3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
3CCM1 3CCJZ 3CCS1 1KD12 1VQPZ 1VQO1 3I56Z 1KQSY 2OTLZ 1YI2Z 3CC7Z 1VQL1 1VQK1 1YJ91 1KQSZ 1M902 3CCRZ 1K731 2QEXZ 3OW2Y 3CMA1 1N8R1 1VQ51 3I551 1KC81 3CCQZ 1VQM1 1YIJZ 1VQ7Z 1VQ81 3CCJ1 1YITZ 3CD6Z 1YJW1 1JJ2Y 1VQ6Z 2OTL1 1YHQ1 3CCVZ 3CC71 1M1K2 1QVGY 3CMEZ 1VQ4Z 1Q7Y2 1QVGZ 3CC4Z 3CCEZ 1Q861 3G6EZ 3CCQ1 3G4SZ 3CXCY 1K9M1 3OW2Z 1Q822 1VQ71 3G71Z 2OTJZ 1VQ9Z 1YIT1 3CXCZ 1S72Z 1YJNZ 3CCLZ 1Q812 1KD11 1VQNZ 1VQ61 1M1K1 3CCV1 1VQP1 3I561 3CCSZ 1QVFY 1M901 3CME1 1YI21 1NJI2 1W2BY 3CC2Z 1VQ41 1JJ2Z 3CCR1 2QA4Z 2QEX1 3CC41 3CCE1 1QVFZ 1K8A2 1W2BZ 3G6E1 3CMAZ 3G4S1 3CPWY 1Q811 3I55Z 1VQ91 1YIJ1 3CPWZ 1YJN1 3CCL1 1S721 1KC82 1VQN1 3CCUZ 1VQ8Z 3CD61 1NJI1 3CCMZ 1YJWZ 3CC21 1YHQZ 1K8A1 1Q7Y1 2QA41 1VQOZ 1VQLZ 1VQKZ 1YJ9Z 1Q821 1K732 1VQ5Z 1Q862 3G711 1N8R2 2OTJ1 3CCU1 1VQMZ 1K9M2
chains in the Genus database with same CATH superfamily
2IZ3A 4A3FI 4BXXI 1KD12 4A3DI 4NBHA 3EERA 1KQSY 4A3MI 3GKQA 3FQQA 1YUKA 5FLXb 2RT9A 2JA7I 2QKDA 1YJ91 4MONA 3H3VJ 1K731 1N8R1 2JR6A 4RVFA 1Y1VI 5T64A 1WIIA 3NDIA 2PM9A 3GCFA 1YITZ 3I4MI 4E30A 3CD6Z 1JJ2Y 2YU9I 1VQ6Z 2OTL1 1YHQ1 2M48A 3CCVZ 3GTKI 3CC71 2F4MA 3Q87A 3F3FC 2AYDA 2DE5A 1ZB8A 2JS4A 3G6EZ 2JA8I 1AA6A 3PO2I 3G4SZ 2LFUA 3NH4A 1Q822 3VTNA 2QLVB 3J81b 4A3JI 4HH4A 4NBFA 4DK1A 3S1RI 1S7MA 1M1K1 2JIQA 4E31A 5C3EI 1M901 3CME1 1YI21 1NJI2 3CCR1 2QA4Z 1QVFZ 3EEDA 2JIMA 2H85A 3CPWY 3TE5B 1Q811 1USPB 1YIJ1 3I4NI 1S721 3CCL1 2VPXA 3J80b 3KIFA 1VQN1 3CCUZ 4QTTA 2R93I 3U50C 1Z03A 1YHQZ 1K8A1 2QRCB 2M6NA 3D2LA 1VQLZ 1VQKZ 1LQLA 2GTHA 4AYBA 3HOVI 1TWFI 1RQFA 4NFRA 1NP6A 5FLXf 3KIHA 1K83I 4EWCA 1VQMZ 4Y7NI 3HOZI 2OOYB 4RS4A 3FQMA 4NH1C 1TWHI 2P3YA 1YI2Z 3M3YI 4RVHA 1M902 3CCRZ 1KQSZ 1YUAA 1Z01A 4MH4A 1I50I 3I551 3BG1B 1TWGI 1KC81 2NVXI 3S1NI 3CCQZ 2E7ZA 2AKLA 1RO2A 2VF1A 3QWUA 1YIJZ 3ESWA 4BBSI 4TNUA 3CCJ1 2E2II 4NB8A 5LL6f 1YJW1 3HOYI 2LIYA 1I3QI 3J81f 4X6AI 4NBEA 1QVGY 1Y8CA 4XX2A 1VQ4Z 1Z02A 3MZLB 4RVDA 2NVQI 2R6MA 3P5JB 1K9M1 2RPRA 3OW2Z 1VQ71 2OOXB 1VQ9Z 3I07A 4A3GI 5T67A 2JNYA 1VQP1 4MD8A 3I561 2VUMI 4HGZA 