1TFIA

A novel zn finger motif in the basal transcriptional machinery: three-dimensional nmr studies of the nucleic-acid binding domain of transcriptional elongation factor tfiis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL ELONGATION FACTOR SII
publication title Novel zinc finger motif in the basal transcriptional machinery: three-dimensional NMR studies of the nucleic acid binding domain of transcriptional elongation factor TFIIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1tfiA00
1LQLA 4NBAA 2NVXI 4MH4A 1N2FA 1R9TI 4NBCA 3Q87A 4BXXI 4A3JI 3GTMI 1X3ZA 1Y1VS 2E2HI 1Y1WI 3S1QI 3VMHA 4XX2A 2F4OA 3S14I 3I07A 1NUIA 4NBGA 3RZDI 3S1NI 3HOWI 5C4XI 4A3FI 3S2DI 2E2JI 1I50I 2F4MA 4NBDA 3RZOI 1WW9A 3S17I 4X6AI 4NBBA 1Y1VI 1TWFI 2J6AA 2JA6I 1TWGI 3PO3S 4A3II 3FKII 5C3EI 4A3MI 1USPA 2DE7A 1PFTA 4NBEA 1I6HI 4A3KI 3S16I 3GKQA 3S1RI 3M3YI 2BJOA 3HOUI 2VUMI 3K7AI 4A93I 5FLMI 1TWCI 3PO3I 1TFIA 4NBHA 1I3QI 2PK7A 3HOYI 3HOXI 3S15I 3S2HI 3U50C 2R92I 3GCFA 1SFOI 4NOZA 4BBSI 1RO4A 3EERA 3GTJI 3GTPI 3HOZI 1TWHI 2JA5I 2NVYI 3I4NI 4QTUA 2E2II 5IP9I 5IP7I 4Y7NI 4BY7I 4A3GI 3VMIA 3GTGI 3GTLI 3ESWA 1ZB9A 3D6WA 4NB8A 2B63I 2NVQI 4Y52I 2NVTI 3PO2I 2JA7I 1VLAA 5CM2M 3GTKI 5C44I 2JNYA 3CQZI 2JA8I 2K5RA 4NB9A 2RBLA 2HF1A 2JR6A 1DL6A 4QTTA 4A3LI 4BY1I 1ML8A 2JS4A 1TWAI 4A3BI 3VB9A 5C4JI 1RLYA 3GTQI 1QYPA 2P3YA 2YU9I 4A3EI 4A3DI 1X3WA 2AKLA 3VMGA 1USPB 3GTOI 3H3VJ 3LUSA 3GTMS 1ZB8A 2R7ZI 3M4OI 2DE5A 4A3CI 1K83I 2KPIA 4NBFA 3S1MI 1L1OC 3HOVI 3I4MI 1YUAA 3H0GI 2R93I 1WCMI 4BBRI 2DE6A
chains in the Genus database with same CATH superfamily
3OW2Y 3MZKB 3D2LA 4NBAA 1Q822 4BXXI 1YJWZ 2JIRA 2RT9A 4E31A 3S1NI 3CCRZ 4MD9A 1WJ2A 1I50I 2IZ4A 4MD7A 4RS4A 1N8R2 1Y1VI 4NBBA 3CCEZ 1QF8A 1FDOA 1S7MA 1YI21 1S721 2DE7A 4NBEA 3S16I 3GKQA 1KC81 1QVGZ 3S1RI 3M3YI 2BJOA 2YADA 4RVDA 5FLXb 2W04A 5T6BA 1YJW1 1I3QI 1VQLZ 3HOXI 2R92I 2AYDA 1K731 3CCR1 2JA5I 2NVYI 3TE5B 2IV2X 1M902 2LFUA 2JIOA 4QTUA 2V8KA 1Q861 4BY7I 1JJ2Y 3GTGI 4E2ZA 3CCE1 1ZB9A 1WIIA 4CL1A 1K8A1 4NB8A 3FQQA 3CCSZ 3I561 4MD8A 1VLAA 5CM2M 5C44I 1VQK1 3CQZI 2M6NA 2OOYB 2V8IA 5D1OA 1DL6A 1YJNZ 1TWAI 2HU9A 1AA6A 2VPYA 1VQL1 2GTHA 1RLYA 1W2BZ 4DQYB 4A3DI 1X3WA 2AKLA 1P9NA 3JAMf 