1TFIA

A novel zn finger motif in the basal transcriptional machinery: three-dimensional nmr studies of the nucleic-acid binding domain of transcriptional elongation factor tfiis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
b'KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL ELONGATION FACTOR SII
publication title Novel zinc finger motif in the basal transcriptional machinery: three-dimensional NMR studies of the nucleic acid binding domain of transcriptional elongation factor TFIIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1tfiA00
4NBEA 4NBCA 1N2FA 4NBDA 3GTMI 3S2HI 2DE6A 2AKLA 4NBGA 2R7ZI 1TWHI 1DL6A 4Y7NI 2DE7A 1LQLA 3GTOI 5IP7I 4BBSI 5C44I 4A3DI 3S17I 4A3JI 2B63I 4A3KI 1R9TI 2YU9I 3HOUI 2K5RA 1VLAA 1X3ZA 2JR6A 3D6WA 3HOXI 3VMIA 1L1OC 3VMGA 3M4OI 2VUMI 2E2II 4QTTA 3VB9A 1ZB8A 3K7AI 3M3YI 1Y1VS 2NVYI 5C4JI 1QYPA 4A3GI 3S1MI 3S1QI 3VMHA 1USPB 3CQZI 3HOVI 2NVTI 4A3EI 4BXXI 3I4NI 2PK7A 1K83I 2NVQI 2E2JI 4NBAA 1I3QI 1PFTA 2P3YA 2R92I 3S16I 3I4MI 5IP9I 2F4OA 1RLYA 1Y1VI 3GTGI 4A3LI 2KPIA 3HOYI 3GTJI 2E2HI 2JA7I 4Y52I 3H0GI 3HOZI 3FKII 2JA8I 3LUSA 1X3WA 3GTQI 4NB9A 1SFOI 2JA5I 2F4MA 3S15I 1I6HI 1TWFI 3S14I 1WCMI 2JS4A 1Y1WI 4A3CI 4A3II 3S1RI 3GTKI 3RZOI 4A3BI 5C3EI 4A3MI 4BY1I 1ML8A 1WW9A 3S2DI 1TWCI 3PO3S 2JNYA 4NBBA 3U50C 4BY7I 5C4XI 2RBLA 5CM2M 1TWAI 3S1NI 2HF1A 3EERA 3ESWA 2BJOA 1ZB9A 2NVXI 3PO2I 4A3FI 4NBHA 3I07A 4NB8A 3GKQA 3H3VJ 1RO4A 1YUAA 2J6AA 3GCFA 1NUIA 3RZDI 3Q87A 3GTPI 5FLMI 1TWGI 3GTMS 4QTUA 3PO3I 4NBFA 2JA6I 4A93I 2DE5A 4X6AI 1TFIA 3GTLI 2R93I 4NOZA 4BBRI 3HOWI 4XX2A 4MH4A 1USPA 1I50I
chains in the Genus database with same CATH superfamily
2QLVB 3CCR1 3I551 4NBEA 1N8R2 2OTL1 4NBDA 1K731 3MZLB 1Q16A 1QVGY 1YHQZ 2DE6A 5AN9F 2AKLA 4RVGA 3I561 3CCEZ 4RVHA 1VQLZ 4RVFA 3KIHA 2DE7A 3JAMf 3CCL1 5C44I 1RO2A 2B63I 1QVFY 3G4S1 2R6MA 3HOUI 2K5RA 4E2ZA 2NAPA 3EEDA 3VMGA 4MRIA 5D1OB 1Q7Y2 3OW2Y 3T4NB 3CC7Z 4E33A 3S1QI 1K8A2 1USPB 2RT9A 3BG0B 4MD7A 2QEXZ 4DQYB 1Y8CA 2GU2A 3CMA1 3S16I 3I4MI 4DK1A 2F4OA 3G6EZ 2KPIA 3HOYI 2JA7I 4Y52I 1P9NA 3HOZI 3FKII 2RIQA 2VPYA 1SFOI 3J7A4 2F4MA 2RPRA 1YJW1 4A3II 3S1RI 3NFZA 3RZOI 4A3MI 3CC2Z 3CCVZ 1ZH1A 3U50C 1VQ5Z 1VQ7Z 1QXFA 5C4XI 1QF8A 1YITZ 1TWAI 