5IT9b 3MZKB 3GTGI 1X0TA 1W2BY 3J80f 2W04A 1WCMI 3IF8A 2QEX1 3CC41 3CCE1 2JIOA 4E2WA 5FLMI 3I55Z 3CPWZ 1YJN1 1TWAI 3D9XA 3HOUI 1KC82 3J7A4 2JA5I 1ZB9A 2QREB 3H0GI 2BJOA 1L1OC 1YJWZ 2GTIA 3CC21 1FDIA 1Q7Y1 2V3VA 3IX0A 3F3PC 1RO4A 4DGLA 3S17I 4A3BI 3NH8A 1YJ9Z 3S16I 1Q16A 3BG0B 1JWHC 3T4NB 1ZH1A 5IP9I 1K732 3G711 1N8R2 4RVGA 4NBCA 1K9M2 1R9TI 2OZKA 3CCM1 1USPA 3CCS1 3M4OI 2QR1B 3MONA 1VQPZ 1VLAA 3I56Z 1VQO1 2OTLZ 2JUBA 4HGYA 2JA6I 1X3ZA 3CC7Z 2QEXZ 2HF1A 3GTJI 2ZAEB 1VQ51 2JIRA 4NBGA 2VPZA 4E2YA 1Y1WI 2P28A 1VQ81 3TDHB 4NBDA 4BY7I 1QXFA 4E32A 1ML8A 1SFOI 1M1K2 3CMEZ 2QRDB 5D1PA 2Q4ZA 1Q7Y2 1QVGZ 2JMOA 1Q861 4A3II 3RZOI 5IT9f 2RIQA 3CXCY 3G71Z 3CQZI 4MD9A 3VMIA 1P9NA 1YIT1 2WB1A 1S72Z 3CCLZ 2F4OA 1Q812 4NB9A 1VQNZ 1VQ61 3S1MI 3CCV1 2I3CA 4S1TA 2V8JA 3CCSZ 2VPYA 3HKZA 5T6BA 1RO0A 2PMZA 4DQYB 3GTOI 3GTMS 1PFTA 2LEXA 1JJ2Z 1FDOA 1X3WA 3JAMb 1K8A2 1W2BZ 2R7ZI 3G6E1 1WJ2A 3IR7A 3G4S1 1TFIA 1TWCI 2IV2X 1WZNA 4BBRI 1I6HI 1VQ8Z 2R92I 1NJI1 4A93I 2HU9A 3S15I 1NUIA 2NVYI 2QA41 2GU2A 2G2KA 3S1QI 4NBBA 2Y0SA 3VMGA 4E2ZA 2KI7B 2K3RA 1Q862 5C4JI 2OTJ1 3CCU1 2RHBA 3HOWI 1Y1VS 4NBAA 1RLYA 5A2Qb 3CCJZ 2B63I 4MD7A 1VQL1 1VQK1 4CL1A 2Q51A 2E9HA 3OW2Y 3CMA1 3S14I 3D6WA 5AN9F 1VQM1 3NFZA 2RBLA 4Y52I 1VQ7Z 3GTQI 3NDJA 2VPWA 2KPIA 3GTPI 3VMHA 1N2FA 2NAPA 3VB9A 3CC4Z 3CCEZ 4NOZA 3K7AI 2V8IA 2O53A 2V45A 3CCQ1 2DE7A 4E2XA 3JAMf 2OTJZ 5C4XI 3CXCZ 1YJNZ 3RZDI 4MXUA 1KD11 2J6AA 2EGTA 1RNIA 4BY1I 1QVFY 3S2HI 3CC2Z 3NH5A 2DE6A 1VQ41 3GTLI 4RV9A 2IZ4A 4A3KI 5IP7I 4A3LI 2W03A 4QTUA 1QF8A 1QYPA 3CMAZ 5CM2M 1DL6A 2O4HA 4MRIA 2JIPA 3PO3I 1VQ91 4A3CI 2NVTI 2K5RA 5D1OB 3GTMI 3CD61 3PO3S 2PK7A 3CCMZ 2V8KA 3HOXI 5D1OA 2YADA 3LUSA 2WAQA 1VQOZ 2VUGA 3S2DI 5A2Qf 5C44I 1KRLA 2E2JI 1Q821 4A3EI 1SIWA 2E2HI 1VQ5Z 3FKII 3IFUA 1WW9A 4E33A
chains in the Genus database with same CATH topology
