3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
1K8A1 1Q811 3G4S1 3G71Z 1JJ2Z 1YI2Z 1YI21 1QVGY 3CCJZ 3I56Z 1Q821 1JJ2Y 1VQKZ 3CCJ1 1VQK1 2QEXZ 3CC4Z 1VQ4Z 3G6EZ 3CD6Z 1M1K2 3CCRZ 2QEX1 3CC41 1VQ41 1VQ8Z 3G6E1 3CMAZ 3CD61 3CCR1 1KD12 1KQSZ 2OTJZ 1K9M2 1VQ81 3CMA1 1VQLZ 1N8R2 3CCMZ 1VQL1 3G711 3CCSZ 3CCQZ 3CCM1 1KQSY 1NJI1 3CCS1 3CCQ1 3CCLZ 3CCVZ 3CCL1 3CCV1 3I561 1VQ7Z 3CC7Z 1KC81 1Q862 1VQ71 1VQNZ 1VQ9Z 1M1K1 1VQN1 1VQMZ 3I55Z 1YHQZ 3CCUZ 1W2BZ 1YJWZ 2OTJ1 1KD11 1VQM1 1YHQ1 1M902 3CPWZ 1YJW1 1YJ9Z 1Q7Y2 3CMEZ 3CXCZ 1VQOZ 3CC2Z 3CME1 1W2BY 1VQO1 3CC21 3CPWY 1S72Z 1K732 1YIJZ 1YJNZ 1K8A2 3CXCY 1S721 1Q812 1YJN1 3G4SZ 1YITZ 3CC71 1QVFZ 3CCEZ 1YIT1 1VQ5Z 1Q861 3CCE1 1NJI2 1VQ51 1VQ91 2OTLZ 3OW2Z 3I551 1K9M1 3CCU1 1Q822 2OTL1 2QA4Z 1QVFY 1VQ6Z 1M901 2QA41 1N8R1 1YJ91 1KC82 1VQ61 1Q7Y1 3OW2Y 1VQPZ 1VQP1 1YIJ1 1K731 1QVGZ
chains in the Genus database with same CATH superfamily
2NVTI 3U50C 3G4S1 1TWGI 2GU2A 4NBHA 3H3VJ 1YI21 1QVGY 3D9XA 3MZKB 2VPWA 3HOYI 5D1OA 4BBSI 2NVYI 4A3BI 2VF1A 3F3FC 4E2YA 4NBDA 3CC4Z 4EWCA 1FDOA 3HOUI 3HOWI 1VQ8Z 3CMAZ 3CD61 2VUMI 4RV9A 2JIMA 2WAQA 3GTLI 2VPYA 3G711 3CCSZ 2W03A 3VMHA 3CCL1 2RPRA 3S16I 2RHBA 1Q862 1VQ71 1VQNZ 3S15I 2H85A 3HKZA 1W2BZ 2OTJ1 4A3LI 1YHQ1 1M902 1YJW1 1YJ9Z 3CMEZ 3VB9A 4DGLA 1TWCI 2JIPA 2P28A 2VUGA 3S1NI 2Q51A 2JA6I 3K7AI 1S72Z 3J81f 5A2Qf 3FQMA 1WZNA 3CXCY 1Q812 4NH1C 1Y1WI 2Q4ZA 3JAMf 4MH4A 1VQ5Z 4MRIA 1Q861 2O53A 2QRCB 3CQZI 2K3RA 2OTLZ 4BY7I 2PK7A 4RVGA 3ESWA 4NBEA 3CCU1 1Q822 2QA4Z 1QVFY 2R92I 2GTHA 3QWUA 2VPXA 3F3PC 3H0GI 1M901 5FLXf 4S1TA 1N8R1 1RO0A 3PO3S 4A3FI 3GKQA 3GCFA 3NDJA 2RBLA 1VQP1 3J80f 3BG1B 3GTKI 1WJ2A 3MONA 2BJOA 1Q811 4MD7A 3J81b 4HGYA 1JJ2Z 1Y1VS 3HOXI 3PO2I 3S1MI 4MD8A 3GTMI 1Q821 4NB8A 1VQKZ 5T64A 3S14I 2R7ZI 3I4MI 3G6EZ 1M1K2 3CCRZ 3CC41 1SFOI 1KD12 4E2WA 1KQSZ 1Z03A 1K9M2 3GTPI 1VQ81 3CMA1 2QREB 3NH5A 1VQLZ 4X6AI 3J80b 3CCMZ 3CCQZ 2R6MA 1NJI1 3I07A 3CCS1 2PMZA 1SIWA 1ZB8A 4A93I 1K83I 4DK1A 4A3CI 5T6BA 5C3EI 4RVFA 3I561 3FKII 5FLMI 3RZDI 2IZ4A 4A3EI 4BBRI 2OOYB 3D2LA 4AYBA 1M1K1 1VQN1 5IP7I 1VQMZ 2E7ZA 