3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
3I551 1VQ41 3CCR1 3I55Z 1VQ4Z 3CCEZ 3CXCZ 3CCRZ 1VQ81 3CPWY 1M902 2OTJ1 1VQ8Z 1VQ71 1N8R1 2OTJZ 1Q822 1VQL1 1VQ7Z 1VQLZ 1QVGZ 1K731 3CCV1 3CCM1 3CCVZ 3G4S1 1JJ2Z 2OTLZ 3G4SZ 1M901 3CCU1 3CCUZ 1YHQ1 1Q811 1QVFY 1KC81 1Q7Y2 1K8A1 1M1K2 1YHQZ 1K9M2 1VQN1 3CCJ1 1JJ2Y 3CMA1 2QEX1 1VQNZ 3CCL1 1Q862 1KD12 1NJI2 3CMAZ 3CC21 3OW2Z 2QEXZ 1S721 3CC2Z 3CD61 1S72Z 3CD6Z 3G6E1 3CCMZ 3CXCY 2QA41 3G6EZ 1YI21 2QA4Z 3CME1 1YIT1 1KQSZ 1YI2Z 3CMEZ 1YITZ 1QVGY 1Q821 3CCQ1 1VQ61 1VQ51 1N8R2 3CPWZ 3CCQZ 1VQ6Z 1VQ5Z 3CCS1 1W2BZ 1K732 3CCJZ 3CCSZ 1VQK1 3CC71 3CCLZ 1VQM1 1YIJ1 1YJ91 3G711 1VQMZ 1YIJZ 1YJ9Z 3CCE1 1YJW1 3G71Z 1YJWZ 1VQO1 1Q7Y1 1M1K1 1VQOZ 1Q812 1KC82 1W2BY 1K9M1 1K8A2 3OW2Y 1QVFZ 1YJN1 1VQ91 1VQP1 1Q861 1KD11 1NJI1 1YJNZ 1VQ9Z 1VQPZ 3I561 2OTL1 3CC41 3I56Z 1VQKZ 1KQSY 3CC7Z 3CC4Z
chains in the Genus database with same CATH superfamily
3I551 5A2Qf 3CCR1 1VQ4Z 3NH8A 4NBFA 3M4OI 1YUAA 2G2KA 5T64A 1M902 3I4NI 5FLXb 3BG1B 1VQ71 1N8R1 1SIWA 2RBLA 5C3EI 1QVGZ 4NBGA 2QREB 1K731 1ZB9A 2JA6I 4X6AI 1L1OC 4BY1I 3CCM1 2IV2X 4DK1A 3CCVZ 3P5JB 4BBRI 2OTLZ 3G4SZ 3S1NI 3S2DI 4NBDA 4S1TA 4E30A 4NH1C 1X3ZA 2NVTI 1KC81 2NVXI 1K8A1 2W03A 2WAQA 1WJ2A 2PM9A 1VQN1 5FLXf 4MONA 1WW9A 5AN9F 3CC21 3OW2Z 1S7MA 3U50C 2DE5A 3CD61 3GTJI 2DE6A 3CCMZ 4BY7I 2R92I 2QA41 3CME1 1YIT1 1KQSZ 5C4XI 3NDJA 4MH4A 1RO0A 4NBBA 3HOXI 1VQ61 4NBCA 1QYPA 2NVYI 1VQ5Z 2Q51A 1VQK1 3S17I 3FQMA 3GCFA 1USPA 2P3YA 1TFIA 1YJ91 1I50I 3G711 1VQMZ 4MD9A 1YIJZ 1X3WA 3J80b 2K5RA 2JA8I 2QR1B 2V8IA 1X0TA 1QXFA 4NB8A 2M6NA 2W04A 1Q812 1W2BY 1TWAI 2KPIA 3VB9A 2JIQA 4DQYB 5T67A 3I07A 1VQ91 3HOYI 1Q16A 5D1PA 1USPB 1WZNA 1K83I 1LQLA 2WB1A 3I4MI 1VQKZ 3MZKB 2RT9A 1SFOI 3GTLI 4A3GI 4E2ZA 3VMIA 2JA5I 1VQ41 3TDHB 1ZB8A 2JIOA 2E2JI 3J80f 2VPZA 4RVGA 1WCMI 3BG0B 1JWHC 4HGYA 4E2WA 3CCV1 3G4S1 3EERA 1Y1VS 2OZKA 3H0GI 3MZLB 4A3DI 2JS4A 1RO4A 4BXXI 1Z03A 2QLVB 3H3VJ 4AYBA 3CCUZ 1Q811 1Q7Y2 4HGZA 1N2FA 1YHQZ 3HOUI 1QF8A 3CCJ1 1JJ2Y 1NP6A 2VUMI 4RV9A 1KD12 3CMAZ 4NBEA 3S14I 2GTHA 1TWCI 3CXCY 3Q87A 3G6EZ 3KIHA 1YI2Z 