2IZ3A 4A3FI 4BXXI 1KD12 4A3DI 4NBHA 3EERA 1KQSY 4A3MI 3GKQA 3FQQA 1YUKA 5FLXb 2RT9A 2JA7I 2QKDA 1YJ91 4MONA 3H3VJ 1K731 1N8R1 2JR6A 4RVFA 1Y1VI 5T64A 1WIIA 3NDIA 2PM9A 3GCFA 1YITZ 3I4MI 4E30A 3CD6Z 1JJ2Y 2YU9I 1VQ6Z 2OTL1 1YHQ1 2M48A 3CCVZ 3GTKI 3CC71 2F4MA 3Q87A 3F3FC 2DE5A 1ZB8A 2JS4A 3G6EZ 2JA8I 3PO2I 3G4SZ 2LFUA 3NH4A 1Q822 3VTNA 2QLVB 3J81b 4A3JI 4HH4A 4NBFA 4DK1A 3S1RI 1S7MA 1M1K1 4E31A 5C3EI 1M901 3CME1 1YI21 1NJI2 3CCR1 2QA4Z 1QVFZ 3EEDA 2H85A 3CPWY 3TE5B 1Q811 1USPB 1YIJ1 3I4NI 1S721 3CCL1 3J80b 3KIFA 1VQN1 3CCUZ 4QTTA 2R93I 3U50C 1Z03A 1YHQZ 1K8A1 2QRCB 2M6NA 1VQLZ 1VQKZ 1LQLA 2GTHA 4AYBA 3HOVI 1TWFI 1RQFA 4NFRA 1NP6A 5FLXf 3KIHA 1K83I 4EWCA 1VQMZ 4Y7NI 3HOZI 2OOYB 4RS4A 3FQMA 4NH1C 1TWHI 2P3YA 1YI2Z 3M3YI 4RVHA 1M902 3CCRZ 1KQSZ 1YUAA 1Z01A 4MH4A 1I50I 3I551 3BG1B 1TWGI 1KC81 2NVXI 3S1NI 3CCQZ 2AKLA 1RO2A 2VF1A 3QWUA 1YIJZ 3ESWA 4BBSI 4TNUA 3CCJ1 2E2II 4NB8A 5LL6f 1YJW1 3HOYI 2LIYA 1I3QI 3J81f 4X6AI 4NBEA 1QVGY 4XX2A 1VQ4Z 1Z02A 3MZLB 4RVDA 2NVQI 2R6MA 3P5JB 1K9M1 2RPRA 3OW2Z 1VQ71 2OOXB 1VQ9Z 3I07A 4A3GI 5T67A 2JNYA 1VQP1 4MD8A 3I561 2VUMI 4HGZA 5IT9b 3MZKB 3GTGI 1X0TA 1W2BY 3J80f 2W04A 1WCMI 3IF8A 2QEX1 3CC41 3CCE1 4E2WA 5FLMI 3I55Z 3CPWZ 1YJN1 1TWAI 3D9XA 3HOUI 1KC82 3J7A4 2JA5I 1ZB9A 2QREB 3H0GI 2BJOA 1L1OC 1YJWZ 2GTIA 3CC21 1Q7Y1 3IX0A 3F3PC 1RO4A 4DGLA 3S17I 4A3BI 3NH8A 1YJ9Z 3S16I 3BG0B 1JWHC 3T4NB 1ZH1A 5IP9I 1K732 3G711 1N8R2 4RVGA 4NBCA 1K9M2 1R9TI 2OZKA 3CCM1 1USPA 3CCS1 3M4OI 2QR1B 3MONA 1VQPZ 1VLAA 3I56Z 1VQO1 2OTLZ 2JUBA 4HGYA 2JA6I 1X3ZA 3CC7Z 2QEXZ 2HF1A 3GTJI 2ZAEB 1VQ51 4NBGA 4E2YA 1Y1WI 2P28A 1VQ81 3TDHB 4NBDA 4BY7I 4E32A 1ML8A 1SFOI 1M1K2 3CMEZ 2QRDB 5D1PA 2Q4ZA 1Q7Y2 1QVGZ 2JMOA 1Q861 4A3II 3RZOI 5IT9f 2RIQA 3CXCY 3G71Z 3CQZI 4MD9A 3VMIA 1P9NA 1YIT1 2WB1A 1S72Z 3CCLZ 2F4OA 1Q812 4NB9A 1VQNZ 1VQ61 3S1MI 3CCV1 2I3CA 4S1TA 2V8JA 3CCSZ 3HKZA 5T6BA 1RO0A 2PMZA 4DQYB 3GTOI 3GTMS 1PFTA 1JJ2Z 1X3WA 3JAMb 1K8A2 1W2BZ 2R7ZI 3G6E1 3G4S1 1TFIA 1TWCI 4BBRI 1I6HI 1VQ8Z 2R92I 1NJI1 4A93I 2HU9A 3S15I 1NUIA 2NVYI 2QA41 2GU2A 2G2KA 3S1QI 4NBBA 2Y0SA 3VMGA 4E2ZA 2KI7B 2K3RA 1Q862 5C4JI 2OTJ1 3CCU1 2RHBA 3HOWI 1Y1VS 4NBAA 1RLYA 5A2Qb 3CCJZ 2B63I 4MD7A 1VQL1 1VQK1 4CL1A 2Q51A 2E9HA 3OW2Y 3CMA1 3S14I 3D6WA 5AN9F 1VQM1 3NFZA 2RBLA 4Y52I 1VQ7Z 3GTQI 3NDJA 2KPIA 3GTPI 3VMHA 1N2FA 3VB9A 3CC4Z 3CCEZ 4NOZA 3K7AI 