3F3FC 3CXCZ 2OZKA 2Q4ZA 1KC81 1WZNA 2IZ4A 1WIIA 2NVXI 3CC41 3I07A 1RO4A 3GCFA 1VQ4Z 5FLMI 4E2WA 4A93I 2JIRA 4AYBA 2R93I 2LFUA 3CCMZ 1QVFZ 3D9XA 2JIOA 2VF1A 1YJ9Z 4NBCA 1S7MA 3FQQA 3S2HI 2QA4Z 3MZKB 1VQ91 4E32A 3OW2Z 4Y7NI 3TDHB 5IT9b 1AA6A 1KQSY 3NDJA 5IP7I 2VUGA 3CCJ1 1RNIA 4NH1C 1S721 3J81f 2OOXB 1N8R1 2PMZA 2OTJ1 1KD12 1X3ZA 2JR6A 2JMOA 1YI2Z 1L1OC 1M1K2 2E2II 1YJNZ 3VB9A 3CCQZ 1Y1VS 1Z03A 1VQ8Z 1VQN1 4A3GI 1VQMZ 3G711 1FDOA 5A2Qf 1YUKA 1YIJ1 3CCUZ 2QR1B 1VQO1 2Y0SA 4TNUA 2NVTI 1K83I 2E9HA 2JIQA 2E2JI 4NBAA 2M48A 1I3QI 2R92I 4MONA 1Q7Y1 3TE5B 3CMEZ 3J80b 1Y1VI 3GTGI 3HKZA 1Q862 2PM9A 5FLXf 3GTJI 3CCSZ 1K8A1 2JA5I 3CCRZ 3S15I 3I55Z 2P28A 3S14I 2OTLZ 1Y1WI 2W03A 4DGLA 2O53A 4BY1I 1NJI2 3I56Z 1TWCI 5D1PA 2JNYA 3IFUA 1W2BZ 3CCLZ 3S1NI 2HF1A 2BJOA 3G4SZ 3CC21 1NUIA 3Q87A 1Q822 3GTPI 2W04A 3GTMS 4QTUA 4NBFA 2JA6I 1JJ2Y 3QWUA 4X6AI 2VPXA 1Q812 1KQSZ 1TFIA 3NH8A 2V3VA 3IR7A 4XX2A 4MH4A 3FQMA 1VQPZ 2RHBA 3CMAZ 3GTMI 2AYDA 4RVDA 3CD61 2I3CA 1TWHI 1NP6A 1QVGZ 3GTOI 4A3DI 3S17I 1YJWZ 4A3JI 3D2LA 2YU9I 3CPWY 1VQ61 1KRLA 1VLAA 3IX0A 4E2YA 3M4OI 2VUMI 3IF8A 3K7AI 3M3YI 1RO0A 5C4JI 1QYPA 3S1MI 1Z01A 3VMHA 3HOVI 2KI7B 3CC4Z 4CL1A 4BXXI 1KD11 3I4NI 1WJ2A 3MONA 2NVQI 2LIYA 4EWCA 1M1K1 2P3YA 4A3LI 1YHQ1 1VQM1 2E2HI 3CCE1 3H0GI 1X0TA 2JA8I 3LUSA 1VQL1 2QREB 1I6HI 1SIWA 2YADA 4MXUA 4A3CI 3GTKI 1VQKZ 1M902 2Q51A 1VQ9Z 2V45A 1WW9A 3NH5A 3S2DI 1JJ2Z 3PO3S 4MD9A 4BY7I 2LEXA 3BG1B 1Q861 2RBLA 3CCJZ 5IT9f 3CC71 3NDIA 3ESWA 1S72Z 2G2KA 2VPZA 1ZB9A 4NFRA 1K9M2 2JIMA 2EGTA 2OTJZ 2OOYB 3VTNA 4NB8A 3GKQA 2QEX1 3H3VJ 1YUAA 2J6AA 4MD8A 1NJI1 1K732 3PO3I 4E30A 2IV2X 1FDIA 5D1OA 1VQNZ 3GTLI 2E7ZA 3G71Z 3G6E1 4BBRI 1YIJZ 1VQOZ 2HU9A 1USPA 4A3KI 1R9TI 3CPWZ 4E31A 3KIFA 5T6BA 1N2FA 1Q821 4HGZA 4HH4A 4NBGA 1Q811 2R7ZI 1DL6A 2JUBA 3CCV1 5T64A 2JIPA 3J80f 1LQLA 1VQ51 4BBSI 1VQ71 2QRCB 1YIT1 1VQP1 2V8KA 2VPWA 2ZAEB 3D6WA 2K3RA 3F3PC 3VMIA 3HOXI 1VQ41 4QTTA 1ZB8A 3NH4A 2NVYI 1JWHC 3CQZI 4RS4A 3CCM1 4S1TA 2O4HA 2M6NA 4A3EI 2WB1A 2PK7A 5LL6f 2IZ3A 1YJ91 1PFTA 5IP9I 2QA41 1RLYA 4E2XA 2GTHA 2V8IA 1X3WA 3GTQI 4NB9A 3J81b 1KC82 1TWFI 1WCMI 2JS4A 4A3BI 2H85A 5C3EI 1W2BY 3CD6Z 1ML8A 3P5JB 4RV9A 4NBBA 1YI21 5CM2M 1YJN1 3CCQ1 1RQFA 3EERA 1VQ81 2QKDA 5A2Qb 5T67A 3JAMb 3PO2I 1VQK1 1VQ6Z 4A3FI 4NBHA 2GTIA 1M901 1Z02A 2QRDB 3CCU1 3RZDI 1TWGI 2DE5A 5FLXb 2V8JA 3CME1 4HGYA 4NOZA 3CXCY 1K9M1 2WAQA 3HOWI 3CCS1 1I50I