3I55Z 1WIIA 1KD11 1YUAA 4E33A 3S1RI 4HGZA 1YUKA 3CPWZ 2OZKA 1Q7Y2 5AN9F 1VQOZ 3CC2Z 3CME1 1W2BY 4NB9A 3IF8A 4NBCA 1Q16A 4E30A 2F4MA 3J7A4 1K732 3Q87A 3M4OI 5IT9f 1K8A2 1S721 3RZOI 3LUSA 1Z01A 3G4SZ 1YITZ 3CC71 1RQFA 2JA7I 2QKDA 2IZ3A 3IX0A 4NBGA 5LL6f 1RLYA 1VQ51 2OOXB 1VQ91 4A3DI 2RT9A 3OW2Z 2DE5A 2JIRA 2OTL1 4NBFA 2V8JA 1VQ6Z 3VMGA 2QA41 1KC82 4Y7NI 1I50I 4NOZA 1LQLA 4HH4A 1Q7Y1 2LFUA 1ZH1A 2VPZA 1YIJ1 1K731 1K8A1 3GTOI 3G71Z 5C44I 2E2HI 2E2JI 3S2HI 2M6NA 1AA6A 2YU9I 2NVQI 3FQQA 1Y8CA 1PFTA 3D6WA 3CCJZ 1JJ2Y 1DL6A 2HU9A 1VQK1 3KIHA 2QEXZ 1VQ4Z 5C4JI 3G6E1 2JS4A 3CCR1 1I3QI 2OTJZ 1X3WA 1QYPA 2P3YA 2JUBA 3KIFA 4BXXI 5A2Qb 2KI7B 1VQL1 1ML8A 2V8IA 2G2KA 3CCM1 1KQSY 3CCQ1 3JAMb 2R93I 3GTMS 2I3CA 1TWAI 3CCVZ 1WCMI 1NUIA 4A3MI 2NVXI 1RO4A 5FLXb 2EGTA 3CCUZ 4E2XA 2O4HA 1TWFI 1X3ZA 1VQM1 2NAPA 4QTUA 4RS4A 4QTTA 3HOVI 3TDHB 1ZB9A 1VQO1 2JIQA 3CC21 3CPWY 2Y0SA 2V3VA 2M48A 1YJNZ 1RNIA 4NBBA 1P9NA 1JWHC 3CCEZ 1YIT1 3EERA 4NFRA 4A3II 3GTGI 1USPB 2B63I 1K9M1 2QLVB 4MXUA 3M3YI 1YJ91 1VQ61 1TWHI 2W04A 4RVDA 3OW2Y 2AYDA 2KPIA 2AKLA 4BY1I 5T67A 1KRLA 1QVGZ 3S2DI 3GTJI 4A3GI 2ZAEB 4TNUA 4Y52I 2F4OA 4XX2A 1YI2Z 2JNYA 3VTNA 2HF1A 3I4NI 1QF8A 1WW9A 2QRDB 3BG0B 2E2II 2JMOA 1USPA 3I56Z 3EEDA 3NH4A 1NP6A 3NFZA 5CM2M 3CCJ1 3IR7A 2DE7A 1Z02A 3CD6Z 2J6AA 2QEX1 1VQ41 3NH8A 2JA5I 2K5RA 3T4NB 1N8R2 1X0TA 3P5JB 5C4XI 5IT9b 4E32A 3CCLZ 1VLAA 2LIYA 2JIOA 4DQYB 2LEXA 5IP9I 4RVHA 1RO2A 3CCV1 2GTIA 1R9TI 1VQ7Z 3CC7Z 1KC81 1QXFA 1TFIA 2V8KA 1I6HI 2YADA 1VQ9Z 3HOZI 4E31A 1YHQZ 1FDIA 1YJWZ 1S7MA 4A3JI 2RIQA 1L1OC 3IFUA 2DE6A 3CXCZ 5D1PA 3PO3I 3MZLB 2E9HA 2IV2X 3S17I 4CL1A 1YIJZ 4A3KI 2JA8I 3GTQI 2QR1B 1YJN1 3VMIA 1QVFZ 2PM9A 4MONA 3CCE1 1NJI2 1N2FA 4NBAA 1Y1VI 3I551 5D1OB 3S1QI 4MD9A 2V45A 2WB1A 4E2ZA 1VQPZ 2JR6A 3TE5B 3NDIA
chains in the Genus database with same CATH topology