2V8IA 2O53A 3CCQ1 2DE7A 4E2XA 3JAMf 2OTJZ 5C4XI 3CXCZ 1YJNZ 3RZDI 4MXUA 1KD11 2J6AA 2EGTA 1RNIA 4BY1I 1QVFY 3S2HI 3CC2Z 3NH5A 2DE6A 1VQ41 3GTLI 4RV9A 2IZ4A 4A3KI 5IP7I 4A3LI 2W03A 4QTUA 1QF8A 1QYPA 3CMAZ 5CM2M 1DL6A 2O4HA 4MRIA 3PO3I 1VQ91 4A3CI 2NVTI 2K5RA 5D1OB 3GTMI 3CD61 3PO3S 2PK7A 3CCMZ 2V8KA 3HOXI 5D1OA 2YADA 3LUSA 2WAQA 1VQOZ 2VUGA 3S2DI 5A2Qf 5C44I 1KRLA 2E2JI 1Q821 4A3EI 2E2HI 1VQ5Z 3FKII 3IFUA 1WW9A 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM 1;  3CCJ Z;  3CCS 1;  1KD1 2;  1VQP Z;  1VQO 1;  3I56 Z;  1KQS Y;  2OTL Z;  1YI2 Z;  3CC7 Z;  1VQL 1;  1VQK 1;  1YJ9 1;  1KQS Z;  1M90 2;  3CCR Z;  1K73 1;  2QEX Z;  3OW2 Y;  3CMA 1;  1N8R 1;  1VQ5 1;  3I55 1;  1KC8 1;  3CCQ Z;  1VQM 1;  1YIJ Z;  1VQ7 Z;  1VQ8 1;  3CCJ 1;  1YIT Z;  3CD6 Z;  1YJW 1;  1JJ2 Y;  1VQ6 Z;  2OTL 1;  1YHQ 1;  3CCV Z;  3CC7 1;  1M1K 2;  1QVG Y;  3CME Z;  1VQ4 Z;  1Q7Y 2;  1QVG Z;  3CC4 Z;  3CCE Z;  1Q86 1;  3G6E Z;  3CCQ 1;  3G4S Z;  3CXC Y;  1K9M 1;  3OW2 Z;  1Q82 2;  1VQ7 1;  3G71 Z;  2OTJ Z;  1VQ9 Z;  1YIT 1;  3CXC Z;  1S72 Z;  1YJN Z;  3CCL Z;  1Q81 2;  1KD1 1;  1VQN Z;  1VQ6 1;  1M1K 1;  3CCV 1;  1VQP 1;  3I56 1;  3CCS Z;  1QVF Y;  1M90 1;  3CME 1;  1YI2 1;  1NJI 2;  1W2B Y;  3CC2 Z;  1VQ4 1;  1JJ2 Z;  3CCR 1;  2QA4 Z;  2QEX 1;  3CC4 1;  3CCE 1;  1QVF Z;  1K8A 2;  1W2B Z;  3G6E 1;  3CMA Z;  3G4S 1;  3CPW Y;  1Q81 1;  3I55 Z;  1VQ9 1;  1YIJ 1;  3CPW Z;  1YJN 1;  3CCL 1;  1S72 1;  1KC8 2;  1VQN 1;  3CCU Z;  1VQ8 Z;  3CD6 1;  1NJI 1;  3CCM Z;  1YJW Z;  3CC2 1;  1YHQ Z;  1K8A 1;  1Q7Y 1;  2QA4 1;  1VQO Z;  1VQL Z;  1VQK Z;  1YJ9 Z;  1Q82 1;  1K73 2;  1VQ5 Z;  1Q86 2;  3G71 1;  1N8R 2;  2OTJ 1;  3CCU 1;  1VQM Z;  1K9M 2; 
#chains in the Genus database with same CATH topology
 2IZ3 A;  4A3F I;  4BXX I;  1KD1 2;  4A3D I;  4NBH A;  3EER A;  1KQS Y;  4A3M I;  3GKQ A;  3FQQ A;  1YUK A;  5FLX b;  2RT9 A;  2JA7 I;  2QKD A;  1YJ9 1;  4MON A;  3H3V J;  1K73 1;  1N8R 1;  2JR6 A;  4RVF A;  1Y1V I;  5T64 A;  1WII A;  3NDI A;  2PM9 A;  3GCF A;  1YIT Z;  3I4M I;  4E30 A;  3CD6 Z;  1JJ2 Y;  2YU9 I;  1VQ6 