9 A;  2NVQ I;  2R6M A;  1RO2 A;  5C3E I;  3S1N I;  1KQS Z;  4NBG A;  3NH4 A;  3CC2 Z;  4NBB A;  1VQN 1;  3FQM A;  3G71 1;  1Y1V S;  2GTI A;  1Q82 2;  4E2W A;  3GTK I;  3CCR 1;  2DE6 A;  1YIT Z;  2NVT I;  1X0T A;  1M1K 2;  3HOX I;  2QEX 1;  1QYP A;  4A3I I;  2WB1 A;  2JA6 I;  2DE7 A;  1Q81 2;  2JUB A;  4RV9 A;  4RS4 A;  1NP6 A;  3CCE 1;  1Q86 2;  4CL1 A;  3HOU I;  1S72 1;  4A3E I;  2W04 A;  5D1P A;  3CCS Z;  3CCV 1;  3CC4 Z;  1M90 2;  1WCM I;  4A3F I;  2JR6 A;  3MZL B;  3QWU A;  5IT9 b;  3GTO I;  2R92 I;  3CD6 1;  2V8I A;  4X6A I;  1KC8 2;  4A3J I;  2E2I I;  1Y1W I;  1X3Z A;  1K8A 1;  3S14 I;  3I56 Z;  3GTM I;  2RPR A;  1WW9 A;  2QA4 1;  5D1O B;  1TWH I;  3IF8 A;  5AN9 F;  2OTL Z;  5A2Q f;  5FLX f;  2OTJ Z;  3GTM S;  4A3K I;  3CCM 1;  4HGZ A;  1Z01 A;  5C4J I;  3GTP I;  2WAQ A;  2M6N A;  2BJO A;  1VQK 1;  2RBL A;  3CCQ Z;  1N8R 1;  3PO2 I;  2LFU A;  3G4S Z;  4BY1 I;  1NUI A;  1YIJ Z;  1YI2 1;  3S15 I;  1VQ9 Z;  1KD1 2;  4NBF A;  1YUK A;  1TWF I;  2J6A A;  3G6E Z;  3BG1 B;  3CCU 1;  1YHQ Z;  1NJI 1;  2RIQ A;  2R7Z I;  3S2H I;  1VLA A;  2NVX I;  3LUS A;  1VQO Z;  1YJN Z;  3VTN A;  1S7M A;  3I55 1;  1RO4 A;  2HF1 A;  3I07 A;  4NBD A;  1Q7Y 1;  1K8A 2;  3CME 1;  3GTQ I;  3IX0 A;  4HGY A;  4NBC A;  4A3G I;  1Y1V I;  1VQM 1;  4E2Y A;  4A3M I;  2M48 A;  3ESW A;  5T64 A;  3J81 b;  4NBH A;  3S2D I;  1VQ6 1;  2IZ4 A;  4MON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...