2NVTI 3U50C 3G4S1 1TWGI 2GU2A 4NBHA 3H3VJ 1YI21 1QVGY 3D9XA 3MZKB 3HOYI 5D1OA 4BBSI 2NVYI 4A3BI 2VF1A 3F3FC 4E2YA 4NBDA 3CC4Z 4EWCA 3HOUI 3HOWI 1VQ8Z 3CMAZ 3CD61 2VUMI 4RV9A 2WAQA 3GTLI 3G711 3CCSZ 2W03A 3VMHA 3CCL1 2RPRA 3S16I 2RHBA 1Q862 1VQ71 1VQNZ 3S15I 2H85A 3HKZA 1W2BZ 2OTJ1 4A3LI 1YHQ1 1M902 1YJW1 1YJ9Z 3CMEZ 3VB9A 4DGLA 1TWCI 2P28A 2VUGA 3S1NI 2Q51A 2JA6I 3K7AI 1S72Z 3J81f 5A2Qf 3FQMA 3CXCY 1Q812 4NH1C 1Y1WI 2Q4ZA 3JAMf 4MH4A 1VQ5Z 4MRIA 1Q861 2O53A 2QRCB 3CQZI 2K3RA 2OTLZ 4BY7I 2PK7A 4RVGA 3ESWA 4NBEA 3CCU1 1Q822 2QA4Z 1QVFY 2R92I 2GTHA 3QWUA 3F3PC 3H0GI 1M901 5FLXf 4S1TA 1N8R1 1RO0A 3PO3S 4A3FI 3GKQA 3GCFA 3NDJA 2RBLA 1VQP1 3J80f 3BG1B 3GTKI 3MONA 2BJOA 1Q811 4MD7A 3J81b 4HGYA 1JJ2Z 1Y1VS 3HOXI 3PO2I 3S1MI 4MD8A 3GTMI 1Q821 4NB8A 1VQKZ 5T64A 3S14I 2R7ZI 3I4MI 3G6EZ 1M1K2 3CCRZ 3CC41 1SFOI 1KD12 4E2WA 1KQSZ 1Z03A 1K9M2 3GTPI 1VQ81 3CMA1 2QREB 3NH5A 1VQLZ 4X6AI 3J80b 3CCMZ 3CCQZ 2R6MA 1NJI1 3I07A 3CCS1 2PMZA 1ZB8A 4A93I 1K83I 4DK1A 4A3CI 5T6BA 5C3EI 4RVFA 3I561 3FKII 5FLMI 3RZDI 2IZ4A 4A3EI 4BBRI 2OOYB 4AYBA 1M1K1 1VQN1 5IP7I 1VQMZ 3I55Z 1WIIA 1KD11 1YUAA 4E33A 3S1RI 4HGZA 1YUKA 3CPWZ 2OZKA 1Q7Y2 5AN9F 1VQOZ 3CC2Z 3CME1 1W2BY 4NB9A 3IF8A 4NBCA 4E30A 2F4MA 3J7A4 1K732 3Q87A 3M4OI 5IT9f 1K8A2 1S721 3RZOI 3LUSA 1Z01A 3G4SZ 1YITZ 3CC71 1RQFA 2JA7I 2QKDA 2IZ3A 3IX0A 4NBGA 5LL6f 1RLYA 1VQ51 2OOXB 1VQ91 4A3DI 2RT9A 3OW2Z 2DE5A 2OTL1 4NBFA 2V8JA 1VQ6Z 3VMGA 2QA41 1KC82 4Y7NI 1I50I 4NOZA 1LQLA 4HH4A 1Q7Y1 2LFUA 1ZH1A 1YIJ1 1K731 1K8A1 3GTOI 3G71Z 5C44I 2E2HI 2E2JI 3S2HI 2M6NA 2YU9I 2NVQI 3FQQA 1PFTA 3D6WA 3CCJZ 1JJ2Y 1DL6A 2HU9A 1VQK1 3KIHA 2QEXZ 1VQ4Z 5C4JI 3G6E1 2JS4A 3CCR1 1I3QI 2OTJZ 1X3WA 1QYPA 2P3YA 2JUBA 3KIFA 4BXXI 5A2Qb 2KI7B 1VQL1 1ML8A 2V8IA 2G2KA 3CCM1 1KQSY 3CCQ1 3JAMb 2R93I 3GTMS 2I3CA 1TWAI 3CCVZ 1WCMI 1NUIA 4A3MI 2NVXI 1RO4A 5FLXb 2EGTA 3CCUZ 4E2XA 2O4HA 1TWFI 1X3ZA 1VQM1 4QTUA 4RS4A 4QTTA 3HOVI 3TDHB 1ZB9A 1VQO1 3CC21 3CPWY 2Y0SA 2M48A 1YJNZ 1RNIA 4NBBA 1P9NA 1JWHC 3CCEZ 1YIT1 3EERA 4NFRA 4A3II 3GTGI 1USPB 2B63I 1K9M1 2QLVB 4MXUA 3M3YI 1YJ91 1VQ61 1TWHI 2W04A 4RVDA 3OW2Y 2KPIA 2AKLA 4BY1I 5T67A 1KRLA 1QVGZ 3S2DI 3GTJI 4A3GI 2ZAEB 4TNUA 4Y52I 2F4OA 4XX2A 1YI2Z 2JNYA 3VTNA 2HF1A 3I4NI 1QF8A 1WW9A 2QRDB 3BG0B 2E2II 2JMOA 1USPA 3I56Z 3EEDA 3NH4A 1NP6A 3NFZA 5CM2M 3CCJ1 2DE7A 1Z02A 3CD6Z 2J6AA 2QEX1 1VQ41 