Z;  2OTL 1;  1YHQ 1;  2M48 A;  3CCV Z;  3GTK I;  3CC7 1;  2F4M A;  3Q87 A;  3F3F C;  2AYD A;  2DE5 A;  1ZB8 A;  2JS4 A;  3G6E Z;  2JA8 I;  1AA6 A;  3PO2 I;  3G4S Z;  2LFU A;  3NH4 A;  1Q82 2;  3VTN A;  2QLV B;  3J81 b;  4A3J I;  4HH4 A;  4NBF A;  4DK1 A;  3S1R I;  1S7M A;  1M1K 1;  2JIQ A;  4E31 A;  5C3E I;  1M90 1;  3CME 1;  1YI2 1;  1NJI 2;  3CCR 1;  2QA4 Z;  1QVF Z;  3EED A;  2JIM A;  2H85 A;  3CPW Y;  3TE5 B;  1Q81 1;  1USP B;  1YIJ 1;  3I4N I;  1S72 1;  3CCL 1;  2VPX A;  3J80 b;  3KIF A;  1VQN 1;  3CCU Z;  4QTT A;  2R93 I;  3U50 C;  1Z03 A;  1YHQ Z;  1K8A 1;  2QRC B;  2M6N A;  3D2L A;  1VQL Z;  1VQK Z;  1LQL A;  2GTH A;  4AYB A;  3HOV I;  1TWF I;  1RQF A;  4NFR A;  1NP6 A;  5FLX f;  3KIH A;  1K83 I;  4EWC A;  1VQM Z;  4Y7N I;  3HOZ I;  2OOY B;  4RS4 A;  3FQM A;  4NH1 C;  1TWH I;  2P3Y A;  1YI2 Z;  3M3Y I;  4RVH A;  1M90 2;  3CCR Z;  1KQS Z;  1YUA A;  1Z01 A;  4MH4 A;  1I50 I;  3I55 1;  3BG1 B;  1TWG I;  1KC8 1;  2NVX I;  3S1N I;  3CCQ Z;  2E7Z A;  2AKL A;  1RO2 A;  2VF1 A;  3QWU A;  1YIJ Z;  3ESW A;  4BBS I;  4TNU A;  3CCJ 1;  2E2I I;  4NB8 A;  5LL6 f;  1YJW 1;  3HOY I;  2LIY A;  1I3Q I;  3J81 f;  4X6A I;  4NBE A;  1QVG Y;  1Y8C A;  4XX2 A;  1VQ4 Z;  1Z02 A;  3MZL B;  4RVD A;  2NVQ I;  2R6M A;  3P5J B;  1K9M 1;  2RPR A;  3OW2 Z;  1VQ7 1;  2OOX B;  1VQ9 Z;  3I07 A;  4A3G I;  5T67 A;  2JNY A;  1VQP 1;  4MD8 A;  3I56 1;  2VUM I;  4HGZ A;  5IT9 b;  3MZK B;  3GTG I;  1X0T A;  1W2B Y;  3J80 f;  2W04 A;  1WCM I;  3IF8 A;  2QEX 1;  3CC4 1;  3CCE 1;  2JIO A;  4E2W A;  5FLM I;  3I55 Z;  3CPW Z;  1YJN 1;  1TWA I;  3D9X A;  3HOU I;  1KC8 2;  3J7A 4;  2JA5 I;  1ZB9 A;  2QRE B;  3H0G I;  2BJO A;  1L1O C;  1YJW Z;  2GTI A;  3CC2 1;  1FDI A;  1Q7Y 1;  2V3V A;  3IX0 A;  3F3P C;  1RO4 A;  4DGL A;  3S17 I;  4A3B I;  3NH8 A;  1YJ9 Z;  3S16 I;  1Q16 A;  3BG0 B;  1JWH C;  3T4N B;  1ZH1 A;  5IP9 I;  1K73 2;  3G71 1;  1N8R 2;  4RVG A;  4NBC A;  1K9M 2;  1R9T I;  2OZK A;  3CCM 1;  1USP A;  3CCS 1;  3M4O I;  2QR1 B;  3MON A;  1VQP Z;  1VLA A;  3I56 Z;  1VQO 1;  2OTL Z;  2JUB A;  4HGY A;  2JA6 I;  1X3Z