3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
3I56Z 3CCQ1 3CCSZ 3I55Z 1QVFZ 3CXCY 3CC41 1YHQZ 3CCJ1 1QVGY 3CPWZ 1KD12 1VQKZ 3CCR1 1K8A2 2OTLZ 3G6EZ 1YIJ1 1VQM1 1VQ7Z 1KQSZ 1VQK1 3CCU1 1VQO1 3CCJZ 1VQ9Z 1NJI2 2QEX1 3CCL1 3CCQZ 3I561 3CCLZ 3CC2Z 1YJWZ 2QEXZ 1VQOZ 1NJI1 3CMAZ 1VQL1 1YITZ 1M1K2 1VQ6Z 3CCM1 1VQ81 1YJN1 3G711 1Q822 1VQ51 1KC82 3CD61 1KC81 3CC4Z 1Q821 1QVFY 3I551 2QA41 1VQPZ 2OTJ1 3G71Z 3CMEZ 2OTL1 1VQ61 1Q811 1W2BY 1VQ41 1YIT1 1S72Z 1KQSY 1YJ9Z 1VQ4Z 3CMA1 1Q7Y2 1Q862 1M1K1 3CCEZ 1M901 3OW2Z 1N8R1 3CC21 1YI2Z 2QA4Z 1VQP1 2OTJZ 3CC71 1K9M1 1K732 1QVGZ 3CPWY 1YIJZ 3CCMZ 1VQ8Z 1K731 3G6E1 1K9M2 3CCRZ 1JJ2Z 1KD11 1Q7Y1 1Q861 1YHQ1 3CC7Z 1K8A1 3CD6Z 1VQ5Z 3CCS1 1JJ2Y 1YJNZ 1YI21 1VQ91 3G4SZ 3CCE1 1N8R2 1VQN1 3CCUZ 1M902 3CCV1 1YJ91 1VQMZ 1VQLZ 1VQ71 1S721 1W2BZ 3CCVZ 3CXCZ 1VQNZ 1Q812 3G4S1 3OW2Y 3CME1 1YJW1
chains in the Genus database with same CATH superfamily
3GTPI 4BBSI 2R93I 3CC41 2KPIA 3CCJ1 3FQMA 3QWUA 2QREB 3EEDA 2QRCB 3CCR1 4NB9A 2DE6A 2E2HI 3F3PC 3G6EZ 3PO3S 3JAMf 2QLVB 4NBFA 1KQSZ 1PFTA 1VQO1 3TDHB 2JMOA 4MD8A 3CCQZ 3VTNA 2R6MA 3CCLZ 3CC2Z 4A3DI 3CMAZ 2G2KA 5A2Qf 3HOXI 1K83I 4NBAA 1WCMI 3PO3I 2O4HA 1YITZ 1M1K2 1X3ZA 3CCM1 4E2XA 4BBRI 1YJN1 1Q822 3T4NB 4A3CI 3HOUI 3GKQA 3GTJI 3K7AI 1QVFY 2PMZA 3NH8A 1RQFA 3G71Z 3EERA 3TE5B 1Q811 4E30A 2IV2X 3GTLI 4MD9A 1S72Z 4MRIA 3HOZI 2JIMA 1M901 1M1K1 2AYDA 4QTTA 3GTMI 2VPXA 2JIRA 2M48A 2QA4Z 1VQP1 2OTJZ 3M4OI 3CC71 1K9M1 4A3MI 1I3QI 3J81f 3GTGI 3FQQA 1YIJZ 5FLMI 4A3EI 2W03A 2JIOA 4DGLA 1K9M2 3IFUA 2HF1A 4E31A 1P9NA 4RVFA 2B63I 1KD11 2PK7A 1YHQ1 3M3YI 4CL1A 1YJNZ 1NP6A 2VPZA 2Q4ZA 2P28A 4NBCA 1VQ91 1Z01A 1N8R2 1VQN1 4NOZA 3CCV1 1YJ91 5C3EI 3CCVZ 3CXCZ 1VQNZ 4NBHA 2VUMI 4NBEA 4A3LI 3I56Z 3CCQ1 1QVFZ 3I55Z 3CXCY 3RZDI 1R9TI 1QVGY 3CPWZ 4A3BI 5C44I 3GTOI 1K8A2 2RT9A 1Z02A 3H0GI 1YIJ1 1VQM1 1L1OC 1SFOI 3CCU1 1NJI2 2QEX1 3VMIA 3I561 5A2Qb 2JIQA 1SIWA 2R92I 2R7ZI 3JAMb 1VQ81 1Y1VI 1RO4A 2RBLA 1QYPA 3IR7A 