3NH8A 2JA5I 2K5RA 3T4NB 1N8R2 1X0TA 3P5JB 5C4XI 5IT9b 4E32A 3CCLZ 1VLAA 2LIYA 4DQYB 5IP9I 4RVHA 1RO2A 3CCV1 2GTIA 1R9TI 1VQ7Z 3CC7Z 1KC81 1TFIA 2V8KA 1I6HI 2YADA 1VQ9Z 3HOZI 4E31A 1YHQZ 1YJWZ 1S7MA 4A3JI 2RIQA 1L1OC 3IFUA 2DE6A 3CXCZ 5D1PA 3PO3I 3MZLB 2E9HA 3S17I 4CL1A 1YIJZ 4A3KI 2JA8I 3GTQI 2QR1B 1YJN1 3VMIA 1QVFZ 2PM9A 4MONA 3CCE1 1NJI2 1N2FA 4NBAA 1Y1VI 3I551 5D1OB 3S1QI 4MD9A 2WB1A 4E2ZA 1VQPZ 2JR6A 3TE5B 3NDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 1;  1Q81 1;  3G4S 1;  3G71 Z;  1JJ2 Z;  1YI2 Z;  1YI2 1;  1QVG Y;  3CCJ Z;  3I56 Z;  1Q82 1;  1JJ2 Y;  1VQK Z;  3CCJ 1;  1VQK 1;  2QEX Z;  3CC4 Z;  1VQ4 Z;  3G6E Z;  3CD6 Z;  1M1K 2;  3CCR Z;  2QEX 1;  3CC4 1;  1VQ4 1;  1VQ8 Z;  3G6E 1;  3CMA Z;  3CD6 1;  3CCR 1;  1KD1 2;  1KQS Z;  2OTJ Z;  1K9M 2;  1VQ8 1;  3CMA 1;  1VQL Z;  1N8R 2;  3CCM Z;  1VQL 1;  3G71 1;  3CCS Z;  3CCQ Z;  3CCM 1;  1KQS Y;  1NJI 1;  3CCS 1;  3CCQ 1;  3CCL Z;  3CCV Z;  3CCL 1;  3CCV 1;  3I56 1;  1VQ7 Z;  3CC7 Z;  1KC8 1;  1Q86 2;  1VQ7 1;  1VQN Z;  1VQ9 Z;  1M1K 1;  1VQN 1;  1VQM Z;  3I55 Z;  1YHQ Z;  3CCU Z;  1W2B Z;  1YJW Z;  2OTJ 1;  1KD1 1;  1VQM 1;  1YHQ 1;  1M90 2;  3CPW Z;  1YJW 1;  1YJ9 Z;  1Q7Y 2;  3CME Z;  3CXC Z;  1VQO Z;  3CC2 Z;  3CME 1;  1W2B Y;  1VQO 1;  3CC2 1;  3CPW Y;  1S72 Z;  1K73 2;  1YIJ Z;  1YJN Z;  1K8A 2;  3CXC Y;  1S72 1;  1Q81 2;  1YJN 1;  3G4S Z;  1YIT Z;  3CC7 1;  1QVF Z;  3CCE Z;  1YIT 1;  1VQ5 Z;  1Q86 1;  3CCE 1;  1NJI 2;  1VQ5 1;  1VQ9 1;  2OTL Z;  3OW2 Z;  3I55 1;  1K9M 1;  3CCU 1;  1Q82 2;  2OTL 1;  2QA4 Z;  1QVF Y;  1VQ6 Z;  1M90 1;  2QA4 1;  1N8R 1;  1YJ9 1;  1KC8 2;  1VQ6 1;  1Q7Y 1;  3OW2 Y;  1VQP Z;  1VQP 1;  1YIJ 1;  1K73 1;  1QVG Z; 
#chains in the Genus database with same CATH topology
 2NVT I;  3U50 C;  3G4S 1;  1TWG I;  2GU2 A;  4NBH A;  3H3V J;  1YI2 1;  1QVG Y;  3D9X A;  3MZK B;  2VPW A;  3HOY I;  5D1O A;  4BBS I;  2NVY I;  4A3B I;  2VF1 A;  3F3F C;  4E2Y A;  4NBD A;  3CC4 Z;  4EWC A;  1FDO A;  3HOU I;  3HOW I;  1VQ8 Z;  3CMA Z;  3CD6 1;  2VUM I;  4RV9 A;  2JIM A;  2WAQ A;  3GTL I;  2VPY A;  3G71 1;  