A;  3CC7 Z;  2QEX Z;  2HF1 A;  3GTJ I;  2ZAE B;  1VQ5 1;  2JIR A;  4NBG A;  2VPZ A;  4E2Y A;  1Y1W I;  2P28 A;  1VQ8 1;  3TDH B;  4NBD A;  4BY7 I;  1QXF A;  4E32 A;  1ML8 A;  1SFO I;  1M1K 2;  3CME Z;  2QRD B;  5D1P A;  2Q4Z A;  1Q7Y 2;  1QVG Z;  2JMO A;  1Q86 1;  4A3I I;  3RZO I;  5IT9 f;  2RIQ A;  3CXC Y;  3G71 Z;  3CQZ I;  4MD9 A;  3VMI A;  1P9N A;  1YIT 1;  2WB1 A;  1S72 Z;  3CCL Z;  2F4O A;  1Q81 2;  4NB9 A;  1VQN Z;  1VQ6 1;  3S1M I;  3CCV 1;  2I3C A;  4S1T A;  2V8J A;  3CCS Z;  2VPY A;  3HKZ A;  5T6B A;  1RO0 A;  2PMZ A;  4DQY B;  3GTO I;  3GTM S;  1PFT A;  2LEX A;  1JJ2 Z;  1FDO A;  1X3W A;  3JAM b;  1K8A 2;  1W2B Z;  2R7Z I;  3G6E 1;  1WJ2 A;  3IR7 A;  3G4S 1;  1TFI A;  1TWC I;  2IV2 X;  1WZN A;  4BBR I;  1I6H I;  1VQ8 Z;  2R92 I;  1NJI 1;  4A93 I;  2HU9 A;  3S15 I;  1NUI A;  2NVY I;  2QA4 1;  2GU2 A;  2G2K A;  3S1Q I;  4NBB A;  2Y0S A;  3VMG A;  4E2Z A;  2KI7 B;  2K3R A;  1Q86 2;  5C4J I;  2OTJ 1;  3CCU 1;  2RHB A;  3HOW I;  1Y1V S;  4NBA A;  1RLY A;  5A2Q b;  3CCJ Z;  2B63 I;  4MD7 A;  1VQL 1;  1VQK 1;  4CL1 A;  2Q51 A;  2E9H A;  3OW2 Y;  3CMA 1;  3S14 I;  3D6W A;  5AN9 F;  1VQM 1;  3NFZ A;  2RBL A;  4Y52 I;  1VQ7 Z;  3GTQ I;  3NDJ A;  2VPW A;  2KPI A;  3GTP I;  3VMH A;  1N2F A;  2NAP A;  3VB9 A;  3CC4 Z;  3CCE Z;  4NOZ A;  3K7A I;  2V8I A;  2O53 A;  2V45 A;  3CCQ 1;  2DE7 A;  4E2X A;  3JAM f;  2OTJ Z;  5C4X I;  3CXC Z;  1YJN Z;  3RZD I;  4MXU A;  1KD1 1;  2J6A A;  2EGT A;  1RNI A;  4BY1 I;  1QVF Y;  3S2H I;  3CC2 Z;  3NH5 A;  2DE6 A;  1VQ4 1;  3GTL I;  4RV9 A;  2IZ4 A;  4A3K I;  5IP7 I;  4A3L I;  2W03 A;  4QTU A;  1QF8 A;  1QYP A;  3CMA Z;  5CM2 M;  1DL6 A;  2O4H A;  4MRI A;  2JIP A;  3PO3 I;  1VQ9 1;  4A3C I;  2NVT I;  2K5R A;  5D1O B;  3GTM I;  3CD6 1;  3PO3 S;  2PK7 A;  3CCM Z;  2V8K A;  3HOX I;  5D1O A;  2YAD A;  3LUS A;  2WAQ A;  1VQO Z;  2VUG A;  3S2D I;  5A2Q f;  5C44 I;  1KRL A;  2E2J I;  1Q82 1;  4A3E I;  1SIW A;  2E2H I;  1VQ5 Z;  3FKI I;  3IFU A;  1WW9 A;  4E33 A; 
#chains in the Genus database with same CATH homology