chains in the Genus database with same CATH topology
2QLVB 3CCR1 3I551 4NBEA 1N8R2 2OTL1 4NBDA 1K731 3MZLB 1QVGY 1YHQZ 2DE6A 5AN9F 2AKLA 4RVGA 3I561 3CCEZ 4RVHA 1VQLZ 4RVFA 3KIHA 2DE7A 3JAMf 3CCL1 5C44I 1RO2A 2B63I 1QVFY 3G4S1 2R6MA 3HOUI 2K5RA 4E2ZA 3EEDA 3VMGA 4MRIA 5D1OB 1Q7Y2 3OW2Y 3T4NB 3CC7Z 4E33A 3S1QI 1K8A2 1USPB 2RT9A 3BG0B 4MD7A 2QEXZ 4DQYB 2GU2A 3CMA1 3S16I 3I4MI 4DK1A 2F4OA 3G6EZ 2KPIA 3HOYI 2JA7I 4Y52I 1P9NA 3HOZI 3FKII 2RIQA 1SFOI 3J7A4 2F4MA 2RPRA 1YJW1 4A3II 3S1RI 3NFZA 3RZOI 4A3MI 3CC2Z 3CCVZ 1ZH1A 3U50C 1VQ5Z 1VQ7Z 5C4XI 1QF8A 1YITZ 1TWAI 3F3FC 3CXCZ 2OZKA 2Q4ZA 1KC81 2IZ4A 1WIIA 2NVXI 3CC41 3I07A 1RO4A 3GCFA 1VQ4Z 5FLMI 4E2WA 4A93I 4AYBA 2R93I 2LFUA 3CCMZ 1QVFZ 3D9XA 2VF1A 1YJ9Z 4NBCA 1S7MA 3FQQA 3S2HI 2QA4Z 3MZKB 1VQ91 4E32A 3OW2Z 4Y7NI 3TDHB 5IT9b 1KQSY 3NDJA 5IP7I 2VUGA 3CCJ1 1RNIA 4NH1C 1S721 3J81f 2OOXB 1N8R1 2PMZA 2OTJ1 1KD12 1X3ZA 2JR6A 2JMOA 1YI2Z 1L1OC 1M1K2 2E2II 1YJNZ 3VB9A 3CCQZ 1Y1VS 1Z03A 1VQ8Z 1VQN1 4A3GI 1VQMZ 3G711 5A2Qf 1YUKA 1YIJ1 3CCUZ 2QR1B 1VQO1 2Y0SA 4TNUA 2NVTI 1K83I 2E9HA 2E2JI 4NBAA 2M48A 1I3QI 2R92I 4MONA 1Q7Y1 3TE5B 3CMEZ 3J80b 1Y1VI 3GTGI 3HKZA 1Q862 2PM9A 5FLXf 3GTJI 3CCSZ 1K8A1 2JA5I 3CCRZ 3S15I 3I55Z 2P28A 3S14I 2OTLZ 1Y1WI 2W03A 4DGLA 2O53A 4BY1I 1NJI2 3I56Z 1TWCI 5D1PA 2JNYA 3IFUA 1W2BZ 3CCLZ 3S1NI 2HF1A 2BJOA 3G4SZ 3CC21 1NUIA 3Q87A 1Q822 3GTPI 2W04A 3GTMS 4QTUA 4NBFA 2JA6I 1JJ2Y 3QWUA 4X6AI 1Q812 1KQSZ 1TFIA 3NH8A 4XX2A 4MH4A 3FQMA 1VQPZ 2RHBA 3CMAZ 3GTMI 4RVDA 3CD61 2I3CA 1TWHI 1NP6A 1QVGZ 3GTOI 4A3DI 3S17I 1YJWZ 4A3JI 2YU9I 3CPWY 1VQ61 1KRLA 1VLAA 3IX0A 4E2YA 3M4OI 2VUMI 3IF8A 3K7AI 3M3YI 1RO0A 5C4JI 1QYPA 3S1MI 1Z01A 3VMHA 3HOVI 2KI7B 3CC4Z 4CL1A 4BXXI 1KD11 3I4NI 3MONA 2NVQI 2LIYA 4EWCA 1M1K1 2P3YA 4A3LI 1YHQ1 1VQM1 2E2HI 3CCE1 3H0GI 1X0TA 2JA8I 3LUSA 1VQL1 2QREB 1I6HI 2YADA 4MXUA 4A3CI 3GTKI 1VQKZ 1M902 2Q51A 1VQ9Z 1WW9A 3NH5A 3S2DI 1JJ2Z 3PO3S 4MD9A 4BY7I 1Q861 3BG1B 2RBLA 3CCJZ 5IT9f 3CC71 3NDIA 3ESWA 1S72Z 2G2KA 1ZB9A 4NFRA 1K9M2 2EGTA 2OTJZ 2OOYB 3VTNA 4NB8A 3GKQA 2QEX1 3H3VJ 1YUAA 2J6AA 