2JA8I 2QKDA 3NDJA 2OZKA 1ZB9A 3CMEZ 2OTL1 2QR1B 3D9XA 1W2BY 2V45A 1ML8A 4HGZA 2YU9I 5FLXb 1JWHC 1YJ9Z 4AYBA 3CMA1 3CCEZ 3KIFA 3OW2Z 3CC21 4A3KI 3S1MI 1QVGZ 3MONA 1VQ8Z 3MZKB 2JIPA 1TWAI 1I6HI 3J80f 3G6E1 1NUIA 1Y8CA 2EGTA 2WAQA 2YADA 2DE5A 1Y1WI 2JA7I 1Q7Y1 1Q861 2JA6I 3CD6Z 5CM2M 3I4NI 2GTIA 4BY7I 1KRLA 3CCE1 3J81b 3IF8A 3CCUZ 2GU2A 2P3YA 4NBBA 2K3RA 2E9HA 5LL6f 1VQMZ 1VQLZ 1N2FA 5C4XI 1TWFI 3D2LA 3S1NI 1Q812 3LUSA 2V8IA 3CME1 2OTLZ 2O53A 4RVHA 1RO0A 3ESWA 1QXFA 2M6NA 1YHQZ 2JR6A 3S16I 3CQZI 4RS4A 4A3FI 1KD12 1TWGI 1WZNA 2WB1A 1AA6A 2VPYA 4RV9A 1TWCI 3Q87A 2IZ3A 5IT9b 3GTQI 1WW9A 2DE7A 1YUKA 3S2HI 1VQK1 2OOYB 5T67A 3I4MI 3NDIA 3CCJZ 1VQ9Z 3HOYI 4E33A 4E2WA 1YJWZ 1DL6A 2QEXZ 1NJI1 4XX2A 1YJW1 3NH5A 2Y0SA 3GTKI 3HKZA 1VQ6Z 2E2II 3S2DI 3BG0B 1USPA 1Z03A 2V3VA 3G711 1FDIA 1VQ51 2JS4A 1KC82 1ZB8A 1RNIA 1KC81 1Q821 4NBGA 3I551 2QA41 1VQPZ 2OTJ1 4E32A 2F4OA 2W04A 2QRDB 2LEXA 2ZAEB 1YIT1 2RHBA 5AN9F 1KQSY 4HGYA 4BY1I 1Q7Y2 3J80b 1Q862 3HOVI 2NVQI 3D6WA 1WIIA 1K732 3CPWY 5T64A 3CCMZ 4S1TA 4QTUA 1X3WA 2H85A 2GTHA 3CCRZ 3GCFA 2VUGA 1JJ2Z 3HOWI 3GTMS 3CC7Z 3CCS1 2J6AA 1JJ2Y 2V8JA 5D1OB 1YI21 4NB8A 5IP9I 2JA5I 4A3II 3S15I 1S721 2BJOA 3VB9A 1QF8A 3S1QI 3G4S1 4NBDA 1I50I 3KIHA 3CCSZ 2OOXB 1FDOA 1VQKZ 3S17I 4A3JI 5IT9f 3H3VJ 2LIYA 3RZOI 2NVXI 3I07A 4Y7NI 1LQLA 2KI7B 1VQ7Z 2NVTI 2NVYI 4MH4A 2RPRA 4E2YA 3NFZA 3CCL1 1Q16A 2VPWA 2PM9A 3J7A4 1VQOZ 1TWHI 4NFRA 3PO2I 1VQL1 3S1RI 3NH4A 4DK1A 3IX0A 2VF1A 4MONA 3VMGA 1S7MA 1WJ2A 3S14I 2I3CA 3CD61 3CC4Z 2HU9A 1USPB 2V8KA 2RIQA 1Y1VS 2JNYA 1VLAA 1VQ61 4NH1C 5FLXf 1VQ41 4E2ZA 2E7ZA 5D1OA 1RLYA 2LFUA 1VQ4Z 5T6BA 5C4JI 1N8R1 4RVGA 2Q51A 1YI2Z 2NAPA 1RO2A 1X0TA 4MXUA 4A3GI 5D1PA 3P5JB 1K731 2AKLA 4X6AI 3BG1B 3MZLB 1ZH1A 1K8A1 3VMHA 1YUAA 4RVDA 4DQYB 4MD7A 1VQ5Z 2F4MA 2IZ4A 3FKII 4HH4A 3F3FC 3G4SZ 2JUBA 1M902 1VQ71 2E2JI 1TFIA 4Y52I 5IP7I 1W2BZ 4BXXI 2K5RA 4TNUA 3OW2Y 4A93I 4EWCA 3U50C
chains in the Genus database with same CATH topology