1USPB 3H3VJ 3LUSA 1M1K1 2DE5A 2KPIA 3CC2Z 1L1OC 5AN9F 1X0TA 2R93I 2KI7B 1WCMI 4BBRI 3CCS1 1RQFA 4EWCA 4A3JI 5IT9b 1KQSZ 1Y1VS 2E2HI 1YJN1 3S14I 1YJ9Z 3F3PC 3CCL1 2QA4Z 4A3FI 2E7ZA 3BG0B 3CMAZ 1W2BY 2F4MA 4NBDA 3S2DI 1VQ9Z 3RZOI 1KD11 1QXFA 1NJI2 1VQ5Z 2M48A 1VQP1 3FKII 5C3EI 3CC7Z 3D9XA 5IT9f 2O4HA 2RPRA 1JWHC 3CCUZ 4A3KI 2QLVB 3CC4Z 3NDIA 1VQ7Z 3EEDA 1ZH1A 4HGZA 4NH1C 2WB1A 1Q812 3CMEZ 2GU2A 2PK7A 3HOYI 3S2HI 3U50C 3GCFA 1YJ91 4BBSI 1VQ81 2QA41 1TWHI 2JMOA 3CMA1 3NH8A 1VQ91 2E2II 4Y7NI 4A3GI 3GTLI 1K9M2 1Z02A 1WZNA 1VQ51 2PM9A 2WAQA 3TDHB 1VQNZ 5T64A 3CC71 2NVTI 4HGYA 1VQ4Z 3CCU1 2JNYA 3CC41 3CPWZ 2JA8I 2W03A 3G6EZ 2RBLA 2HF1A 1VQ71 1FDIA 4QTTA 2H85A 2JS4A 5D1PA 4E2YA 3J81b 3I55Z 1VQ6Z 2IZ3A 4A3BI 1RO0A 2OTJZ 2Y0SA 4A3EI 1YUKA 5FLXf 3VTNA 2NAPA 3GTOI 1ZB8A 5A2Qb 4E30A 3CXCZ 1Q7Y1 1QVGY 4TNUA 3P5JB 3IR7A 1RO2A 2ZAEB 2QREB 1Q16A 1VQOZ 1LQLA 1QVFZ 2P28A 4MH4A 2NVXI 1VQ41 1R9TI 4NBCA 3Q87A 3J81f 3CPWY 1SIWA 5LL6f 1KC82 3IFUA 2VF1A 2Q51A 1X3ZA 3G71Z 3G6E1 1Y1WI 2GTIA 3S1QI 2VPWA 3VMHA 3CCQZ 2F4OA 2G2KA 3RZDI 3NFZA 1YIJZ 4HH4A 3I551 1YITZ 1VQ61 2E2JI 2OTJ1 1K732 1WW9A 4X6AI 1TWFI 2JIPA 2JA6I 1TWGI 1Z03A 4RVGA 4A3MI 1USPA 2QKDA 1Q821 1PFTA 1I6HI 1QVFY 1VQO1 2VUGA 3FQMA 3T4NB 2VUMI 3K7AI 2JIQA 4A93I 1NP6A 1TWCI 3PO3I 4NBHA 2K3RA 3S15I 3IX0A 3CCQ1 1SFOI 4RVHA 2JIMA 4E33A 3GTPI 1N8R1 3NH4A 1YIT1 2I3CA 3G4SZ 3I4NI 5IP9I 3CC21 3VMIA 1K9M1 5T67A 1RNIA 1YI2Z 2JA7I 2O53A 1KQSY 3CD6Z 3CCMZ 2QRCB 4NB9A 2QEXZ 3F3FC 4RVFA 2JR6A 2E9HA 3MZLB 4DK1A 2LIYA 3IF8A 3VB9A 1M901 3GTQI 2EGTA 2Q4ZA 4RV9A 2P3YA 2YU9I 4MXUA 3VMGA 3G4S1 2R7ZI 3M4OI 1K83I 1KD12 3S1MI 3I4MI 1YUAA 3H0GI 3NDJA 1JJ2Z 1N2FA 3I56Z 3CD61 3CME1 3CCM1 1VQKZ 3GTMI 2QEX1 4E2XA 4MRIA 4XX2A 3I07A 1NUIA 4NBGA 3HOWI 5C4XI 4E32A 3S17I 2OZKA 3CCJZ 1VQN1 2J6AA 3PO3S 4A3II 1Y8CA 4AYBA 2RHBA 4MONA 2RIQA 1YHQZ 2JUBA 3CCVZ 4DGLA 5D1OB 3HOUI 3J80b 3JAMb 5A2Qf 5FLMI 1TFIA 4NOZA 1RO4A 3EERA 3GTJI 3HOZI 3CXCY 1VQMZ 3CCLZ 1NJI1 1Q862 5IP7I 4S1TA 3CCJ1 2R6MA 1K8A2 3ESWA 2OTLZ 3D6WA 3HKZA 3QWUA 2QRDB 3J80f 2B63I 2NVQI 4Y52I 1Q7Y2 1VQPZ 3PO2I 3BG1B 1YHQ1 3GTKI 3OW2Z 3CCV1 2PMZA 3G711 2VPZA 1Q811 2K5RA 3KIHA 4A3LI 1YIJ1 4BY1I 2VPXA 1ML8A 2LEXA 3J7A4 2OOXB 4NFRA 5C4JI 1QYPA 3NH5A 2V45A 4E2WA 1KRLA 2V8JA 3MONA 1VQM1 2V3VA 1M1K2 1VQ8Z 3KIFA 3GTMS 1S72Z 4A3CI 1Z01A 4NBFA 2OTL1 3HOVI 2QR1B 2DE6A