4MD8A 1NJI1 1K732 3PO3I 4E30A 5D1OA 1VQNZ 3GTLI 3G71Z 3G6E1 4BBRI 1YIJZ 1VQOZ 2HU9A 1USPA 4A3KI 1R9TI 3CPWZ 4E31A 3KIFA 5T6BA 1N2FA 1Q821 4HGZA 4HH4A 4NBGA 1Q811 2R7ZI 1DL6A 2JUBA 3CCV1 5T64A 3J80f 1LQLA 1VQ51 4BBSI 1VQ71 2QRCB 1YIT1 1VQP1 2V8KA 2ZAEB 3D6WA 2K3RA 3F3PC 3VMIA 3HOXI 1VQ41 4QTTA 1ZB8A 3NH4A 2NVYI 1JWHC 3CQZI 4RS4A 3CCM1 4S1TA 2O4HA 2M6NA 4A3EI 2WB1A 2PK7A 5LL6f 2IZ3A 1YJ91 1PFTA 5IP9I 2QA41 1RLYA 4E2XA 2GTHA 2V8IA 1X3WA 3GTQI 4NB9A 3J81b 1KC82 1TWFI 1WCMI 2JS4A 4A3BI 2H85A 5C3EI 1W2BY 3CD6Z 1ML8A 3P5JB 4RV9A 4NBBA 1YI21 5CM2M 1YJN1 3CCQ1 1RQFA 3EERA 1VQ81 2QKDA 5A2Qb 5T67A 3JAMb 3PO2I 1VQK1 1VQ6Z 4A3FI 4NBHA 2GTIA 1M901 1Z02A 2QRDB 3CCU1 3RZDI 1TWGI 2DE5A 5FLXb 2V8JA 3CME1 4HGYA 4NOZA 3CXCY 1K9M1 2WAQA 3HOWI 3CCS1 1I50I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBE A;  4NBC A;  1N2F A;  4NBD A;  3GTM I;  3S2H I;  2DE6 A;  2AKL A;  4NBG A;  2R7Z I;  1TWH I;  1DL6 A;  4Y7N I;  2DE7 A;  1LQL A;  3GTO I;  5IP7 I;  4BBS I;  5C44 I;  4A3D I;  3S17 I;  4A3J I;  2B63 I;  4A3K I;  1R9T I;  2YU9 I;  3HOU I;  2K5R A;  1VLA A;  1X3Z A;  2JR6 A;  3D6W A;  3HOX I;  3VMI A;  1L1O C;  3VMG A;  3M4O I;  2VUM I;  2E2I I;  4QTT A;  3VB9 A;  1ZB8 A;  3K7A I;  3M3Y I;  1Y1V S;  2NVY I;  5C4J I;  1QYP A;  4A3G I;  3S1M I;  3S1Q I;  3VMH A;  1USP B;  3CQZ I;  3HOV I;  2NVT I;  4A3E I;  4BXX I;  3I4N I;  2PK7 A;  1K83 I;  2NVQ I;  2E2J I;  4NBA A;  1I3Q I;  1PFT A;  2P3Y A;  2R92 I;  3S16 I;  3I4M I;  5IP9 I;  2F4O A;  1RLY A;  1Y1V I;  3GTG I;  4A3L I;  2KPI A;  3HOY I;  3GTJ I;  2E2H I;  2JA7 I;  4Y52 I;  3H0G I;  3HOZ I;  3FKI I;  2JA8 I;  3LUS A;  1X3W A;  3GTQ I;  4NB9 A;  1SFO I;  2JA5 I;  2F4M A;  3S15 I;  1I6H I;  1TWF I;  3S14 I;  1WCM I;  2JS4 A;  1Y1W I;  4A3C I;  4A3I I;  3S1R I;  3GTK I;  3RZO I;  4A3B I;  5C3E I;  4A3M I;  4BY1 I;  1ML8 A;  1WW9 A;  3S2D I;  1TWC I;  3PO3 S;  2JNY A;  4NBB A;  3U50 C;  4BY7 I;  5C4X I;  2RBL A;  5CM2 M;  1TWA I;  3S1N I;  2HF1 A;  3EER A;  3ESW A;  2BJO A;  1ZB9 A;  2NVX I;  3PO2 I;  4A3F I;  4NBH A;  3I07 A;  4NB8 A;  3GKQ A;  3H3V J;  1RO4 A;  1YUA A;  2J6A A;  3GCF A;  1NUI A;  3RZD I;  3Q87 A;  3GTP I;  5FLM I;  1TWG I;  3GTM S;  4QTU A;  3PO3 I;  4NBF A;  2JA6 I;  4A93 I;  2DE5 A;  4X6A I;  1TFI A;  3GTL I;  2R93 I;  4NOZ A;  4BBR I;  3HOW I;  4XX2 A;  4MH4 A;  1USP A;  1I50 I; 