3PO2I 5IT9b 2RHBA 4RVDA 2V8JA 5C44I 1VQ51 2R93I 3S16I 1VLAA 1RO2A 4E33A 3NDIA 3MONA 4TNUA 3CCJZ 4A3II 1VQM1 1YIJ1 2GTIA 3CCE1 3GTOI 3D2LA 3TE5B 2R6MA 2V3VA 3HOWI 2M48A 1Q7Y1 1Z02A 2LIYA 4MRIA 2LEXA 1Y8CA 5IT9f 2VPYA 4MXUA 2E2II 1KD11 1YJNZ 4E31A 3M3YI 2BJOA 3I56Z 3GTMS 2JUBA 2GU2A 2E9HA 1NUIA 1Y1WI 3CCEZ 3CXCZ 3CQZI 3CPWY 4QTTA 4E32A 1VQ8Z 2O53A 2H85A 2OTJZ 1Q822 3PO3S 4MD8A 5D1OA 3D9XA 1VQLZ 3HOZI 4A93I 3S2HI 3GTPI 3IFUA 4DGLA 2O4HA 3QWUA 2VUGA 2JIPA 3RZDI 1RNIA 4HH4A 3JAMb 3F3FC 4QTUA 3VMHA 1R9TI 2V45A 4RVHA 1KRLA 2F4OA 2JIMA 4RS4A 3CCU1 2OOXB 3GTQI 1TWHI 1Y1VI 1YHQ1 1QVFY 5C4JI 4NB9A 4E2YA 5D1OB 1K9M2 3CMA1 3EEDA 3CCL1 1NJI2 2QEXZ 3K7AI 2PMZA 1S72Z 3J81b 3G6E1 1YI21 3FKII 3GKQA 2AYDA 3JAMf 2RPRA 1WIIA 1Q821 3VMGA 2IZ3A 3CPWZ 3CCQZ 4A3FI 5IP7I 3IF8A 3NH5A 2JA7I 2VPXA 1W2BZ 1FDOA 2F4MA 2VF1A 3CCSZ 3CC71 3CCLZ 3T4NB 2Y0SA 1PFTA 2HF1A 2YU9I 1YJWZ 3J81f 3GTKI 3KIFA 2NAPA 3IR7A 1VQOZ 1RLYA 2PK7A 1K9M1 4A3KI 4A3LI 1QVFZ 1YJN1 3ESWA 1NJI1 1ZH1A 2B63I 1VQPZ 2J6AA 3I561 5T6BA 1DL6A 4Y52I 2ZAEB 3CC7Z 3CC4Z 2LFUA 3I55Z 3LUSA 3CCRZ 1VQ81 3GTMI 2P28A 5FLMI 2OTJ1 1TWGI 4RVFA 1VQL1 1VQ7Z 3HOVI 1P9NA 4Y7NI 3GTGI 2QRCB 2QRDB 4A3JI 1Z01A 3NH4A 3S1QI 3PO3I 1JJ2Z 4NBAA 3NFZA 1FDIA 2E7ZA 3FQQA 3VTNA 2IZ4A 1M901 2DE7A 4A3BI 1TWFI 2JNYA 1M1K2 2VPWA 1I6HI 2QKDA 4MD7A 3S1RI 3S1MI 2JMOA 4EWCA 5CM2M 2Q4ZA 2QEX1 1VQNZ 1Q862 4NBHA 4XX2A 2RIQA 1S721 2I3CA 3CC2Z 2R7ZI 3CD6Z 1I3QI 2HU9A 1YUKA 5IP9I 2QA4Z 3CMEZ 1YITZ 3IX0A 2NVQI 2K3RA 4NFRA 1QVGY 3CCQ1 2EGTA 1N8R2 3J7A4 1VQ6Z 2E2HI 2AKLA 3CCS1 1K732 4CL1A 2OOYB 5A2Qb 2JR6A 5LL6f 4BBSI 4A3EI 1YJ9Z 1YJW1 3G71Z 3S15I 4E2XA 2JIRA 1RQFA 1VQO1 1AA6A 1M1K1 4NOZA 1KC82 1K8A2 3RZOI 3OW2Y 4A3MI 3D6WA 1VQP1 1Q861 2KI7B 2V8KA 1VQ9Z 3HKZA 3F3PC 2OTL1 3CC41 1ML8A 2YADA 1KQSY 4A3CI
chains in the Genus database with same CATH topology