3GTPI 4BBSI 2R93I 3CC41 2KPIA 3CCJ1 3FQMA 3QWUA 2QREB 3EEDA 2QRCB 3CCR1 4NB9A 2DE6A 2E2HI 3F3PC 3G6EZ 3PO3S 3JAMf 2QLVB 4NBFA 1KQSZ 1PFTA 1VQO1 3TDHB 2JMOA 4MD8A 3CCQZ 3VTNA 2R6MA 3CCLZ 3CC2Z 4A3DI 3CMAZ 2G2KA 5A2Qf 3HOXI 1K83I 4NBAA 1WCMI 3PO3I 2O4HA 1YITZ 1M1K2 1X3ZA 3CCM1 4E2XA 4BBRI 1YJN1 1Q822 3T4NB 4A3CI 3HOUI 3GKQA 3GTJI 3K7AI 1QVFY 2PMZA 3NH8A 1RQFA 3G71Z 3EERA 3TE5B 1Q811 4E30A 3GTLI 4MD9A 1S72Z 4MRIA 3HOZI 1M901 1M1K1 4QTTA 3GTMI 2M48A 2QA4Z 1VQP1 2OTJZ 3M4OI 3CC71 1K9M1 4A3MI 1I3QI 3J81f 3GTGI 3FQQA 1YIJZ 5FLMI 4A3EI 2W03A 4DGLA 1K9M2 3IFUA 2HF1A 4E31A 1P9NA 4RVFA 2B63I 1KD11 2PK7A 1YHQ1 3M3YI 4CL1A 1YJNZ 1NP6A 2Q4ZA 2P28A 4NBCA 1VQ91 1Z01A 1N8R2 1VQN1 4NOZA 3CCV1 1YJ91 5C3EI 3CCVZ 3CXCZ 1VQNZ 4NBHA 2VUMI 4NBEA 4A3LI 3I56Z 3CCQ1 1QVFZ 3I55Z 3CXCY 3RZDI 1R9TI 1QVGY 3CPWZ 4A3BI 5C44I 3GTOI 1K8A2 2RT9A 1Z02A 3H0GI 1YIJ1 1VQM1 1L1OC 1SFOI 3CCU1 1NJI2 2QEX1 3VMIA 3I561 5A2Qb 2R92I 2R7ZI 3JAMb 1VQ81 1Y1VI 1RO4A 2RBLA 1QYPA 2JA8I 2QKDA 3NDJA 2OZKA 1ZB9A 3CMEZ 2OTL1 2QR1B 3D9XA 1W2BY 1ML8A 4HGZA 2YU9I 5FLXb 1JWHC 1YJ9Z 4AYBA 3CMA1 3CCEZ 3KIFA 3OW2Z 3CC21 4A3KI 3S1MI 1QVGZ 3MONA 1VQ8Z 3MZKB 1TWAI 1I6HI 3J80f 3G6E1 1NUIA 2EGTA 2WAQA 2YADA 2DE5A 1Y1WI 2JA7I 1Q7Y1 1Q861 2JA6I 3CD6Z 5CM2M 3I4NI 2GTIA 4BY7I 1KRLA 3CCE1 3J81b 3IF8A 3CCUZ 2GU2A 2P3YA 4NBBA 2K3RA 2E9HA 5LL6f 1VQMZ 1VQLZ 1N2FA 5C4XI 1TWFI 3S1NI 1Q812 3LUSA 2V8IA 3CME1 2OTLZ 2O53A 4RVHA 1RO0A 3ESWA 2M6NA 1YHQZ 2JR6A 3S16I 3CQZI 4RS4A 4A3FI 1KD12 1TWGI 2WB1A 4RV9A 1TWCI 3Q87A 2IZ3A 5IT9b 3GTQI 1WW9A 2DE7A 1YUKA 3S2HI 1VQK1 2OOYB 5T67A 3I4MI 3NDIA 3CCJZ 1VQ9Z 3HOYI 4E33A 4E2WA 1YJWZ 1DL6A 2QEXZ 1NJI1 4XX2A 1YJW1 3NH5A 2Y0SA 3GTKI 3HKZA 1VQ6Z 2E2II 3S2DI 3BG0B 1USPA 1Z03A 3G711 1VQ51 2JS4A 1KC82 1ZB8A 1RNIA 1KC81 1Q821 4NBGA 3I551 2QA41 1VQPZ 2OTJ1 4E32A 2F4OA 2W04A 2QRDB 2ZAEB 1YIT1 2RHBA 5AN9F 1KQSY 4HGYA 4BY1I 1Q7Y2 3J80b 1Q862 3HOVI 2NVQI 3D6WA 1WIIA 1K732 3CPWY 5T64A 3CCMZ 4S1TA 4QTUA 1X3WA 2H85A 2GTHA 