#chains in the Genus database with same CATH topology
 2QLV B;  3CCR 1;  3I55 1;  4NBE A;  1N8R 2;  2OTL 1;  4NBD A;  1K73 1;  3MZL B;  1Q16 A;  1QVG Y;  1YHQ Z;  2DE6 A;  5AN9 F;  2AKL A;  4RVG A;  3I56 1;  3CCE Z;  4RVH A;  1VQL Z;  4RVF A;  3KIH A;  2DE7 A;  3JAM f;  3CCL 1;  5C44 I;  1RO2 A;  2B63 I;  1QVF Y;  3G4S 1;  2R6M A;  3HOU I;  2K5R A;  4E2Z A;  2NAP A;  3EED A;  3VMG A;  4MRI A;  5D1O B;  1Q7Y 2;  3OW2 Y;  3T4N B;  3CC7 Z;  4E33 A;  3S1Q I;  1K8A 2;  1USP B;  2RT9 A;  3BG0 B;  4MD7 A;  2QEX Z;  4DQY B;  1Y8C A;  2GU2 A;  3CMA 1;  3S16 I;  3I4M I;  4DK1 A;  2F4O A;  3G6E Z;  2KPI A;  3HOY I;  2JA7 I;  4Y52 I;  1P9N A;  3HOZ I;  3FKI I;  2RIQ A;  2VPY A;  1SFO I;  3J7A 4;  2F4M A;  2RPR A;  1YJW 1;  4A3I I;  3S1R I;  3NFZ A;  3RZO I;  4A3M I;  3CC2 Z;  3CCV Z;  1ZH1 A;  3U50 C;  1VQ5 Z;  1VQ7 Z;  1QXF A;  5C4X I;  1QF8 A;  1YIT Z;  1TWA I;  3F3F C;  3CXC Z;  2OZK A;  2Q4Z A;  1KC8 1;  1WZN A;  2IZ4 A;  1WII A;  2NVX I;  3CC4 1;  3I07 A;  1RO4 A;  3GCF A;  1VQ4 Z;  5FLM I;  4E2W A;  4A93 I;  2JIR A;  4AYB A;  2R93 I;  2LFU A;  3CCM Z;  1QVF Z;  3D9X A;  2JIO A;  2VF1 A;  1YJ9 Z;  4NBC A;  1S7M A;  3FQQ A;  3S2H I;  2QA4 Z;  3MZK B;  1VQ9 1;  4E32 A;  3OW2 Z;  4Y7N I;  3TDH B;  5IT9 b;  1AA6 A;  1KQS Y;  3NDJ A;  5IP7 I;  2VUG A;  3CCJ 1;  1RNI A;  4NH1 C;  1S72 1;  3J81 f;  2OOX B;  1N8R 1;  2PMZ A;  2OTJ 1;  1KD1 2;  1X3Z A;  2JR6 A;  2JMO A;  1YI2 Z;  1L1O C;  1M1K 2;  2E2I I;  1YJN Z;  3VB9 A;  3CCQ Z;  1Y1V S;  1Z03 A;  1VQ8 Z;  1VQN 1;  4A3G I;  1VQM Z;  3G71 1;  1FDO A;  5A2Q f;  1YUK A;  1YIJ 1;  3CCU Z;  2QR1 B;  1VQO 1;  2Y0S A;  4TNU A;  2NVT I;  1K83 I;  2E9H A;  2JIQ A;  2E2J I;  4NBA A;  2M48 A;  1I3Q I;  2R92 I;  4MON A;  1Q7Y 1;  3TE5 B;  3CME Z;  3J80 b;  1Y1V I;  3GTG I;  3HKZ A;  1Q86 2;  2PM9 A;  5FLX f;  3GTJ I;  3CCS Z;  1K8A 1;  2JA5 I;  3CCR Z;  3S15 I;  3I55 Z;  2P28 A;  3S14 I;  2OTL Z;  1Y1W I;  2W03 A;  4DGL A;  2O53 A;  4BY1 I;  1NJI 2;  3I56 Z;  1TWC I;  5D1P A;  2JNY A;  3IFU A;  1W2B Z;  3CCL Z;  3S1N I;  2HF1 A;  2BJO A;  3G4S Z;  