3I551 5A2Qf 3CCR1 1VQ4Z 3NH8A 4NBFA 3M4OI 1YUAA 2G2KA 5T64A 1M902 3I4NI 5FLXb 3BG1B 1VQ71 1N8R1 2RBLA 5C3EI 1QVGZ 4NBGA 2QREB 1K731 1ZB9A 2JA6I 4X6AI 1L1OC 4BY1I 3CCM1 4DK1A 3CCVZ 3P5JB 4BBRI 2OTLZ 3G4SZ 3S1NI 3S2DI 4NBDA 4S1TA 4E30A 4NH1C 1X3ZA 2NVTI 1KC81 2NVXI 1K8A1 2W03A 2WAQA 2PM9A 1VQN1 5FLXf 4MONA 1WW9A 5AN9F 3CC21 3OW2Z 1S7MA 3U50C 2DE5A 3CD61 3GTJI 2DE6A 3CCMZ 4BY7I 2R92I 2QA41 3CME1 1YIT1 1KQSZ 5C4XI 3NDJA 4MH4A 1RO0A 4NBBA 3HOXI 1VQ61 4NBCA 1QYPA 2NVYI 1VQ5Z 2Q51A 1VQK1 3S17I 3FQMA 3GCFA 1USPA 2P3YA 1TFIA 1YJ91 1I50I 3G711 1VQMZ 4MD9A 1YIJZ 1X3WA 3J80b 2K5RA 2JA8I 2QR1B 2V8IA 1X0TA 4NB8A 2M6NA 2W04A 1Q812 1W2BY 1TWAI 2KPIA 3VB9A 4DQYB 5T67A 3I07A 1VQ91 3HOYI 5D1PA 1USPB 1K83I 1LQLA 2WB1A 3I4MI 1VQKZ 3MZKB 2RT9A 1SFOI 3GTLI 4A3GI 4E2ZA 3VMIA 2JA5I 1VQ41 3TDHB 1ZB8A 2E2JI 3J80f 4RVGA 1WCMI 3BG0B 1JWHC 4HGYA 4E2WA 3CCV1 3G4S1 3EERA 1Y1VS 2OZKA 3H0GI 3MZLB 4A3DI 2JS4A 1RO4A 4BXXI 1Z03A 2QLVB 3H3VJ 4AYBA 3CCUZ 1Q811 1Q7Y2 4HGZA 1N2FA 1YHQZ 3HOUI 1QF8A 3CCJ1 1JJ2Y 1NP6A 2VUMI 4RV9A 1KD12 3CMAZ 4NBEA 3S14I 2GTHA 1TWCI 3CXCY 3Q87A 3G6EZ 3KIHA 1YI2Z 3PO2I 5IT9b 2RHBA 4RVDA 2V8JA 5C44I 1VQ51 2R93I 3S16I 1VLAA 1RO2A 4E33A 3NDIA 3MONA 4TNUA 3CCJZ 4A3II 1VQM1 1YIJ1 2GTIA 3CCE1 3GTOI 3TE5B 2R6MA 3HOWI 2M48A 1Q7Y1 1Z02A 2LIYA 4MRIA 5IT9f 4MXUA 2E2II 1KD11 1YJNZ 4E31A 3M3YI 2BJOA 3I56Z 3GTMS 2JUBA 2GU2A 2E9HA 1NUIA 1Y1WI 3CCEZ 3CXCZ 3CQZI 3CPWY 4QTTA 4E32A 1VQ8Z 2O53A 2H85A 2OTJZ 1Q822 3PO3S 4MD8A 5D1OA 3D9XA 1VQLZ 3HOZI 4A93I 3S2HI 3GTPI 3IFUA 4DGLA 2O4HA 3QWUA 2VUGA 3RZDI 1RNIA 4HH4A 3JAMb 3F3FC 4QTUA 3VMHA 1R9TI 4RVHA 1KRLA 2F4OA 4RS4A 3CCU1 2OOXB 3GTQI 1TWHI 1Y1VI 1YHQ1 1QVFY 5C4JI 4NB9A 4E2YA 5D1OB 1K9M2 3CMA1 3EEDA 3CCL1 1NJI2 2QEXZ 3K7AI 2PMZA 1S72Z 3J81b 3G6E1 1YI21 3FKII 3GKQA 3JAMf 2RPRA 1WIIA 1Q821 3VMGA 2IZ3A 3CPWZ 3CCQZ 4A3FI 5IP7I 3IF8A 3NH5A 2JA7I 1W2BZ 2F4MA 2VF1A 3CCSZ 3CC71 3CCLZ 3T4NB 2Y0SA 1PFTA 2HF1A 2YU9I 1YJWZ 3J81f 3GTKI 3KIFA 1VQOZ 1RLYA 2PK7A 1K9M1 4A3KI 4A3LI 1QVFZ 1YJN1 3ESWA 1NJI1 1ZH1A 2B63I 1VQPZ 2J6AA 3I561 5T6BA 1DL6A 4Y52I 2ZAEB 3CC7Z 3CC4Z 2LFUA 3I55Z 3LUSA 3CCRZ 1VQ81 3GTMI 2P28A 5FLMI 2OTJ1 1TWGI 4RVFA 1VQL1 1VQ7Z 3HOVI 1P9NA 4Y7NI 3GTGI 2QRCB 2QRDB 4A3JI 1Z01A 3NH4A 3S1QI 3PO3I 1JJ2Z 4NBAA 3NFZA 3FQQA 3VTNA 2IZ4A 1M901 2DE7A 4A3BI 1TWFI 2JNYA 1M1K2 1I6HI 2QKDA 4MD7A 3S1RI 3S1MI 2JMOA 4EWCA 