3CCRZ 3GCFA 2VUGA 1JJ2Z 3HOWI 3GTMS 3CC7Z 3CCS1 2J6AA 1JJ2Y 2V8JA 5D1OB 1YI21 4NB8A 5IP9I 2JA5I 4A3II 3S15I 1S721 2BJOA 3VB9A 1QF8A 3S1QI 3G4S1 4NBDA 1I50I 3KIHA 3CCSZ 2OOXB 1VQKZ 3S17I 4A3JI 5IT9f 3H3VJ 2LIYA 3RZOI 2NVXI 3I07A 4Y7NI 1LQLA 2KI7B 1VQ7Z 2NVTI 2NVYI 4MH4A 2RPRA 4E2YA 3NFZA 3CCL1 2PM9A 3J7A4 1VQOZ 1TWHI 4NFRA 3PO2I 1VQL1 3S1RI 3NH4A 4DK1A 3IX0A 2VF1A 4MONA 3VMGA 1S7MA 3S14I 2I3CA 3CD61 3CC4Z 2HU9A 1USPB 2V8KA 2RIQA 1Y1VS 2JNYA 1VLAA 1VQ61 4NH1C 5FLXf 1VQ41 4E2ZA 5D1OA 1RLYA 2LFUA 1VQ4Z 5T6BA 5C4JI 1N8R1 4RVGA 2Q51A 1YI2Z 1RO2A 1X0TA 4MXUA 4A3GI 5D1PA 3P5JB 1K731 2AKLA 4X6AI 3BG1B 3MZLB 1ZH1A 1K8A1 3VMHA 1YUAA 4RVDA 4DQYB 4MD7A 1VQ5Z 2F4MA 2IZ4A 3FKII 4HH4A 3F3FC 3G4SZ 2JUBA 1M902 1VQ71 2E2JI 1TFIA 4Y52I 5IP7I 1W2BZ 4BXXI 2K5RA 4TNUA 3OW2Y 4A93I 4EWCA 3U50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  3CCQ 1;  3CCS Z;  3I55 Z;  1QVF Z;  3CXC Y;  3CC4 1;  1YHQ Z;  3CCJ 1;  1QVG Y;  3CPW Z;  1KD1 2;  1VQK Z;  3CCR 1;  1K8A 2;  2OTL Z;  3G6E Z;  1YIJ 1;  1VQM 1;  1VQ7 Z;  1KQS Z;  1VQK 1;  3CCU 1;  1VQO 1;  3CCJ Z;  1VQ9 Z;  1NJI 2;  2QEX 1;  3CCL 1;  3CCQ Z;  3I56 1;  3CCL Z;  3CC2 Z;  1YJW Z;  2QEX Z;  1VQO Z;  1NJI 1;  3CMA Z;  1VQL 1;  1YIT Z;  1M1K 2;  1VQ6 Z;  3CCM 1;  1VQ8 1;  1YJN 1;  3G71 1;  1Q82 2;  1VQ5 1;  1KC8 2;  3CD6 1;  1KC8 1;  3CC4 Z;  1Q82 1;  1QVF Y;  3I55 1;  2QA4 1;  1VQP Z;  2OTJ 1;  3G71 Z;  3CME Z;  2OTL 1;  1VQ6 1;  1Q81 1;  1W2B Y;  1VQ4 1;  1YIT 1;  1S72 Z;  1KQS Y;  1YJ9 Z;  1VQ4 Z;  3CMA 1;  1Q7Y 2;  1Q86 2;  1M1K 1;  3CCE Z;  1M90 1;  3OW2 Z;  1N8R 1;  3CC2 1;  1YI2 Z;  2QA4 Z;  1VQP 1;  2OTJ Z;  3CC7 1;  1K9M 1;  1K73 2;  1QVG Z;  3CPW Y;  1YIJ Z;  3CCM Z;  1VQ8 Z;  1K73 1;  3G6E 1;  1K9M 2;  3CCR Z;  1JJ2 Z;  1KD1 1;  1Q7Y 1;  1Q86 1;  1YHQ 1;  3CC7 Z;  1K8A 1;  3CD6 Z;  1VQ5 Z;  3CCS 1;  1JJ2 Y;  1YJN Z;  1YI2 1;  1VQ9 1;  3G4S Z;  3CCE 1;  1N8R 2;  1VQN 1;  3CCU Z;  1M90 2;  3CCV 1;  1YJ9 1;  1VQM Z;  1VQL Z;  1VQ7 1;  1S72 1;  1W2B Z;  3CCV Z;  3CXC Z;  1VQN Z;  1Q81 2;  3G4S 1;  3OW2 Y;  3CME 1;  1YJW 1; 