3CCS Z;  2W03 A;  3VMH A;  3CCL 1;  2RPR A;  3S16 I;  2RHB A;  1Q86 2;  1VQ7 1;  1VQN Z;  3S15 I;  2H85 A;  3HKZ A;  1W2B Z;  2OTJ 1;  4A3L I;  1YHQ 1;  1M90 2;  1YJW 1;  1YJ9 Z;  3CME Z;  3VB9 A;  4DGL A;  1TWC I;  2JIP A;  2P28 A;  2VUG A;  3S1N I;  2Q51 A;  2JA6 I;  3K7A I;  1S72 Z;  3J81 f;  5A2Q f;  3FQM A;  1WZN A;  3CXC Y;  1Q81 2;  4NH1 C;  1Y1W I;  2Q4Z A;  3JAM f;  4MH4 A;  1VQ5 Z;  4MRI A;  1Q86 1;  2O53 A;  2QRC B;  3CQZ I;  2K3R A;  2OTL Z;  4BY7 I;  2PK7 A;  4RVG A;  3ESW A;  4NBE A;  3CCU 1;  1Q82 2;  2QA4 Z;  1QVF Y;  2R92 I;  2GTH A;  3QWU A;  2VPX A;  3F3P C;  3H0G I;  1M90 1;  5FLX f;  4S1T A;  1N8R 1;  1RO0 A;  3PO3 S;  4A3F I;  3GKQ A;  3GCF A;  3NDJ A;  2RBL A;  1VQP 1;  3J80 f;  3BG1 B;  3GTK I;  1WJ2 A;  3MON A;  2BJO A;  1Q81 1;  4MD7 A;  3J81 b;  4HGY A;  1JJ2 Z;  1Y1V S;  3HOX I;  3PO2 I;  3S1M I;  4MD8 A;  3GTM I;  1Q82 1;  4NB8 A;  1VQK Z;  5T64 A;  3S14 I;  2R7Z I;  3I4M I;  3G6E Z;  1M1K 2;  3CCR Z;  3CC4 1;  1SFO I;  1KD1 2;  4E2W A;  1KQS Z;  1Z03 A;  1K9M 2;  3GTP I;  1VQ8 1;  3CMA 1;  2QRE B;  3NH5 A;  1VQL Z;  4X6A I;  3J80 b;  3CCM Z;  3CCQ Z;  2R6M A;  1NJI 1;  3I07 A;  3CCS 1;  2PMZ A;  1SIW A;  1ZB8 A;  4A93 I;  1K83 I;  4DK1 A;  4A3C I;  5T6B A;  5C3E I;  4RVF A;  3I56 1;  3FKI I;  5FLM I;  3RZD I;  2IZ4 A;  4A3E I;  4BBR I;  2OOY B;  3D2L A;  4AYB A;  1M1K 1;  1VQN 1;  5IP7 I;  1VQM Z;  2E7Z A;  3I55 Z;  1WII A;  1KD1 1;  1YUA A;  4E33 A;  3S1R I;  4HGZ A;  1YUK A;  3CPW Z;  2OZK A;  1Q7Y 2;  5AN9 F;  1VQO Z;  3CC2 Z;  3CME 1;  1W2B Y;  4NB9 A;  3IF8 A;  4NBC A;  1Q16 A;  4E30 A;  2F4M A;  3J7A 4;  1K73 2;  3Q87 A;  3M4O I;  5IT9 f;  1K8A 2;  1S72 1;  3RZO I;  3LUS A;  1Z01 A;  3G4S Z;  1YIT Z;  3CC7 1;  1RQF A;  2JA7 I;  2QKD A;  2IZ3 A;  3IX0 A;  4NBG A;  5LL6 f;  1RLY A;  1VQ5 1;  2OOX B;  1VQ9 1;  4A3D I;  2RT9 A;  3OW2 Z;  2DE5 A;  2JIR A;  2OTL 1;  4NBF A;  2V8J A;  1VQ6 Z;  3VMG A;  2QA4 1;  1KC8 2;  4Y7N I;  1I50 I;  4NOZ A;  1LQL A;  4HH4 A;  1Q7Y 1;  2LFU A;  1ZH1 A;  2VPZ A;  1YIJ 1;  1K73 1;  1K8A 1;  3GTO I;  3G71 Z;  5C44 