5CM2M 2Q4ZA 2QEX1 1VQNZ 1Q862 4NBHA 4XX2A 2RIQA 1S721 2I3CA 3CC2Z 2R7ZI 3CD6Z 1I3QI 2HU9A 1YUKA 5IP9I 2QA4Z 3CMEZ 1YITZ 3IX0A 2NVQI 2K3RA 4NFRA 1QVGY 3CCQ1 2EGTA 1N8R2 3J7A4 1VQ6Z 2E2HI 2AKLA 3CCS1 1K732 4CL1A 2OOYB 5A2Qb 2JR6A 5LL6f 4BBSI 4A3EI 1YJ9Z 1YJW1 3G71Z 3S15I 4E2XA 1RQFA 1VQO1 1M1K1 4NOZA 1KC82 1K8A2 3RZOI 3OW2Y 4A3MI 3D6WA 1VQP1 1Q861 2KI7B 2V8KA 1VQ9Z 3HKZA 3F3PC 2OTL1 3CC41 1ML8A 2YADA 1KQSY 4A3CI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 1;  1VQ4 1;  3CCR 1;  3I55 Z;  1VQ4 Z;  3CCE Z;  3CXC Z;  3CCR Z;  1VQ8 1;  3CPW Y;  1M90 2;  2OTJ 1;  1VQ8 Z;  1VQ7 1;  1N8R 1;  2OTJ Z;  1Q82 2;  1VQL 1;  1VQ7 Z;  1VQL Z;  1QVG Z;  1K73 1;  3CCV 1;  3CCM 1;  3CCV Z;  3G4S 1;  1JJ2 Z;  2OTL Z;  3G4S Z;  1M90 1;  3CCU 1;  3CCU Z;  1YHQ 1;  1Q81 1;  1QVF Y;  1KC8 1;  1Q7Y 2;  1K8A 1;  1M1K 2;  1YHQ Z;  1K9M 2;  1VQN 1;  3CCJ 1;  1JJ2 Y;  3CMA 1;  2QEX 1;  1VQN Z;  3CCL 1;  1Q86 2;  1KD1 2;  1NJI 2;  3CMA Z;  3CC2 1;  3OW2 Z;  2QEX Z;  1S72 1;  3CC2 Z;  3CD6 1;  1S72 Z;  3CD6 Z;  3G6E 1;  3CCM Z;  3CXC Y;  2QA4 1;  3G6E Z;  1YI2 1;  2QA4 Z;  3CME 1;  1YIT 1;  1KQS Z;  1YI2 Z;  3CME Z;  1YIT Z;  1QVG Y;  1Q82 1;  3CCQ 1;  1VQ6 1;  1VQ5 1;  1N8R 2;  3CPW Z;  3CCQ Z;  1VQ6 Z;  1VQ5 Z;  3CCS 1;  1W2B Z;  1K73 2;  3CCJ Z;  3CCS Z;  1VQK 1;  3CC7 1;  3CCL Z;  1VQM 1;  1YIJ 1;  1YJ9 1;  3G71 1;  1VQM Z;  1YIJ Z;  1YJ9 Z;  3CCE 1;  1YJW 1;  3G71 Z;  1YJW Z;  1VQO 1;  1Q7Y 1;  1M1K 1;  1VQO Z;  1Q81 2;  1KC8 2;  1W2B Y;  1K9M 1;  1K8A 2;  3OW2 Y;  1QVF Z;  1YJN 1;  1VQ9 1;  1VQP 1;  1Q86 1;  1KD1 1;  1NJI 1;  1YJN Z;  1VQ9 Z;  1VQP Z;  3I56 1;  2OTL 1;  3CC4 1;  3I56 Z;  1VQK Z;  1KQS Y;  3CC7 Z;  3CC4 Z; 
#chains in the Genus database with same CATH topology
 3I55 1;  5A2Q f;  3CCR 1;  1VQ4 Z;  3NH8 A;  4NBF A;  3M4O I;  1YUA A;  2G2K A;  5T64 A;  1M90 2;  3I4N I;  5FLX b;  3BG1 B;  1VQ7 1;  1N8R 1;  1SIW A;  2RBL A;  5C3E I;  1QVG Z;  4NBG A;  2QRE B;  1K73 1;  1ZB9 A;  2JA6 I;  4X6A I;  1L1O C;  4BY1 I;  3CCM 1;  2IV2 X;  4DK1 A;  3CCV Z;  3P5J B;  4BBR I;  2OTL Z;  3G4S Z;  