#chains in the Genus database with same CATH topology
 3GTP I;  4BBS I;  2R93 I;  3CC4 1;  2KPI A;  3CCJ 1;  3FQM A;  3QWU A;  2QRE B;  3EED A;  2QRC B;  3CCR 1;  4NB9 A;  2DE6 A;  2E2H I;  3F3P C;  3G6E Z;  3PO3 S;  3JAM f;  2QLV B;  4NBF A;  1KQS Z;  1PFT A;  1VQO 1;  3TDH B;  2JMO A;  4MD8 A;  3CCQ Z;  3VTN A;  2R6M A;  3CCL Z;  3CC2 Z;  4A3D I;  3CMA Z;  2G2K A;  5A2Q f;  3HOX I;  1K83 I;  4NBA A;  1WCM I;  3PO3 I;  2O4H A;  1YIT Z;  1M1K 2;  1X3Z A;  3CCM 1;  4E2X A;  4BBR I;  1YJN 1;  1Q82 2;  3T4N B;  4A3C I;  3HOU I;  3GKQ A;  3GTJ I;  3K7A I;  1QVF Y;  2PMZ A;  3NH8 A;  1RQF A;  3G71 Z;  3EER A;  3TE5 B;  1Q81 1;  4E30 A;  2IV2 X;  3GTL I;  4MD9 A;  1S72 Z;  4MRI A;  3HOZ I;  2JIM A;  1M90 1;  1M1K 1;  2AYD A;  4QTT A;  3GTM I;  2VPX A;  2JIR A;  2M48 A;  2QA4 Z;  1VQP 1;  2OTJ Z;  3M4O I;  3CC7 1;  1K9M 1;  4A3M I;  1I3Q I;  3J81 f;  3GTG I;  3FQQ A;  1YIJ Z;  5FLM I;  4A3E I;  2W03 A;  2JIO A;  4DGL A;  1K9M 2;  3IFU A;  2HF1 A;  4E31 A;  1P9N A;  4RVF A;  2B63 I;  1KD1 1;  2PK7 A;  1YHQ 1;  3M3Y I;  4CL1 A;  1YJN Z;  1NP6 A;  2VPZ A;  2Q4Z A;  2P28 A;  4NBC A;  1VQ9 1;  1Z01 A;  1N8R 2;  1VQN 1;  4NOZ A;  3CCV 1;  1YJ9 1;  5C3E I;  3CCV Z;  3CXC Z;  1VQN Z;  4NBH A;  2VUM I;  4NBE A;  4A3L I;  3I56 Z;  3CCQ 1;  1QVF Z;  3I55 Z;  3CXC Y;  3RZD I;  1R9T I;  1QVG Y;  3CPW Z;  4A3B I;  5C44 I;  3GTO I;  1K8A 2;  2RT9 A;  1Z02 A;  3H0G I;  1YIJ 1;  1VQM 1;  1L1O C;  1SFO I;  3CCU 1;  1NJI 2;  2QEX 1;  3VMI A;  3I56 1;  5A2Q b;  2JIQ A;  1SIW A;  2R92 I;  2R7Z I;  3JAM b;  1VQ8 1;  1Y1V I;  1RO4 A;  2RBL A;  1QYP A;  3IR7 A;  2JA8 I;  2QKD A;  3NDJ A;  2OZK A;  1ZB9 A;  3CME Z;  2OTL 1;  2QR1 B;  3D9X A;  1W2B Y;  2V45 A;  1ML8 A;  4HGZ A;  2YU9 I;  5FLX b;  1JWH C;  1YJ9 Z;  4AYB A;  3CMA 1;  3CCE Z;  3KIF A;  3OW2 Z;  3CC2 1;  4A3K I;  3S1M I;  1QVG Z;  