chains in the Genus database with same CATH topology
3OW2Y 3MZKB 4NBAA 1Q822 4BXXI 1YJWZ 2RT9A 4E31A 3S1NI 3CCRZ 4MD9A 1I50I 2IZ4A 4MD7A 4RS4A 1N8R2 1Y1VI 4NBBA 3CCEZ 1QF8A 1S7MA 1YI21 1S721 2DE7A 4NBEA 3S16I 3GKQA 1KC81 1QVGZ 3S1RI 3M3YI 2BJOA 2YADA 4RVDA 5FLXb 2W04A 5T6BA 1YJW1 1I3QI 1VQLZ 3HOXI 2R92I 1K731 3CCR1 2JA5I 2NVYI 3TE5B 1M902 2LFUA 4QTUA 2V8KA 1Q861 4BY7I 1JJ2Y 3GTGI 4E2ZA 3CCE1 1ZB9A 1WIIA 4CL1A 1K8A1 4NB8A 3FQQA 3CCSZ 3I561 4MD8A 1VLAA 5CM2M 5C44I 1VQK1 3CQZI 2M6NA 2OOYB 2V8IA 5D1OA 1DL6A 1YJNZ 1TWAI 2HU9A 1VQL1 2GTHA 1RLYA 1W2BZ 4DQYB 4A3DI 1X3WA 2AKLA 1P9NA 3JAMf 1USPB 3H3VJ 3LUSA 1M1K1 2DE5A 2KPIA 3CC2Z 1L1OC 5AN9F 1X0TA 2R93I 2KI7B 1WCMI 4BBRI 3CCS1 1RQFA 4EWCA 4A3JI 5IT9b 1KQSZ 1Y1VS 2E2HI 1YJN1 3S14I 1YJ9Z 3F3PC 3CCL1 2QA4Z 4A3FI 3BG0B 1W2BY 3CMAZ 3S2DI 2F4MA 4NBDA 1VQ9Z 3RZOI 1KD11 1NJI2 1VQ5Z 2M48A 1VQP1 3FKII 5C3EI 3CC7Z 3D9XA 5IT9f 2O4HA 2RPRA 1JWHC 3CCUZ 4A3KI 2QLVB 3CC4Z 3NDIA 1VQ7Z 3EEDA 1ZH1A 4HGZA 4NH1C 2WB1A 1Q812 3CMEZ 2GU2A 2PK7A 3HOYI 3S2HI 3U50C 3GCFA 1YJ91 4BBSI 1VQ81 2QA41 1TWHI 2JMOA 3CMA1 3NH8A 1VQ91 2E2II 4Y7NI 4A3GI 3GTLI 1K9M2 1Z02A 1VQ51 2PM9A 2WAQA 3TDHB 1VQNZ 5T64A 3CC71 2NVTI 4HGYA 1VQ4Z 3CCU1 2JNYA 3CC41 3CPWZ 2JA8I 2W03A 3G6EZ 2RBLA 2HF1A 1VQ71 4QTTA 2H85A 2JS4A 5D1PA 4E2YA 3J81b 3I55Z 1VQ6Z 2IZ3A 4A3BI 1RO0A 2OTJZ 2Y0SA 4A3EI 1YUKA 5FLXf 3VTNA 3GTOI 1ZB8A 5A2Qb 4E30A 3CXCZ 1Q7Y1 1QVGY 4TNUA 3P5JB 1RO2A 2ZAEB 2QREB 1VQOZ 1LQLA 1QVFZ 2P28A 4MH4A 2NVXI 1VQ41 1R9TI 4NBCA 3Q87A 3J81f 3CPWY 5LL6f 1KC82 3IFUA 2VF1A 2Q51A 1X3ZA 3G71Z 3G6E1 1Y1WI 2GTIA 3S1QI 3VMHA 3CCQZ 2F4OA 2G2KA 3RZDI 3NFZA 1YIJZ 4HH4A 3I551 1YITZ 1VQ61 2E2JI 2OTJ1 1K732 1WW9A 4X6AI 1TWFI 2JA6I 1TWGI 1Z03A 4RVGA 4A3MI 1USPA 2QKDA 1Q821 1PFTA 1I6HI 1QVFY 1VQO1 2VUGA 3FQMA 3T4NB 2VUMI 3K7AI 4A93I 1NP6A 1TWCI 3PO3I 4NBHA 2K3RA 3S15I 3IX0A 3CCQ1 1SFOI 4RVHA 4E33A 3GTPI 1N8R1 3NH4A 1YIT1 2I3CA 3G4SZ 3I4NI 5IP9I 3CC21 3VMIA 1K9M1 5T67A 1RNIA 1YI2Z 2JA7I 2O53A 1KQSY 3CD6Z 3CCMZ 2QRCB 4NB9A 2QEXZ 3F3FC 4RVFA 2JR6A 2E9HA 3MZLB 4DK1A 2LIYA 3IF8A 3VB9A 1M901 3GTQI 2EGTA 2Q4ZA 4RV9A 