 2IZ3 A;  4A3F I;  4BXX I;  1KD1 2;  4A3D I;  4NBH A;  3EER A;  1KQS Y;  4A3M I;  3GKQ A;  3FQQ A;  1YUK A;  5FLX b;  2RT9 A;  2JA7 I;  2QKD A;  1YJ9 1;  4MON A;  3H3V J;  1K73 1;  1N8R 1;  2JR6 A;  4RVF A;  1Y1V I;  5T64 A;  1WII A;  3NDI A;  2PM9 A;  3GCF A;  1YIT Z;  3I4M I;  4E30 A;  3CD6 Z;  1JJ2 Y;  2YU9 I;  1VQ6 Z;  2OTL 1;  1YHQ 1;  2M48 A;  3CCV Z;  3GTK I;  3CC7 1;  2F4M A;  3Q87 A;  3F3F C;  2DE5 A;  1ZB8 A;  2JS4 A;  3G6E Z;  2JA8 I;  3PO2 I;  3G4S Z;  2LFU A;  3NH4 A;  1Q82 2;  3VTN A;  2QLV B;  3J81 b;  4A3J I;  4HH4 A;  4NBF A;  4DK1 A;  3S1R I;  1S7M A;  1M1K 1;  4E31 A;  5C3E I;  1M90 1;  3CME 1;  1YI2 1;  1NJI 2;  3CCR 1;  2QA4 Z;  1QVF Z;  3EED A;  2H85 A;  3CPW Y;  3TE5 B;  1Q81 1;  1USP B;  1YIJ 1;  3I4N I;  1S72 1;  3CCL 1;  3J80 b;  3KIF A;  1VQN 1;  3CCU Z;  4QTT A;  2R93 I;  3U50 C;  1Z03 A;  1YHQ Z;  1K8A 1;  2QRC B;  2M6N A;  1VQL Z;  1VQK Z;  1LQL A;  2GTH A;  4AYB A;  3HOV I;  1TWF I;  1RQF A;  4NFR A;  1NP6 A;  5FLX f;  3KIH A;  1K83 I;  4EWC A;  1VQM Z;  4Y7N I;  3HOZ I;  2OOY B;  4RS4 A;  3FQM A;  4NH1 C;  1TWH I;  2P3Y A;  1YI2 Z;  3M3Y I;  4RVH A;  1M90 2;  3CCR Z;  1KQS Z;  1YUA A;  1Z01 A;  4MH4 A;  1I50 I;  3I55 1;  3BG1 B;  1TWG I;  1KC8 1;  2NVX I;  3S1N I;  3CCQ Z;  2AKL A;  1RO2 A;  2VF1 A;  3QWU A;  1YIJ Z;  3ESW A;  4BBS I;  4TNU A;  3CCJ 1;  2E2I I;  4NB8 A;  5LL6 f;  1YJW 1;  3HOY I;  2LIY A;  1I3Q I;  3J81 f;  4X6A I;  4NBE A;  1QVG Y;  4XX2 A;  1VQ4 Z;  1Z02 A;  3MZL B;  4RVD A;  2NVQ I;  2R6M A;  3P5J B;  1K9M 1;  2RPR A;  3OW2 Z;  1VQ7 1;  2OOX B;  1VQ9 Z;  3I07 A;  4A3G I;  5T67 A;  2JNY A;  1VQP 1;  4MD8 A;  3I56 1;  2VUM I;  4HGZ A;  5IT9 b;  3MZK B;  3GTG I;  1X0T A;  1W2B Y;  3J80 f;  2W04 A;  1WCM I;  3IF8 A;  2QEX 1;  3CC4 1;  3CCE 1;  4E2W A;  5FLM I;  3I55 Z;  3CPW Z;  1YJN 1;  1TWA I;  3D9X A;  3HOU I;  1KC8 2;  3J7A 4;  2JA5 I;  1ZB9 A;  2QRE B;  3H0G I;  2BJO A;  1L1O C;  1YJW Z;  2GTI A;  3CC2 1;  1Q7Y 1;  3IX0 A;  3F3P C;  1RO4 A;  4DGL A;  3S17 I;  4A3B I;  3NH8 A;  1YJ9 Z;  3S16 I;  3BG0 B;  1JWH C;  3T4N B;  1ZH1 A;  5IP9 I;  1K73 2;  3G71 1;  1N8R 