3MON A;  1VQ8 Z;  3MZK B;  2JIP A;  1TWA I;  1I6H I;  3J80 f;  3G6E 1;  1NUI A;  1Y8C A;  2EGT A;  2WAQ A;  2YAD A;  2DE5 A;  1Y1W I;  2JA7 I;  1Q7Y 1;  1Q86 1;  2JA6 I;  3CD6 Z;  5CM2 M;  3I4N I;  2GTI A;  4BY7 I;  1KRL A;  3CCE 1;  3J81 b;  3IF8 A;  3CCU Z;  2GU2 A;  2P3Y A;  4NBB A;  2K3R A;  2E9H A;  5LL6 f;  1VQM Z;  1VQL Z;  1N2F A;  5C4X I;  1TWF I;  3D2L A;  3S1N I;  1Q81 2;  3LUS A;  2V8I A;  3CME 1;  2OTL Z;  2O53 A;  4RVH A;  1RO0 A;  3ESW A;  1QXF A;  2M6N A;  1YHQ Z;  2JR6 A;  3S16 I;  3CQZ I;  4RS4 A;  4A3F I;  1KD1 2;  1TWG I;  1WZN A;  2WB1 A;  1AA6 A;  2VPY A;  4RV9 A;  1TWC I;  3Q87 A;  2IZ3 A;  5IT9 b;  3GTQ I;  1WW9 A;  2DE7 A;  1YUK A;  3S2H I;  1VQK 1;  2OOY B;  5T67 A;  3I4M I;  3NDI A;  3CCJ Z;  1VQ9 Z;  3HOY I;  4E33 A;  4E2W A;  1YJW Z;  1DL6 A;  2QEX Z;  1NJI 1;  4XX2 A;  1YJW 1;  3NH5 A;  2Y0S A;  3GTK I;  3HKZ A;  1VQ6 Z;  2E2I I;  3S2D I;  3BG0 B;  1USP A;  1Z03 A;  2V3V A;  3G71 1;  1FDI A;  1VQ5 1;  2JS4 A;  1KC8 2;  1ZB8 A;  1RNI A;  1KC8 1;  1Q82 1;  4NBG A;  3I55 1;  2QA4 1;  1VQP Z;  2OTJ 1;  4E32 A;  2F4O A;  2W04 A;  2QRD B;  2LEX A;  2ZAE B;  1YIT 1;  2RHB A;  5AN9 F;  1KQS Y;  4HGY A;  4BY1 I;  1Q7Y 2;  3J80 b;  1Q86 2;  3HOV I;  2NVQ I;  3D6W A;  1WII A;  1K73 2;  3CPW Y;  5T64 A;  3CCM Z;  4S1T A;  4QTU A;  1X3W A;  2H85 A;  2GTH A;  3CCR Z;  3GCF A;  2VUG A;  1JJ2 Z;  3HOW I;  3GTM S;  3CC7 Z;  3CCS 1;  2J6A A;  1JJ2 Y;  2V8J A;  5D1O B;  1YI2 1;  4NB8 A;  5IP9 I;  2JA5 I;  4A3I I;  3S15 I;  1S72 1;  2BJO A;  3VB9 A;  1QF8 A;  3S1Q I;  3G4S 1;  4NBD A;  1I50 I;  3KIH A;  3CCS Z;  2OOX B;  1FDO A;  1VQK Z;  3S17 I;  4A3J I;  5IT9 f;  3H3V J;  2LIY A;  3RZO I;  2NVX I;  3I07 A;  4Y7N I;  1LQL A;  2KI7 B;  1VQ7 Z;  2NVT I;  2NVY I;  4MH4 A;  2RPR A;  4E2Y A;  3NFZ A;  3CCL 1;  1Q16 A;  2VPW A;  2PM9 A;  3J7A 4;  1VQO Z;  1TWH I;  4NFR A;  3PO2 I;  1VQL 1;  3S1R I;  3NH4 A;  4DK1 A;  3IX0 A;  2VF1 A;  4MON A;  3VMG A;  