2P3YA 2YU9I 4MXUA 3VMGA 3G4S1 2R7ZI 3M4OI 1K83I 1KD12 3S1MI 3I4MI 1YUAA 3H0GI 3NDJA 1JJ2Z 1N2FA 3I56Z 3CD61 3CME1 3CCM1 1VQKZ 3GTMI 2QEX1 4E2XA 4MRIA 4XX2A 3I07A 1NUIA 4NBGA 3HOWI 5C4XI 4E32A 3S17I 2OZKA 3CCJZ 1VQN1 2J6AA 3PO3S 4A3II 4AYBA 2RHBA 4MONA 2RIQA 1YHQZ 2JUBA 3CCVZ 4DGLA 5D1OB 3HOUI 3J80b 3JAMb 5A2Qf 5FLMI 1TFIA 4NOZA 1RO4A 3EERA 3GTJI 3HOZI 3CXCY 1VQMZ 3CCLZ 1NJI1 1Q862 5IP7I 4S1TA 3CCJ1 2R6MA 1K8A2 3ESWA 2OTLZ 3D6WA 3HKZA 3QWUA 2QRDB 3J80f 2B63I 2NVQI 4Y52I 1Q7Y2 1VQPZ 3PO2I 3BG1B 1YHQ1 3GTKI 3OW2Z 3CCV1 2PMZA 3G711 1Q811 2K5RA 3KIHA 4A3LI 1YIJ1 4BY1I 1ML8A 3J7A4 2OOXB 4NFRA 5C4JI 1QYPA 3NH5A 4E2WA 1KRLA 2V8JA 3MONA 1VQM1 1M1K2 1VQ8Z 3KIFA 3GTMS 1S72Z 4A3CI 1Z01A 4NBFA 2OTL1 3HOVI 2QR1B 2DE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4NBA A;  2NVX I;  4MH4 A;  1N2F A;  1R9T I;  4NBC A;  3Q87 A;  4BXX I;  4A3J I;  3GTM I;  1X3Z A;  1Y1V S;  2E2H I;  1Y1W I;  3S1Q I;  3VMH A;  4XX2 A;  2F4O A;  3S14 I;  3I07 A;  1NUI A;  4NBG A;  3RZD I;  3S1N I;  3HOW I;  5C4X I;  4A3F I;  3S2D I;  2E2J I;  1I50 I;  2F4M A;  4NBD A;  3RZO I;  1WW9 A;  3S17 I;  4X6A I;  4NBB A;  1Y1V I;  1TWF I;  2J6A A;  2JA6 I;  1TWG I;  3PO3 S;  4A3I I;  3FKI I;  5C3E I;  4A3M I;  1USP A;  2DE7 A;  1PFT A;  4NBE A;  1I6H I;  4A3K I;  3S16 I;  3GKQ A;  3S1R I;  3M3Y I;  2BJO A;  3HOU I;  2VUM I;  3K7A I;  4A93 I;  5FLM I;  1TWC I;  3PO3 I;  1TFI A;  4NBH A;  1I3Q I;  2PK7 A;  3HOY I;  3HOX I;  3S15 I;  3S2H I;  3U50 C;  2R92 I;  3GCF A;  1SFO I;  4NOZ A;  4BBS I;  1RO4 A;  3EER A;  3GTJ I;  3GTP I;  3HOZ I;  1TWH I;  2JA5 I;  2NVY I;  3I4N I;  4QTU A;  2E2I I;  5IP9 I;  5IP7 I;  4Y7N I;  4BY7 I;  4A3G I;  3VMI A;  3GTG I;  3GTL I;  3ESW A;  1ZB9 A;  3D6W A;  4NB8 A;  2B63 I;  2NVQ I;  4Y52 I;  2NVT I;  3PO2 I;  2JA7 I;  1VLA A;  5CM2 M;  3GTK I;  5C44 I;  2JNY A;  3CQZ I;  2JA8 I;  2K5R A;  4NB9 A;  2RBL A;  2HF1 A;  2JR6 A;  1DL6 A;  4QTT A;  4A3L I;  4BY1 I;  1ML8 A;  2JS4 A;  1TWA I;  4A3B I;  3VB9 A;  5C4J I;  1RLY A;  3GTQ I;  1QYP A;  2P3Y A;  2YU9 I;  4A3E I;  4A3D I;  1X3W A;  2AKL A;  3VMG A;  1USP B;  3GTO I;  3H3V J;  3LUS A;  3GTM S;  1ZB8 A;  2R7Z I;  3M4O I;  2DE5 A;  4A3C I;  1K83 I;  2KPI A;  4NBF A;  3S1M I;  1L1O C;  3HOV I;  3I4M I;  1YUA A;  3H0G I;  2R93 I;  1WCM I;  4BBR I;  2DE6 A; 