3S1N I;  3S2D I;  4NBD A;  4S1T A;  4E30 A;  4NH1 C;  1X3Z A;  2NVT I;  1KC8 1;  2NVX I;  1K8A 1;  2W03 A;  2WAQ A;  1WJ2 A;  2PM9 A;  1VQN 1;  5FLX f;  4MON A;  1WW9 A;  5AN9 F;  3CC2 1;  3OW2 Z;  1S7M A;  3U50 C;  2DE5 A;  3CD6 1;  3GTJ I;  2DE6 A;  3CCM Z;  4BY7 I;  2R92 I;  2QA4 1;  3CME 1;  1YIT 1;  1KQS Z;  5C4X I;  3NDJ A;  4MH4 A;  1RO0 A;  4NBB A;  3HOX I;  1VQ6 1;  4NBC A;  1QYP A;  2NVY I;  1VQ5 Z;  2Q51 A;  1VQK 1;  3S17 I;  3FQM A;  3GCF A;  1USP A;  2P3Y A;  1TFI A;  1YJ9 1;  1I50 I;  3G71 1;  1VQM Z;  4MD9 A;  1YIJ Z;  1X3W A;  3J80 b;  2K5R A;  2JA8 I;  2QR1 B;  2V8I A;  1X0T A;  1QXF A;  4NB8 A;  2M6N A;  2W04 A;  1Q81 2;  1W2B Y;  1TWA I;  2KPI A;  3VB9 A;  2JIQ A;  4DQY B;  5T67 A;  3I07 A;  1VQ9 1;  3HOY I;  1Q16 A;  5D1P A;  1USP B;  1WZN A;  1K83 I;  1LQL A;  2WB1 A;  3I4M I;  1VQK Z;  3MZK B;  2RT9 A;  1SFO I;  3GTL I;  4A3G I;  4E2Z A;  3VMI A;  2JA5 I;  1VQ4 1;  3TDH B;  1ZB8 A;  2JIO A;  2E2J I;  3J80 f;  2VPZ A;  4RVG A;  1WCM I;  3BG0 B;  1JWH C;  4HGY A;  4E2W A;  3CCV 1;  3G4S 1;  3EER A;  1Y1V S;  2OZK A;  3H0G I;  3MZL B;  4A3D I;  2JS4 A;  1RO4 A;  4BXX I;  1Z03 A;  2QLV B;  3H3V J;  4AYB A;  3CCU Z;  1Q81 1;  1Q7Y 2;  4HGZ A;  1N2F A;  1YHQ Z;  3HOU I;  1QF8 A;  3CCJ 1;  1JJ2 Y;  1NP6 A;  2VUM I;  4RV9 A;  1KD1 2;  3CMA Z;  4NBE A;  3S14 I;  2GTH A;  1TWC I;  3CXC Y;  3Q87 A;  3G6E Z;  3KIH A;  1YI2 Z;  3PO2 I;  5IT9 b;  2RHB A;  4RVD A;  2V8J A;  5C44 I;  1VQ5 1;  2R93 I;  3S16 I;  1VLA A;  1RO2 A;  4E33 A;  3NDI A;  3MON A;  4TNU A;  3CCJ Z;  4A3I I;  1VQM 1;  1YIJ 1;  2GTI A;  3CCE 1;  3GTO I;  3D2L A;  3TE5 B;  2R6M A;  2V3V A;  3HOW I;  2M48 A;  1Q7Y 1;  1Z02 A;  2LIY A;  4MRI A;  2LEX A;  1Y8C A;  5IT9 f;  2VPY A;  4MXU A;  2E2I I;  1KD1 1;  1YJN Z;  4E31 A;  3M3Y I;  2BJO A;  3I56 Z;  3GTM S;  2JUB A;  2GU2 A;  2E9H A;  1NUI A;  1Y1W I;  3CCE Z;  3CXC Z;  3CQZ I;  3CPW Y;  4QTT A;  4E32 A;  1VQ8 Z;  2O53 A;  2H85 A;  2OTJ Z;  1Q82 2;  3PO3 S;  4MD8 A;  5D1O A;  3D9X A;  1VQL Z;  3HOZ I;  4A93 I;  3S2H I;  3GTP I;  3IFU A;  4DGL A;  2O4H