1S7M A;  1WJ2 A;  3S14 I;  2I3C A;  3CD6 1;  3CC4 Z;  2HU9 A;  1USP B;  2V8K A;  2RIQ A;  1Y1V S;  2JNY A;  1VLA A;  1VQ6 1;  4NH1 C;  5FLX f;  1VQ4 1;  4E2Z A;  2E7Z A;  5D1O A;  1RLY A;  2LFU A;  1VQ4 Z;  5T6B A;  5C4J I;  1N8R 1;  4RVG A;  2Q51 A;  1YI2 Z;  2NAP A;  1RO2 A;  1X0T A;  4MXU A;  4A3G I;  5D1P A;  3P5J B;  1K73 1;  2AKL A;  4X6A I;  3BG1 B;  3MZL B;  1ZH1 A;  1K8A 1;  3VMH A;  1YUA A;  4RVD A;  4DQY B;  4MD7 A;  1VQ5 Z;  2F4M A;  2IZ4 A;  3FKI I;  4HH4 A;  3F3F C;  3G4S Z;  2JUB A;  1M90 2;  1VQ7 1;  2E2J I;  1TFI A;  4Y52 I;  5IP7 I;  1W2B Z;  4BXX I;  2K5R A;  4TNU A;  3OW2 Y;  4A93 I;  4EWC A;  3U50 C; 
#chains in the Genus database with same CATH homology
 3GTP I;  4BBS I;  2R93 I;  3CC4 1;  2KPI A;  3CCJ 1;  3FQM A;  3QWU A;  2QRE B;  3EED A;  2QRC B;  3CCR 1;  4NB9 A;  2DE6 A;  2E2H I;  3F3P C;  3G6E Z;  3PO3 S;  3JAM f;  2QLV B;  4NBF A;  1KQS Z;  1PFT A;  1VQO 1;  3TDH B;  2JMO A;  4MD8 A;  3CCQ Z;  3VTN A;  2R6M A;  3CCL Z;  3CC2 Z;  4A3D I;  3CMA Z;  2G2K A;  5A2Q f;  3HOX I;  1K83 I;  4NBA A;  1WCM I;  3PO3 I;  2O4H A;  1YIT Z;  1M1K 2;  1X3Z A;  3CCM 1;  4E2X A;  4BBR I;  1YJN 1;  1Q82 2;  3T4N B;  4A3C I;  3HOU I;  3GKQ A;  3GTJ I;  3K7A I;  1QVF Y;  2PMZ A;  3NH8 A;  1RQF A;  3G71 Z;  3EER A;  3TE5 B;  1Q81 1;  4E30 A;  3GTL I;  4MD9 A;  1S72 Z;  4MRI A;  3HOZ I;  1M90 1;  1M1K 1;  4QTT A;  3GTM I;  2M48 A;  2QA4 Z;  1VQP 1;  2OTJ Z;  3M4O I;  3CC7 1;  1K9M 1;  4A3M I;  1I3Q I;  3J81 f;  3GTG I;  3FQQ A;  1YIJ Z;  5FLM I;  4A3E I;  2W03 A;  4DGL A;  1K9M 2;  3IFU A;  2HF1 A;  4E31 A;  1P9N A;  4RVF A;  2B63 I;  1KD1 1;  2PK7 A;  1YHQ 1;  3M3Y I;  4CL1 A;  1YJN Z;  1NP6 A;  2Q4Z A;  2P28 A;  4NBC A;  1VQ9 1;  1Z01 A;  1N8R 2;  1VQN 1;  4NOZ A;  3CCV 1;  1YJ9 1;  5C3E I;  3CCV Z;  3CXC Z;  1VQN Z;  4NBH A;  2VUM I;  4NBE A;  4A3L I;  3I56 Z;  3CCQ 1;  1QVF Z;  3I55 Z;  3CXC Y;  3RZD I;  1R9T I;  1QVG Y;  3CPW Z;  4A3B I;  5C44 I;  3GTO