#chains in the Genus database with same CATH topology
 3OW2 Y;  3MZK B;  3D2L A;  4NBA A;  1Q82 2;  4BXX I;  1YJW Z;  2JIR A;  2RT9 A;  4E31 A;  3S1N I;  3CCR Z;  4MD9 A;  1WJ2 A;  1I50 I;  2IZ4 A;  4MD7 A;  4RS4 A;  1N8R 2;  1Y1V I;  4NBB A;  3CCE Z;  1QF8 A;  1FDO A;  1S7M A;  1YI2 1;  1S72 1;  2DE7 A;  4NBE A;  3S16 I;  3GKQ A;  1KC8 1;  1QVG Z;  3S1R I;  3M3Y I;  2BJO A;  2YAD A;  4RVD A;  5FLX b;  2W04 A;  5T6B A;  1YJW 1;  1I3Q I;  1VQL Z;  3HOX I;  2R92 I;  2AYD A;  1K73 1;  3CCR 1;  2JA5 I;  2NVY I;  3TE5 B;  2IV2 X;  1M90 2;  2LFU A;  2JIO A;  4QTU A;  2V8K A;  1Q86 1;  4BY7 I;  1JJ2 Y;  3GTG I;  4E2Z A;  3CCE 1;  1ZB9 A;  1WII A;  4CL1 A;  1K8A 1;  4NB8 A;  3FQQ A;  3CCS Z;  3I56 1;  4MD8 A;  1VLA A;  5CM2 M;  5C44 I;  1VQK 1;  3CQZ I;  2M6N A;  2OOY B;  2V8I A;  5D1O A;  1DL6 A;  1YJN Z;  1TWA I;  2HU9 A;  1AA6 A;  2VPY A;  1VQL 1;  2GTH A;  1RLY A;  1W2B Z;  4DQY B;  4A3D I;  1X3W A;  2AKL A;  1P9N A;  3JAM f;  1USP B;  3H3V J;  3LUS A;  1M1K 1;  2DE5 A;  2KPI A;  3CC2 Z;  1L1O C;  5AN9 F;  1X0T A;  2R93 I;  2KI7 B;  1WCM I;  4BBR I;  3CCS 1;  1RQF A;  4EWC A;  4A3J I;  5IT9 b;  1KQS Z;  1Y1V S;  2E2H I;  1YJN 1;  3S14 I;  1YJ9 Z;  3F3P C;  3CCL 1;  2QA4 Z;  4A3F I;  2E7Z A;  3BG0 B;  3CMA Z;  1W2B Y;  2F4M A;  4NBD A;  3S2D I;  1VQ9 Z;  3RZO I;  1KD1 1;  1QXF A;  1NJI 2;  1VQ5 Z;  2M48 A;  1VQP 1;  3FKI I;  5C3E I;  3CC7 Z;  3D9X A;  5IT9 f;  2O4H A;  2RPR A;  1JWH C;  3CCU Z;  4A3K I;  2QLV B;  3CC4 Z;  3NDI A;  1VQ7 Z;  3EED A;  1ZH1 A;  4HGZ A;  4NH1 C;  2WB1 A;  1Q81 2;  3CME Z;  2GU2 A;  2PK7 A;  3HOY I;  3S2H I;  3U50 C;  3GCF A;  1YJ9 1;  4BBS I;  1VQ8 1;  2QA4 1;  1TWH I;  2JMO A;  3CMA 1;  3NH8 A;  1VQ9 1;  2E2I I;  4Y7N I;  4A3G I;  3GTL I;  1K9M 2;  1Z02 A;  1WZN A;  1VQ5 1;  2PM9 A;  2WAQ A;  3TDH B;  1VQN Z;  5T64 A;  3CC7 1;  2NVT I;  4HGY A;  1VQ4 Z;  3CCU 1;  2JNY A;  3CC4 1;  3CPW Z;  2JA8 I;  2W03 A;  3G6E Z;  2RBL A;  2HF1 A;  1VQ7 1;  1FDI A;  4QTT A;  2H85 A;  2JS4 A;  5D1P A;  4E2Y A;  3J81 b;  3I55 Z;  1VQ6 Z;  2IZ3 A;  4A3B I;  1RO0 A;  2OTJ Z;  2Y0S A;  4A3E I;  