3CC2 1;  1NUI A;  3Q87 A;  1Q82 2;  3GTP I;  2W04 A;  3GTM S;  4QTU A;  4NBF A;  2JA6 I;  1JJ2 Y;  3QWU A;  4X6A I;  2VPX A;  1Q81 2;  1KQS Z;  1TFI A;  3NH8 A;  2V3V A;  3IR7 A;  4XX2 A;  4MH4 A;  3FQM A;  1VQP Z;  2RHB A;  3CMA Z;  3GTM I;  2AYD A;  4RVD A;  3CD6 1;  2I3C A;  1TWH I;  1NP6 A;  1QVG Z;  3GTO I;  4A3D I;  3S17 I;  1YJW Z;  4A3J I;  3D2L A;  2YU9 I;  3CPW Y;  1VQ6 1;  1KRL A;  1VLA A;  3IX0 A;  4E2Y A;  3M4O I;  2VUM I;  3IF8 A;  3K7A I;  3M3Y I;  1RO0 A;  5C4J I;  1QYP A;  3S1M I;  1Z01 A;  3VMH A;  3HOV I;  2KI7 B;  3CC4 Z;  4CL1 A;  4BXX I;  1KD1 1;  3I4N I;  1WJ2 A;  3MON A;  2NVQ I;  2LIY A;  4EWC A;  1M1K 1;  2P3Y A;  4A3L I;  1YHQ 1;  1VQM 1;  2E2H I;  3CCE 1;  3H0G I;  1X0T A;  2JA8 I;  3LUS A;  1VQL 1;  2QRE B;  1I6H I;  1SIW A;  2YAD A;  4MXU A;  4A3C I;  3GTK I;  1VQK Z;  1M90 2;  2Q51 A;  1VQ9 Z;  2V45 A;  1WW9 A;  3NH5 A;  3S2D I;  1JJ2 Z;  3PO3 S;  4MD9 A;  4BY7 I;  2LEX A;  3BG1 B;  1Q86 1;  2RBL A;  3CCJ Z;  5IT9 f;  3CC7 1;  3NDI A;  3ESW A;  1S72 Z;  2G2K A;  2VPZ A;  1ZB9 A;  4NFR A;  1K9M 2;  2JIM A;  2EGT A;  2OTJ Z;  2OOY B;  3VTN A;  4NB8 A;  3GKQ A;  2QEX 1;  3H3V J;  1YUA A;  2J6A A;  4MD8 A;  1NJI 1;  1K73 2;  3PO3 I;  4E30 A;  2IV2 X;  1FDI A;  5D1O A;  1VQN Z;  3GTL I;  2E7Z A;  3G71 Z;  3G6E 1;  4BBR I;  1YIJ Z;  1VQO Z;  2HU9 A;  1USP A;  4A3K I;  1R9T I;  3CPW Z;  4E31 A;  3KIF A;  5T6B A;  1N2F A;  1Q82 1;  4HGZ A;  4HH4 A;  4NBG A;  1Q81 1;  2R7Z I;  1DL6 A;  2JUB A;  3CCV 1;  5T64 A;  2JIP A;  3J80 f;  1LQL A;  1VQ5 1;  4BBS I;  1VQ7 1;  2QRC B;  1YIT 1;  1VQP 1;  2V8K A;  2VPW A;  2ZAE B;  3D6W A;  2K3R A;  3F3P C;  3VMI A;  3HOX I;  1VQ4 1;  4QTT A;  1ZB8 A;  3NH4 A;  2NVY I;  1JWH C;  3CQZ I;  4RS4 A;  3CCM 1;  4S1T A;  2O4H A;  2M6N A;  4A3E I;  2WB1 A;  2PK7 A;  5LL6 f;  2IZ3 A;  1YJ9 1;  1PFT A;  5IP9 I;  2QA4 1;  1RLY A;  4E2X A;  2GTH A;  2V8I A;  1X3W A;  3GTQ I;  4NB9 A;  3J81 b;  1KC8 2;  1TWF I;  1WCM I;  2JS4 A;  4A3B I;  2H85 A;  5C3E I;  1W2B Y;  3CD6 Z;  1ML8 A;  3P5J B;  4RV9 A;  4NBB A;  1YI2 1;  5CM2 M;  1YJN 1;  3CCQ 1;  1RQF A;  3EER A;  1VQ8 1;  2QKD A;  5A2Q b;  5T67 A;  3JAM b;  3PO2 I;  1VQK 1;  1VQ6 Z;  4A3F I;  4NBH A;  2GTI A;  1M90 1;  1Z02 A;  2QRD B;  3CCU 1;  3RZD I;  1TWG I;  2DE5 A;  5FLX b;  2V8J A;  3CME 1;  4HGY A;  4NOZ A;  3CXC Y;  1K9M 1;  2WAQ A;  3HOW I;  3CCS 1;  1I50 I; 