I;  2E2H I;  2E2J I;  3S2H I;  2M6N A;  1AA6 A;  2YU9 I;  2NVQ I;  3FQQ A;  1Y8C A;  1PFT A;  3D6W A;  3CCJ Z;  1JJ2 Y;  1DL6 A;  2HU9 A;  1VQK 1;  3KIH A;  2QEX Z;  1VQ4 Z;  5C4J I;  3G6E 1;  2JS4 A;  3CCR 1;  1I3Q I;  2OTJ Z;  1X3W A;  1QYP A;  2P3Y A;  2JUB A;  3KIF A;  4BXX I;  5A2Q b;  2KI7 B;  1VQL 1;  1ML8 A;  2V8I A;  2G2K A;  3CCM 1;  1KQS Y;  3CCQ 1;  3JAM b;  2R93 I;  3GTM S;  2I3C A;  1TWA I;  3CCV Z;  1WCM I;  1NUI A;  4A3M I;  2NVX I;  1RO4 A;  5FLX b;  2EGT A;  3CCU Z;  4E2X A;  2O4H A;  1TWF I;  1X3Z A;  1VQM 1;  2NAP A;  4QTU A;  4RS4 A;  4QTT A;  3HOV I;  3TDH B;  1ZB9 A;  1VQO 1;  2JIQ A;  3CC2 1;  3CPW Y;  2Y0S A;  2V3V A;  2M48 A;  1YJN Z;  1RNI A;  4NBB A;  1P9N A;  1JWH C;  3CCE Z;  1YIT 1;  3EER A;  4NFR A;  4A3I I;  3GTG I;  1USP B;  2B63 I;  1K9M 1;  2QLV B;  4MXU A;  3M3Y I;  1YJ9 1;  1VQ6 1;  1TWH I;  2W04 A;  4RVD A;  3OW2 Y;  2AYD A;  2KPI A;  2AKL A;  4BY1 I;  5T67 A;  1KRL A;  1QVG Z;  3S2D I;  3GTJ I;  4A3G I;  2ZAE B;  4TNU A;  4Y52 I;  2F4O A;  4XX2 A;  1YI2 Z;  2JNY A;  3VTN A;  2HF1 A;  3I4N I;  1QF8 A;  1WW9 A;  2QRD B;  3BG0 B;  2E2I I;  2JMO A;  1USP A;  3I56 Z;  3EED A;  3NH4 A;  1NP6 A;  3NFZ A;  5CM2 M;  3CCJ 1;  3IR7 A;  2DE7 A;  1Z02 A;  3CD6 Z;  2J6A A;  2QEX 1;  1VQ4 1;  3NH8 A;  2JA5 I;  2K5R A;  3T4N B;  1N8R 2;  1X0T A;  3P5J B;  5C4X I;  5IT9 b;  4E32 A;  3CCL Z;  1VLA A;  2LIY A;  2JIO A;  4DQY B;  2LEX A;  5IP9 I;  4RVH A;  1RO2 A;  3CCV 1;  2GTI A;  1R9T I;  1VQ7 Z;  3CC7 Z;  1KC8 1;  1QXF A;  1TFI A;  2V8K A;  1I6H I;  2YAD A;  1VQ9 Z;  3HOZ I;  4E31 A;  1YHQ Z;  1FDI A;  1YJW Z;  1S7M A;  4A3J I;  2RIQ A;  1L1O C;  3IFU A;  2DE6 A;  3CXC Z;  5D1P A;  3PO3 I;  3MZL B;  2E9H A;  2IV2 X;  3S17 I;  4CL1 A;  1YIJ Z;  4A3K I;  2JA8 I;  3GTQ I;  2QR1 B;  1YJN 1;  3VMI A;  1QVF Z;  2PM9 A;  4MON A;  3CCE 1;  1NJI 2;  1N2F A;  4NBA A;  1Y1V I;  3I55 1;  5D1O B;  3S1Q I;  4MD9 A;  2V45 A;  2WB1 A;  4E2Z A;  1VQP Z;  2JR6 A;  3TE5 B;  3NDI A; 
#chains in the Genus database with same CATH homology