1YUK A;  5FLX f;  3VTN A;  2NAP A;  3GTO I;  1ZB8 A;  5A2Q b;  4E30 A;  3CXC Z;  1Q7Y 1;  1QVG Y;  4TNU A;  3P5J B;  3IR7 A;  1RO2 A;  2ZAE B;  2QRE B;  1Q16 A;  1VQO Z;  1LQL A;  1QVF Z;  2P28 A;  4MH4 A;  2NVX I;  1VQ4 1;  1R9T I;  4NBC A;  3Q87 A;  3J81 f;  3CPW Y;  1SIW A;  5LL6 f;  1KC8 2;  3IFU A;  2VF1 A;  2Q51 A;  1X3Z A;  3G71 Z;  3G6E 1;  1Y1W I;  2GTI A;  3S1Q I;  2VPW A;  3VMH A;  3CCQ Z;  2F4O A;  2G2K A;  3RZD I;  3NFZ A;  1YIJ Z;  4HH4 A;  3I55 1;  1YIT Z;  1VQ6 1;  2E2J I;  2OTJ 1;  1K73 2;  1WW9 A;  4X6A I;  1TWF I;  2JIP A;  2JA6 I;  1TWG I;  1Z03 A;  4RVG A;  4A3M I;  1USP A;  2QKD A;  1Q82 1;  1PFT A;  1I6H I;  1QVF Y;  1VQO 1;  2VUG A;  3FQM A;  3T4N B;  2VUM I;  3K7A I;  2JIQ A;  4A93 I;  1NP6 A;  1TWC I;  3PO3 I;  4NBH A;  2K3R A;  3S15 I;  3IX0 A;  3CCQ 1;  1SFO I;  4RVH A;  2JIM A;  4E33 A;  3GTP I;  1N8R 1;  3NH4 A;  1YIT 1;  2I3C A;  3G4S Z;  3I4N I;  5IP9 I;  3CC2 1;  3VMI A;  1K9M 1;  5T67 A;  1RNI A;  1YI2 Z;  2JA7 I;  2O53 A;  1KQS Y;  3CD6 Z;  3CCM Z;  2QRC B;  4NB9 A;  2QEX Z;  3F3F C;  4RVF A;  2JR6 A;  2E9H A;  3MZL B;  4DK1 A;  2LIY A;  3IF8 A;  3VB9 A;  1M90 1;  3GTQ I;  2EGT A;  2Q4Z A;  4RV9 A;  2P3Y A;  2YU9 I;  4MXU A;  3VMG A;  3G4S 1;  2R7Z I;  3M4O I;  1K83 I;  1KD1 2;  3S1M I;  3I4M I;  1YUA A;  3H0G I;  3NDJ A;  1JJ2 Z;  1N2F A;  3I56 Z;  3CD6 1;  3CME 1;  3CCM 1;  1VQK Z;  3GTM I;  2QEX 1;  4E2X A;  4MRI A;  4XX2 A;  3I07 A;  1NUI A;  4NBG A;  3HOW I;  5C4X I;  4E32 A;  3S17 I;  2OZK A;  3CCJ Z;  1VQN 1;  2J6A A;  3PO3 S;  4A3I I;  1Y8C A;  4AYB A;  2RHB A;  4MON A;  2RIQ A;  1YHQ Z;  2JUB A;  3CCV Z;  4DGL A;  5D1O B;  3HOU I;  3J80 b;  3JAM b;  5A2Q f;  5FLM I;  1TFI A;  4NOZ A;  1RO4 A;  3EER A;  3GTJ I;  3HOZ I;  3CXC Y;  1VQM Z;  3CCL Z;  1NJI 1;  1Q86 2;  5IP7 I;  4S1T A;  3CCJ 1;  2R6M A;  1K8A 2;  3ESW A;  2OTL Z;  3D6W A;  3HKZ A;  3QWU A;  2QRD B;  3J80 f;  2B63 I;  2NVQ I;  4Y52 I;  1Q7Y 2;  1VQP Z;  3PO2 I;  3BG1 B;  1YHQ 1;  3GTK I;  3OW2 Z;  3CCV 1;  2PMZ A;  3G71 1;  2VPZ A;  1Q81 1;  2K5R A;  3KIH A;  4A3L I;  1YIJ 1;  4BY1 I;  2VPX A;  1ML8 A;  2LEX A;  3J7A 4;  2OOX B;  4NFR A;  5C4J I;  1QYP A;  3NH5 A;  2V45 A;  4E2W A;  1KRL A;  2V8J A;  3MON A;  1VQM 1;  2V3V A;  1M1K 2;  1VQ8 Z;  3KIF A;  3GTM S;  1S72 Z;  4A3C I;  1Z01 A;  4NBF A;  2OTL 1;  3HOV I;  2QR1 B;  2DE6 A; 