A;  3QWU A;  2VUG A;  2JIP A;  3RZD I;  1RNI A;  4HH4 A;  3JAM b;  3F3F C;  4QTU A;  3VMH A;  1R9T I;  2V45 A;  4RVH A;  1KRL A;  2F4O A;  2JIM A;  4RS4 A;  3CCU 1;  2OOX B;  3GTQ I;  1TWH I;  1Y1V I;  1YHQ 1;  1QVF Y;  5C4J I;  4NB9 A;  4E2Y A;  5D1O B;  1K9M 2;  3CMA 1;  3EED A;  3CCL 1;  1NJI 2;  2QEX Z;  3K7A I;  2PMZ A;  1S72 Z;  3J81 b;  3G6E 1;  1YI2 1;  3FKI I;  3GKQ A;  2AYD A;  3JAM f;  2RPR A;  1WII A;  1Q82 1;  3VMG A;  2IZ3 A;  3CPW Z;  3CCQ Z;  4A3F I;  5IP7 I;  3IF8 A;  3NH5 A;  2JA7 I;  2VPX A;  1W2B Z;  1FDO A;  2F4M A;  2VF1 A;  3CCS Z;  3CC7 1;  3CCL Z;  3T4N B;  2Y0S A;  1PFT A;  2HF1 A;  2YU9 I;  1YJW Z;  3J81 f;  3GTK I;  3KIF A;  2NAP A;  3IR7 A;  1VQO Z;  1RLY A;  2PK7 A;  1K9M 1;  4A3K I;  4A3L I;  1QVF Z;  1YJN 1;  3ESW A;  1NJI 1;  1ZH1 A;  2B63 I;  1VQP Z;  2J6A A;  3I56 1;  5T6B A;  1DL6 A;  4Y52 I;  2ZAE B;  3CC7 Z;  3CC4 Z;  2LFU A;  3I55 Z;  3LUS A;  3CCR Z;  1VQ8 1;  3GTM I;  2P28 A;  5FLM I;  2OTJ 1;  1TWG I;  4RVF A;  1VQL 1;  1VQ7 Z;  3HOV I;  1P9N A;  4Y7N I;  3GTG I;  2QRC B;  2QRD B;  4A3J I;  1Z01 A;  3NH4 A;  3S1Q I;  3PO3 I;  1JJ2 Z;  4NBA A;  3NFZ A;  1FDI A;  2E7Z A;  3FQQ A;  3VTN A;  2IZ4 A;  1M90 1;  2DE7 A;  4A3B I;  1TWF I;  2JNY A;  1M1K 2;  2VPW A;  1I6H I;  2QKD A;  4MD7 A;  3S1R I;  3S1M I;  2JMO A;  4EWC A;  5CM2 M;  2Q4Z A;  2QEX 1;  1VQN Z;  1Q86 2;  4NBH A;  4XX2 A;  2RIQ A;  1S72 1;  2I3C A;  3CC2 Z;  2R7Z I;  3CD6 Z;  1I3Q I;  2HU9 A;  1YUK A;  5IP9 I;  2QA4 Z;  3CME Z;  1YIT Z;  3IX0 A;  2NVQ I;  2K3R A;  4NFR A;  1QVG Y;  3CCQ 1;  2EGT A;  1N8R 2;  3J7A 4;  1VQ6 Z;  2E2H I;  2AKL A;  3CCS 1;  1K73 2;  4CL1 A;  2OOY B;  5A2Q b;  2JR6 A;  5LL6 f;  4BBS I;  4A3E I;  1YJ9 Z;  1YJW 1;  3G71 Z;  3S15 I;  4E2X A;  2JIR A;  1RQF A;  1VQO 1;  1AA6 A;  1M1K 1;  4NOZ A;  1KC8 2;  1K8A 2;  3RZO I;  3OW2 Y;  4A3M I;  3D6W A;  1VQP 1;  1Q86 1;  2KI7 B;  2V8K A;  1VQ9 Z;  3HKZ A;  3F3P C;  2OTL 1;  3CC4 1;  1ML8 A;  2YAD A;  1KQS Y;  4A3C I; 
#chains in the Genus database with same CATH homology