 2NVT I;  3U50 C;  3G4S 1;  1TWG I;  2GU2 A;  4NBH A;  3H3V J;  1YI2 1;  1QVG Y;  3D9X A;  3MZK B;  3HOY I;  5D1O A;  4BBS I;  2NVY I;  4A3B I;  2VF1 A;  3F3F C;  4E2Y A;  4NBD A;  3CC4 Z;  4EWC A;  3HOU I;  3HOW I;  1VQ8 Z;  3CMA Z;  3CD6 1;  2VUM I;  4RV9 A;  2WAQ A;  3GTL I;  3G71 1;  3CCS Z;  2W03 A;  3VMH A;  3CCL 1;  2RPR A;  3S16 I;  2RHB A;  1Q86 2;  1VQ7 1;  1VQN Z;  3S15 I;  2H85 A;  3HKZ A;  1W2B Z;  2OTJ 1;  4A3L I;  1YHQ 1;  1M90 2;  1YJW 1;  1YJ9 Z;  3CME Z;  3VB9 A;  4DGL A;  1TWC I;  2P28 A;  2VUG A;  3S1N I;  2Q51 A;  2JA6 I;  3K7A I;  1S72 Z;  3J81 f;  5A2Q f;  3FQM A;  3CXC Y;  1Q81 2;  4NH1 C;  1Y1W I;  2Q4Z A;  3JAM f;  4MH4 A;  1VQ5 Z;  4MRI A;  1Q86 1;  2O53 A;  2QRC B;  3CQZ I;  2K3R A;  2OTL Z;  4BY7 I;  2PK7 A;  4RVG A;  3ESW A;  4NBE A;  3CCU 1;  1Q82 2;  2QA4 Z;  1QVF Y;  2R92 I;  2GTH A;  3QWU A;  3F3P C;  3H0G I;  1M90 1;  5FLX f;  4S1T A;  1N8R 1;  1RO0 A;  3PO3 S;  4A3F I;  3GKQ A;  3GCF A;  3NDJ A;  2RBL A;  1VQP 1;  3J80 f;  3BG1 B;  3GTK I;  3MON A;  2BJO A;  1Q81 1;  4MD7 A;  3J81 b;  4HGY A;  1JJ2 Z;  1Y1V S;  3HOX I;  3PO2 I;  3S1M I;  4MD8 A;  3GTM I;  1Q82 1;  4NB8 A;  1VQK Z;  5T64 A;  3S14 I;  2R7Z I;  3I4M I;  3G6E Z;  1M1K 2;  3CCR Z;  3CC4 1;  1SFO I;  1KD1 2;  4E2W A;  1KQS Z;  1Z03 A;  1K9M 2;  3GTP I;  1VQ8 1;  3CMA 1;  2QRE B;  3NH5 A;  1VQL Z;  4X6A I;  3J80 b;  3CCM Z;  3CCQ Z;  2R6M A;  1NJI 1;  3I07 A;  3CCS 1;  2PMZ A;  1ZB8 A;  4A93 I;  1K83 I;  4DK1 A;  4A3C I;  5T6B A;  5C3E I;  4RVF A;  3I56 1;  3FKI I;  5FLM I;  3RZD I;  2IZ4 A;  4A3E I;  4BBR I;  2OOY B;  4AYB A;  1M1K 1;  1VQN 1;  5IP7 I;  1VQM Z;  3I55 Z;  1WII A;  1KD1 1;  1YUA A;  4E33 A;  3S1R I;  4HGZ A;  1YUK A;  3CPW Z;  2OZK A;  1Q7Y 2;  5AN9 F;  1VQO Z;  3CC2 Z;  3CME 1;  1W2B Y;  4NB9 A;  3IF8 A;  4NBC A;  4E30 A;  2F4M A;  3J7A 4;  1K73 2;  3Q87 A;  3M4O I;  5IT9 f;  1K8A 2;  1S72 1;  3RZO I;  3LUS A;  1Z01 A;  3G4S Z;  1YIT Z;  3CC7 1;  1RQF A;  2JA7 I;  2QKD A;  2IZ3 A;  3IX0 A;  4NBG A;  5LL6 f;  1RLY A;  1VQ5 1;  2OOX B;  1VQ9 1;  4A3D I;  2RT9 A;  3OW2 Z;  2DE5 A;  2OTL 1;  4NBF A;  2V8J A;  