#chains in the Genus database with same CATH homology
 3OW2 Y;  3MZK B;  4NBA A;  1Q82 2;  4BXX I;  1YJW Z;  2RT9 A;  4E31 A;  3S1N I;  3CCR Z;  4MD9 A;  1I50 I;  2IZ4 A;  4MD7 A;  4RS4 A;  1N8R 2;  1Y1V I;  4NBB A;  3CCE Z;  1QF8 A;  1S7M A;  1YI2 1;  1S72 1;  2DE7 A;  4NBE A;  3S16 I;  3GKQ A;  1KC8 1;  1QVG Z;  3S1R I;  3M3Y I;  2BJO A;  2YAD A;  4RVD A;  5FLX b;  2W04 A;  5T6B A;  1YJW 1;  1I3Q I;  1VQL Z;  3HOX I;  2R92 I;  1K73 1;  3CCR 1;  2JA5 I;  2NVY I;  3TE5 B;  1M90 2;  2LFU A;  4QTU A;  2V8K A;  1Q86 1;  4BY7 I;  1JJ2 Y;  3GTG I;  4E2Z A;  3CCE 1;  1ZB9 A;  1WII A;  4CL1 A;  1K8A 1;  4NB8 A;  3FQQ A;  3CCS Z;  3I56 1;  4MD8 A;  1VLA A;  5CM2 M;  5C44 I;  1VQK 1;  3CQZ I;  2M6N A;  2OOY B;  2V8I A;  5D1O A;  1DL6 A;  1YJN Z;  1TWA I;  2HU9 A;  1VQL 1;  2GTH A;  1RLY A;  1W2B Z;  4DQY B;  4A3D I;  1X3W A;  2AKL A;  1P9N A;  3JAM f;  1USP B;  3H3V J;  3LUS A;  1M1K 1;  2DE5 A;  2KPI A;  3CC2 Z;  1L1O C;  5AN9 F;  1X0T A;  2R93 I;  2KI7 B;  1WCM I;  4BBR I;  3CCS 1;  1RQF A;  4EWC A;  4A3J I;  5IT9 b;  1KQS Z;  1Y1V S;  2E2H I;  1YJN 1;  3S14 I;  1YJ9 Z;  3F3P C;  3CCL 1;  2QA4 Z;  4A3F I;  3BG0 B;  1W2B Y;  3CMA Z;  3S2D I;  2F4M A;  4NBD A;  1VQ9 Z;  3RZO I;  1KD1 1;  1NJI 2;  1VQ5 Z;  2M48 A;  1VQP 1;  3FKI I;  5C3E I;  3CC7 Z;  3D9X A;  5IT9 f;  2O4H A;  2RPR A;  1JWH C;  3CCU Z;  4A3K I;  2QLV B;  3CC4 Z;  3NDI A;  1VQ7 Z;  3EED A;  1ZH1 A;  4HGZ A;  4NH1 C;  2WB1 A;  1Q81 2;  3CME Z;  2GU2 A;  2PK7 A;  3HOY I;  3S2H I;  3U50 C;  3GCF A;  1YJ9 1;  4BBS I;  1VQ8 1;  2QA4 1;  1TWH I;  2JMO A;  3CMA 1;  3NH8 A;  1VQ9 1;  2E2I I;  4Y7N I;  4A3G I;  3GTL I;  1K9M 2;  1Z02 A;  1VQ5 1;  2PM9 A;  2WAQ A;  3TDH B;  1VQN Z;  5T64 A;  3CC7 1;  2NVT I;  4HGY A;  1VQ4 Z;  3CCU 1;  2JNY A;  3CC4 1;  3CPW Z;  2JA8 I;  2W03 A;  3G6E Z;  2RBL A;  2HF1 A;  1VQ7 1;  4QTT A;  2H85 A;  2JS4 A;  5D1P A;  4E2Y A;  3J81 b;  3I55 Z;  1VQ6 Z;  2IZ3 A;  4A3B I;  1RO0 A;  2OTJ Z;  2Y0S A;  4A3E I;  1YUK A;  5FLX f;  3VTN A;  3GTO I;  1ZB8 A;  5A2Q b;  4E30 A;  3CXC