 3I55 1;  5A2Q f;  3CCR 1;  1VQ4 Z;  3NH8 A;  4NBF A;  3M4O I;  1YUA A;  2G2K A;  5T64 A;  1M90 2;  3I4N I;  5FLX b;  3BG1 B;  1VQ7 1;  1N8R 1;  2RBL A;  5C3E I;  1QVG Z;  4NBG A;  2QRE B;  1K73 1;  1ZB9 A;  2JA6 I;  4X6A I;  1L1O C;  4BY1 I;  3CCM 1;  4DK1 A;  3CCV Z;  3P5J B;  4BBR I;  2OTL Z;  3G4S Z;  3S1N I;  3S2D I;  4NBD A;  4S1T A;  4E30 A;  4NH1 C;  1X3Z A;  2NVT I;  1KC8 1;  2NVX I;  1K8A 1;  2W03 A;  2WAQ A;  2PM9 A;  1VQN 1;  5FLX f;  4MON A;  1WW9 A;  5AN9 F;  3CC2 1;  3OW2 Z;  1S7M A;  3U50 C;  2DE5 A;  3CD6 1;  3GTJ I;  2DE6 A;  3CCM Z;  4BY7 I;  2R92 I;  2QA4 1;  3CME 1;  1YIT 1;  1KQS Z;  5C4X I;  3NDJ A;  4MH4 A;  1RO0 A;  4NBB A;  3HOX I;  1VQ6 1;  4NBC A;  1QYP A;  2NVY I;  1VQ5 Z;  2Q51 A;  1VQK 1;  3S17 I;  3FQM A;  3GCF A;  1USP A;  2P3Y A;  1TFI A;  1YJ9 1;  1I50 I;  3G71 1;  1VQM Z;  4MD9 A;  1YIJ Z;  1X3W A;  3J80 b;  2K5R A;  2JA8 I;  2QR1 B;  2V8I A;  1X0T A;  4NB8 A;  2M6N A;  2W04 A;  1Q81 2;  1W2B Y;  1TWA I;  2KPI A;  3VB9 A;  4DQY B;  5T67 A;  3I07 A;  1VQ9 1;  3HOY I;  5D1P A;  1USP B;  1K83 I;  1LQL A;  2WB1 A;  3I4M I;  1VQK Z;  3MZK B;  2RT9 A;  1SFO I;  3GTL I;  4A3G I;  4E2Z A;  3VMI A;  2JA5 I;  1VQ4 1;  3TDH B;  1ZB8 A;  2E2J I;  3J80 f;  4RVG A;  1WCM I;  3BG0 B;  1JWH C;  4HGY A;  4E2W A;  3CCV 1;  3G4S 1;  3EER A;  1Y1V S;  2OZK A;  3H0G I;  3MZL B;  4A3D I;  2JS4 A;  1RO4 A;  4BXX I;  1Z03 A;  2QLV B;  3H3V J;  4AYB A;  3CCU Z;  1Q81 1;  1Q7Y 2;  4HGZ A;  1N2F A;  1YHQ Z;  3HOU I;  1QF8 A;  3CCJ 1;  1JJ2 Y;  1NP6 A;  2VUM I;  4RV9 A;  1KD1 2;  3CMA Z;  4NBE A;  3S14 I;  2GTH A;  1TWC I;  3CXC Y;  3Q87 A;  3G6E Z;  3KIH A;  1YI2 Z;  3PO2 I;  5IT9 b;  2RHB A;  4RVD A;  2V8J A;  5C44 I;  1VQ5 1;  2R93 I;  3S16 I;  1VLA A;  1RO2 A;  4E33 A;  3NDI A;  3MON A;  4TNU A;  3CCJ Z;  4A3I I;  1VQM 1;  1YIJ 1;  2GTI A;  3CCE 1;  3GTO I;  3TE5 B;  2R6M A;  3HOW I;  2M48 A;  1Q7Y 1;  1Z02 A;  2LIY A;  4MRI A;  5IT9 f;  4MXU A;  2E2I I;  1KD1 1;  1YJN Z;  4E31 A;  3M3Y I;  2BJO A;  3I56 Z;  3GTM S;  2JUB A;  2GU2 A;  2E9H A;  1NUI A;  1Y1W I;  3CCE Z;  3CXC Z;  3CQZ I;  3CPW Y;  4QTT A;  