#chains in the Genus database with same CATH homology
 2QLV B;  3CCR 1;  3I55 1;  4NBE A;  1N8R 2;  2OTL 1;  4NBD A;  1K73 1;  3MZL B;  1QVG Y;  1YHQ Z;  2DE6 A;  5AN9 F;  2AKL A;  4RVG A;  3I56 1;  3CCE Z;  4RVH A;  1VQL Z;  4RVF A;  3KIH A;  2DE7 A;  3JAM f;  3CCL 1;  5C44 I;  1RO2 A;  2B63 I;  1QVF Y;  3G4S 1;  2R6M A;  3HOU I;  2K5R A;  4E2Z A;  3EED A;  3VMG A;  4MRI A;  5D1O B;  1Q7Y 2;  3OW2 Y;  3T4N B;  3CC7 Z;  4E33 A;  3S1Q I;  1K8A 2;  1USP B;  2RT9 A;  3BG0 B;  4MD7 A;  2QEX Z;  4DQY B;  2GU2 A;  3CMA 1;  3S16 I;  3I4M I;  4DK1 A;  2F4O A;  3G6E Z;  2KPI A;  3HOY I;  2JA7 I;  4Y52 I;  1P9N A;  3HOZ I;  3FKI I;  2RIQ A;  1SFO I;  3J7A 4;  2F4M A;  2RPR A;  1YJW 1;  4A3I I;  3S1R I;  3NFZ A;  3RZO I;  4A3M I;  3CC2 Z;  3CCV Z;  1ZH1 A;  3U50 C;  1VQ5 Z;  1VQ7 Z;  5C4X I;  1QF8 A;  1YIT Z;  1TWA I;  3F3F C;  3CXC Z;  2OZK A;  2Q4Z A;  1KC8 1;  2IZ4 A;  1WII A;  2NVX I;  3CC4 1;  3I07 A;  1RO4 A;  3GCF A;  1VQ4 Z;  5FLM I;  4E2W A;  4A93 I;  4AYB A;  2R93 I;  2LFU A;  3CCM Z;  1QVF Z;  3D9X A;  2VF1 A;  1YJ9 Z;  4NBC A;  1S7M A;  3FQQ A;  3S2H I;  2QA4 Z;  3MZK B;  1VQ9 1;  4E32 A;  3OW2 Z;  4Y7N I;  3TDH B;  5IT9 b;  1KQS Y;  3NDJ A;  5IP7 I;  2VUG A;  3CCJ 1;  1RNI A;  4NH1 C;  1S72 1;  3J81 f;  2OOX B;  1N8R 1;  2PMZ A;  2OTJ 1;  1KD1 2;  1X3Z A;  2JR6 A;  2JMO A;  1YI2 Z;  1L1O C;  1M1K 2;  2E2I I;  1YJN Z;  3VB9 A;  3CCQ Z;  1Y1V S;  1Z03 A;  1VQ8 Z;  1VQN 1;  4A3G I;  1VQM Z;  3G71 1;  5A2Q f;  1YUK A;  1YIJ 1;  3CCU Z;  2QR1 B;  1VQO 1;  2Y0S A;  4TNU A;  2NVT I;  1K83 I;  2E9H A;  2E2J I;  4NBA A;  2M48 A;  1I3Q I;  2R92 I;  4MON A;  1Q7Y 1;  3TE5 B;  3CME Z;  3J80 b;  1Y1V I;  3GTG I;  3HKZ A;  1Q86 2;  2PM9 A;  5FLX f;  3GTJ I;  3CCS Z;  1K8A 1;  2JA5 I;  3CCR Z;  3S15 I;  3I55 Z;  2P28 A;  3S14 I;  2OTL Z;  1Y1W I;  2W03 A;  4DGL A;  2O53 A;  4BY1 I;  1NJI 2;  3I56 Z;  1TWC I;  5D1P A;  2JNY A;  3IFU A;  1W2B Z;  3CCL Z;  3S1N I;  2HF1 A;  2BJO A;  3G4S Z;  3CC2 1;  1NUI A;  3Q87 A;  1Q82 2;  3GTP I;  2W04 A;  3GTM S;  4QTU A;  