1VQ6 Z;  3VMG A;  2QA4 1;  1KC8 2;  4Y7N I;  1I50 I;  4NOZ A;  1LQL A;  4HH4 A;  1Q7Y 1;  2LFU A;  1ZH1 A;  1YIJ 1;  1K73 1;  1K8A 1;  3GTO I;  3G71 Z;  5C44 I;  2E2H I;  2E2J I;  3S2H I;  2M6N A;  2YU9 I;  2NVQ I;  3FQQ A;  1PFT A;  3D6W A;  3CCJ Z;  1JJ2 Y;  1DL6 A;  2HU9 A;  1VQK 1;  3KIH A;  2QEX Z;  1VQ4 Z;  5C4J I;  3G6E 1;  2JS4 A;  3CCR 1;  1I3Q I;  2OTJ Z;  1X3W A;  1QYP A;  2P3Y A;  2JUB A;  3KIF A;  4BXX I;  5A2Q b;  2KI7 B;  1VQL 1;  1ML8 A;  2V8I A;  2G2K A;  3CCM 1;  1KQS Y;  3CCQ 1;  3JAM b;  2R93 I;  3GTM S;  2I3C A;  1TWA I;  3CCV Z;  1WCM I;  1NUI A;  4A3M I;  2NVX I;  1RO4 A;  5FLX b;  2EGT A;  3CCU Z;  4E2X A;  2O4H A;  1TWF I;  1X3Z A;  1VQM 1;  4QTU A;  4RS4 A;  4QTT A;  3HOV I;  3TDH B;  1ZB9 A;  1VQO 1;  3CC2 1;  3CPW Y;  2Y0S A;  2M48 A;  1YJN Z;  1RNI A;  4NBB A;  1P9N A;  1JWH C;  3CCE Z;  1YIT 1;  3EER A;  4NFR A;  4A3I I;  3GTG I;  1USP B;  2B63 I;  1K9M 1;  2QLV B;  4MXU A;  3M3Y I;  1YJ9 1;  1VQ6 1;  1TWH I;  2W04 A;  4RVD A;  3OW2 Y;  2KPI A;  2AKL A;  4BY1 I;  5T67 A;  1KRL A;  1QVG Z;  3S2D I;  3GTJ I;  4A3G I;  2ZAE B;  4TNU A;  4Y52 I;  2F4O A;  4XX2 A;  1YI2 Z;  2JNY A;  3VTN A;  2HF1 A;  3I4N I;  1QF8 A;  1WW9 A;  2QRD B;  3BG0 B;  2E2I I;  2JMO A;  1USP A;  3I56 Z;  3EED A;  3NH4 A;  1NP6 A;  3NFZ A;  5CM2 M;  3CCJ 1;  2DE7 A;  1Z02 A;  3CD6 Z;  2J6A A;  2QEX 1;  1VQ4 1;  3NH8 A;  2JA5 I;  2K5R A;  3T4N B;  1N8R 2;  1X0T A;  3P5J B;  5C4X I;  5IT9 b;  4E32 A;  3CCL Z;  1VLA A;  2LIY A;  4DQY B;  5IP9 I;  4RVH A;  1RO2 A;  3CCV 1;  2GTI A;  1R9T I;  1VQ7 Z;  3CC7 Z;  1KC8 1;  1TFI A;  2V8K A;  1I6H I;  2YAD A;  1VQ9 Z;  3HOZ I;  4E31 A;  1YHQ Z;  1YJW Z;  1S7M A;  4A3J I;  2RIQ A;  1L1O C;  3IFU A;  2DE6 A;  3CXC Z;  5D1P A;  3PO3 I;  3MZL B;  2E9H A;  3S17 I;  4CL1 A;  1YIJ Z;  4A3K I;  2JA8 I;  3GTQ I;  2QR1 B;  1YJN 1;  3VMI A;  1QVF Z;  2PM9 A;  4MON A;  3CCE 1;  1NJI 2;  1N2F A;  4NBA A;  1Y1V I;  3I55 1;  5D1O B;  3S1Q I;  4MD9 A;  2WB1 A;  4E2Z A;  1VQP Z;  2JR6 A;  3TE5 B;  3NDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...