4E32 A;  1VQ8 Z;  2O53 A;  2H85 A;  2OTJ Z;  1Q82 2;  3PO3 S;  4MD8 A;  5D1O A;  3D9X A;  1VQL Z;  3HOZ I;  4A93 I;  3S2H I;  3GTP I;  3IFU A;  4DGL A;  2O4H A;  3QWU A;  2VUG A;  3RZD I;  1RNI A;  4HH4 A;  3JAM b;  3F3F C;  4QTU A;  3VMH A;  1R9T I;  4RVH A;  1KRL A;  2F4O A;  4RS4 A;  3CCU 1;  2OOX B;  3GTQ I;  1TWH I;  1Y1V I;  1YHQ 1;  1QVF Y;  5C4J I;  4NB9 A;  4E2Y A;  5D1O B;  1K9M 2;  3CMA 1;  3EED A;  3CCL 1;  1NJI 2;  2QEX Z;  3K7A I;  2PMZ A;  1S72 Z;  3J81 b;  3G6E 1;  1YI2 1;  3FKI I;  3GKQ A;  3JAM f;  2RPR A;  1WII A;  1Q82 1;  3VMG A;  2IZ3 A;  3CPW Z;  3CCQ Z;  4A3F I;  5IP7 I;  3IF8 A;  3NH5 A;  2JA7 I;  1W2B Z;  2F4M A;  2VF1 A;  3CCS Z;  3CC7 1;  3CCL Z;  3T4N B;  2Y0S A;  1PFT A;  2HF1 A;  2YU9 I;  1YJW Z;  3J81 f;  3GTK I;  3KIF A;  1VQO Z;  1RLY A;  2PK7 A;  1K9M 1;  4A3K I;  4A3L I;  1QVF Z;  1YJN 1;  3ESW A;  1NJI 1;  1ZH1 A;  2B63 I;  1VQP Z;  2J6A A;  3I56 1;  5T6B A;  1DL6 A;  4Y52 I;  2ZAE B;  3CC7 Z;  3CC4 Z;  2LFU A;  3I55 Z;  3LUS A;  3CCR Z;  1VQ8 1;  3GTM I;  2P28 A;  5FLM I;  2OTJ 1;  1TWG I;  4RVF A;  1VQL 1;  1VQ7 Z;  3HOV I;  1P9N A;  4Y7N I;  3GTG I;  2QRC B;  2QRD B;  4A3J I;  1Z01 A;  3NH4 A;  3S1Q I;  3PO3 I;  1JJ2 Z;  4NBA A;  3NFZ A;  3FQQ A;  3VTN A;  2IZ4 A;  1M90 1;  2DE7 A;  4A3B I;  1TWF I;  2JNY A;  1M1K 2;  1I6H I;  2QKD A;  4MD7 A;  3S1R I;  3S1M I;  2JMO A;  4EWC A;  5CM2 M;  2Q4Z A;  2QEX 1;  1VQN Z;  1Q86 2;  4NBH A;  4XX2 A;  2RIQ A;  1S72 1;  2I3C A;  3CC2 Z;  2R7Z I;  3CD6 Z;  1I3Q I;  2HU9 A;  1YUK A;  5IP9 I;  2QA4 Z;  3CME Z;  1YIT Z;  3IX0 A;  2NVQ I;  2K3R A;  4NFR A;  1QVG Y;  3CCQ 1;  2EGT A;  1N8R 2;  3J7A 4;  1VQ6 Z;  2E2H I;  2AKL A;  3CCS 1;  1K73 2;  4CL1 A;  2OOY B;  5A2Q b;  2JR6 A;  5LL6 f;  4BBS I;  4A3E I;  1YJ9 Z;  1YJW 1;  3G71 Z;  3S15 I;  4E2X A;  1RQF A;  1VQO 1;  1M1K 1;  4NOZ A;  1KC8 2;  1K8A 2;  3RZO I;  3OW2 Y;  4A3M I;  3D6W A;  1VQP 1;  1Q86 1;  2KI7 B;  2V8K A;  1VQ9 Z;  3HKZ A;  3F3P C;  2OTL 1;  3CC4 1;  1ML8 A;  2YAD A;  1KQS Y;  4A3C I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...