4NBF A;  2JA6 I;  1JJ2 Y;  3QWU A;  4X6A I;  1Q81 2;  1KQS Z;  1TFI A;  3NH8 A;  4XX2 A;  4MH4 A;  3FQM A;  1VQP Z;  2RHB A;  3CMA Z;  3GTM I;  4RVD A;  3CD6 1;  2I3C A;  1TWH I;  1NP6 A;  1QVG Z;  3GTO I;  4A3D I;  3S17 I;  1YJW Z;  4A3J I;  2YU9 I;  3CPW Y;  1VQ6 1;  1KRL A;  1VLA A;  3IX0 A;  4E2Y A;  3M4O I;  2VUM I;  3IF8 A;  3K7A I;  3M3Y I;  1RO0 A;  5C4J I;  1QYP A;  3S1M I;  1Z01 A;  3VMH A;  3HOV I;  2KI7 B;  3CC4 Z;  4CL1 A;  4BXX I;  1KD1 1;  3I4N I;  3MON A;  2NVQ I;  2LIY A;  4EWC A;  1M1K 1;  2P3Y A;  4A3L I;  1YHQ 1;  1VQM 1;  2E2H I;  3CCE 1;  3H0G I;  1X0T A;  2JA8 I;  3LUS A;  1VQL 1;  2QRE B;  1I6H I;  2YAD A;  4MXU A;  4A3C I;  3GTK I;  1VQK Z;  1M90 2;  2Q51 A;  1VQ9 Z;  1WW9 A;  3NH5 A;  3S2D I;  1JJ2 Z;  3PO3 S;  4MD9 A;  4BY7 I;  1Q86 1;  3BG1 B;  2RBL A;  3CCJ Z;  5IT9 f;  3CC7 1;  3NDI A;  3ESW A;  1S72 Z;  2G2K A;  1ZB9 A;  4NFR A;  1K9M 2;  2EGT A;  2OTJ Z;  2OOY B;  3VTN A;  4NB8 A;  3GKQ A;  2QEX 1;  3H3V J;  1YUA A;  2J6A A;  4MD8 A;  1NJI 1;  1K73 2;  3PO3 I;  4E30 A;  5D1O A;  1VQN Z;  3GTL I;  3G71 Z;  3G6E 1;  4BBR I;  1YIJ Z;  1VQO Z;  2HU9 A;  1USP A;  4A3K I;  1R9T I;  3CPW Z;  4E31 A;  3KIF A;  5T6B A;  1N2F A;  1Q82 1;  4HGZ A;  4HH4 A;  4NBG A;  1Q81 1;  2R7Z I;  1DL6 A;  2JUB A;  3CCV 1;  5T64 A;  3J80 f;  1LQL A;  1VQ5 1;  4BBS I;  1VQ7 1;  2QRC B;  1YIT 1;  1VQP 1;  2V8K A;  2ZAE B;  3D6W A;  2K3R A;  3F3P C;  3VMI A;  3HOX I;  1VQ4 1;  4QTT A;  1ZB8 A;  3NH4 A;  2NVY I;  1JWH C;  3CQZ I;  4RS4 A;  3CCM 1;  4S1T A;  2O4H A;  2M6N A;  4A3E I;  2WB1 A;  2PK7 A;  5LL6 f;  2IZ3 A;  1YJ9 1;  1PFT A;  5IP9 I;  2QA4 1;  1RLY A;  4E2X A;  2GTH A;  2V8I A;  1X3W A;  3GTQ I;  4NB9 A;  3J81 b;  1KC8 2;  1TWF I;  1WCM I;  2JS4 A;  4A3B I;  2H85 A;  5C3E I;  1W2B Y;  3CD6 Z;  1ML8 A;  3P5J B;  4RV9 A;  4NBB A;  1YI2 1;  5CM2 M;  1YJN 1;  3CCQ 1;  1RQF A;  3EER A;  1VQ8 1;  2QKD A;  5A2Q b;  5T67 A;  3JAM b;  3PO2 I;  1VQK 1;  1VQ6 Z;  4A3F I;  4NBH A;  2GTI A;  1M90 1;  1Z02 A;  2QRD B;  3CCU 1;  3RZD I;  1TWG I;  2DE5 A;  5FLX b;  2V8J A;  3CME 1;  4HGY A;  4NOZ A;  3CXC Y;  1K9M 1;  2WAQ A;  3HOW I;  3CCS 1;  1I50 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...