2;  4RVG A;  4NBC A;  1K9M 2;  1R9T I;  2OZK A;  3CCM 1;  1USP A;  3CCS 1;  3M4O I;  2QR1 B;  3MON A;  1VQP Z;  1VLA A;  3I56 Z;  1VQO 1;  2OTL Z;  2JUB A;  4HGY A;  2JA6 I;  1X3Z A;  3CC7 Z;  2QEX Z;  2HF1 A;  3GTJ I;  2ZAE B;  1VQ5 1;  4NBG A;  4E2Y A;  1Y1W I;  2P28 A;  1VQ8 1;  3TDH B;  4NBD A;  4BY7 I;  4E32 A;  1ML8 A;  1SFO I;  1M1K 2;  3CME Z;  2QRD B;  5D1P A;  2Q4Z A;  1Q7Y 2;  1QVG Z;  2JMO A;  1Q86 1;  4A3I I;  3RZO I;  5IT9 f;  2RIQ A;  3CXC Y;  3G71 Z;  3CQZ I;  4MD9 A;  3VMI A;  1P9N A;  1YIT 1;  2WB1 A;  1S72 Z;  3CCL Z;  2F4O A;  1Q81 2;  4NB9 A;  1VQN Z;  1VQ6 1;  3S1M I;  3CCV 1;  2I3C A;  4S1T A;  2V8J A;  3CCS Z;  3HKZ A;  5T6B A;  1RO0 A;  2PMZ A;  4DQY B;  3GTO I;  3GTM S;  1PFT A;  1JJ2 Z;  1X3W A;  3JAM b;  1K8A 2;  1W2B Z;  2R7Z I;  3G6E 1;  3G4S 1;  1TFI A;  1TWC I;  4BBR I;  1I6H I;  1VQ8 Z;  2R92 I;  1NJI 1;  4A93 I;  2HU9 A;  3S15 I;  1NUI A;  2NVY I;  2QA4 1;  2GU2 A;  2G2K A;  3S1Q I;  4NBB A;  2Y0S A;  3VMG A;  4E2Z A;  2KI7 B;  2K3R A;  1Q86 2;  5C4J I;  2OTJ 1;  3CCU 1;  2RHB A;  3HOW I;  1Y1V S;  4NBA A;  1RLY A;  5A2Q b;  3CCJ Z;  2B63 I;  4MD7 A;  1VQL 1;  1VQK 1;  4CL1 A;  2Q51 A;  2E9H A;  3OW2 Y;  3CMA 1;  3S14 I;  3D6W A;  5AN9 F;  1VQM 1;  3NFZ A;  2RBL A;  4Y52 I;  1VQ7 Z;  3GTQ I;  3NDJ A;  2KPI A;  3GTP I;  3VMH A;  1N2F A;  3VB9 A;  3CC4 Z;  3CCE Z;  4NOZ A;  3K7A I;  2V8I A;  2O53 A;  3CCQ 1;  2DE7 A;  4E2X A;  3JAM f;  2OTJ Z;  5C4X I;  3CXC Z;  1YJN Z;  3RZD I;  4MXU A;  1KD1 1;  2J6A A;  2EGT A;  1RNI A;  4BY1 I;  1QVF Y;  3S2H I;  3CC2 Z;  3NH5 A;  2DE6 A;  1VQ4 1;  3GTL I;  4RV9 A;  2IZ4 A;  4A3K I;  5IP7 I;  4A3L I;  2W03 A;  4QTU A;  1QF8 A;  1QYP A;  3CMA Z;  5CM2 M;  1DL6 A;  2O4H A;  4MRI A;  3PO3 I;  1VQ9 1;  4A3C I;  2NVT I;  2K5R A;  5D1O B;  3GTM I;  3CD6 1;  3PO3 S;  2PK7 A;  3CCM Z;  2V8K A;  3HOX I;  5D1O A;  2YAD A;  3LUS A;  2WAQ A;  1VQO Z;  2VUG A;  3S2D I;  5A2Q f;  5C44 I;  1KRL A;  2E2J I;  1Q82 1;  4A3E I;  2E2H I;  1VQ5 Z;  3FKI I;  3IFU A;  1WW9 A;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...