Z;  1Q7Y 1;  1QVG Y;  4TNU A;  3P5J B;  1RO2 A;  2ZAE B;  2QRE B;  1VQO Z;  1LQL A;  1QVF Z;  2P28 A;  4MH4 A;  2NVX I;  1VQ4 1;  1R9T I;  4NBC A;  3Q87 A;  3J81 f;  3CPW Y;  5LL6 f;  1KC8 2;  3IFU A;  2VF1 A;  2Q51 A;  1X3Z A;  3G71 Z;  3G6E 1;  1Y1W I;  2GTI A;  3S1Q I;  3VMH A;  3CCQ Z;  2F4O A;  2G2K A;  3RZD I;  3NFZ A;  1YIJ Z;  4HH4 A;  3I55 1;  1YIT Z;  1VQ6 1;  2E2J I;  2OTJ 1;  1K73 2;  1WW9 A;  4X6A I;  1TWF I;  2JA6 I;  1TWG I;  1Z03 A;  4RVG A;  4A3M I;  1USP A;  2QKD A;  1Q82 1;  1PFT A;  1I6H I;  1QVF Y;  1VQO 1;  2VUG A;  3FQM A;  3T4N B;  2VUM I;  3K7A I;  4A93 I;  1NP6 A;  1TWC I;  3PO3 I;  4NBH A;  2K3R A;  3S15 I;  3IX0 A;  3CCQ 1;  1SFO I;  4RVH A;  4E33 A;  3GTP I;  1N8R 1;  3NH4 A;  1YIT 1;  2I3C A;  3G4S Z;  3I4N I;  5IP9 I;  3CC2 1;  3VMI A;  1K9M 1;  5T67 A;  1RNI A;  1YI2 Z;  2JA7 I;  2O53 A;  1KQS Y;  3CD6 Z;  3CCM Z;  2QRC B;  4NB9 A;  2QEX Z;  3F3F C;  4RVF A;  2JR6 A;  2E9H A;  3MZL B;  4DK1 A;  2LIY A;  3IF8 A;  3VB9 A;  1M90 1;  3GTQ I;  2EGT A;  2Q4Z A;  4RV9 A;  2P3Y A;  2YU9 I;  4MXU A;  3VMG A;  3G4S 1;  2R7Z I;  3M4O I;  1K83 I;  1KD1 2;  3S1M I;  3I4M I;  1YUA A;  3H0G I;  3NDJ A;  1JJ2 Z;  1N2F A;  3I56 Z;  3CD6 1;  3CME 1;  3CCM 1;  1VQK Z;  3GTM I;  2QEX 1;  4E2X A;  4MRI A;  4XX2 A;  3I07 A;  1NUI A;  4NBG A;  3HOW I;  5C4X I;  4E32 A;  3S17 I;  2OZK A;  3CCJ Z;  1VQN 1;  2J6A A;  3PO3 S;  4A3I I;  4AYB A;  2RHB A;  4MON A;  2RIQ A;  1YHQ Z;  2JUB A;  3CCV Z;  4DGL A;  5D1O B;  3HOU I;  3J80 b;  3JAM b;  5A2Q f;  5FLM I;  1TFI A;  4NOZ A;  1RO4 A;  3EER A;  3GTJ I;  3HOZ I;  3CXC Y;  1VQM Z;  3CCL Z;  1NJI 1;  1Q86 2;  5IP7 I;  4S1T A;  3CCJ 1;  2R6M A;  1K8A 2;  3ESW A;  2OTL Z;  3D6W A;  3HKZ A;  3QWU A;  2QRD B;  3J80 f;  2B63 I;  2NVQ I;  4Y52 I;  1Q7Y 2;  1VQP Z;  3PO2 I;  3BG1 B;  1YHQ 1;  3GTK I;  3OW2 Z;  3CCV 1;  2PMZ A;  3G71 1;  1Q81 1;  2K5R A;  3KIH A;  4A3L I;  1YIJ 1;  4BY1 I;  1ML8 A;  3J7A 4;  2OOX B;  4NFR A;  5C4J I;  1QYP A;  3NH5 A;  4E2W A;  1KRL A;  2V8J A;  3MON A;  1VQM 1;  1M1K 2;  1VQ8 Z;  3KIF A;  3GTM S;  1S72 Z;  4A3C I;  1Z01 A;  4NBF A;  2OTL 1;  3HOV I;  2QR1 B;  2DE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...