I;  1K8A 2;  2RT9 A;  1Z02 A;  3H0G I;  1YIJ 1;  1VQM 1;  1L1O C;  1SFO I;  3CCU 1;  1NJI 2;  2QEX 1;  3VMI A;  3I56 1;  5A2Q b;  2R92 I;  2R7Z I;  3JAM b;  1VQ8 1;  1Y1V I;  1RO4 A;  2RBL A;  1QYP A;  2JA8 I;  2QKD A;  3NDJ A;  2OZK A;  1ZB9 A;  3CME Z;  2OTL 1;  2QR1 B;  3D9X A;  1W2B Y;  1ML8 A;  4HGZ A;  2YU9 I;  5FLX b;  1JWH C;  1YJ9 Z;  4AYB A;  3CMA 1;  3CCE Z;  3KIF A;  3OW2 Z;  3CC2 1;  4A3K I;  3S1M I;  1QVG Z;  3MON A;  1VQ8 Z;  3MZK B;  1TWA I;  1I6H I;  3J80 f;  3G6E 1;  1NUI A;  2EGT A;  2WAQ A;  2YAD A;  2DE5 A;  1Y1W I;  2JA7 I;  1Q7Y 1;  1Q86 1;  2JA6 I;  3CD6 Z;  5CM2 M;  3I4N I;  2GTI A;  4BY7 I;  1KRL A;  3CCE 1;  3J81 b;  3IF8 A;  3CCU Z;  2GU2 A;  2P3Y A;  4NBB A;  2K3R A;  2E9H A;  5LL6 f;  1VQM Z;  1VQL Z;  1N2F A;  5C4X I;  1TWF I;  3S1N I;  1Q81 2;  3LUS A;  2V8I A;  3CME 1;  2OTL Z;  2O53 A;  4RVH A;  1RO0 A;  3ESW A;  2M6N A;  1YHQ Z;  2JR6 A;  3S16 I;  3CQZ I;  4RS4 A;  4A3F I;  1KD1 2;  1TWG I;  2WB1 A;  4RV9 A;  1TWC I;  3Q87 A;  2IZ3 A;  5IT9 b;  3GTQ I;  1WW9 A;  2DE7 A;  1YUK A;  3S2H I;  1VQK 1;  2OOY B;  5T67 A;  3I4M I;  3NDI A;  3CCJ Z;  1VQ9 Z;  3HOY I;  4E33 A;  4E2W A;  1YJW Z;  1DL6 A;  2QEX Z;  1NJI 1;  4XX2 A;  1YJW 1;  3NH5 A;  2Y0S A;  3GTK I;  3HKZ A;  1VQ6 Z;  2E2I I;  3S2D I;  3BG0 B;  1USP A;  1Z03 A;  3G71 1;  1VQ5 1;  2JS4 A;  1KC8 2;  1ZB8 A;  1RNI A;  1KC8 1;  1Q82 1;  4NBG A;  3I55 1;  2QA4 1;  1VQP Z;  2OTJ 1;  4E32 A;  2F4O A;  2W04 A;  2QRD B;  2ZAE B;  1YIT 1;  2RHB A;  5AN9 F;  1KQS Y;  4HGY A;  4BY1 I;  1Q7Y 2;  3J80 b;  1Q86 2;  3HOV I;  2NVQ I;  3D6W A;  1WII A;  1K73 2;  3CPW Y;  5T64 A;  3CCM Z;  4S1T A;  4QTU A;  1X3W A;  2H85 A;  2GTH A;  3CCR Z;  3GCF A;  2VUG A;  1JJ2 Z;  3HOW I;  3GTM S;  3CC7 Z;  3CCS 1;  2J6A A;  1JJ2 Y;  2V8J A;  5D1O B;  1YI2 1;  4NB8 A;  5IP9 I;  2JA5 I;  4A3I I;  3S15 I;  1S72 1;  2BJO A;  3VB9 A;  1QF8 A;  3S1Q I;  3G4S 1;  4NBD A;  1I50 I;  3KIH A;  3CCS Z;  2OOX B;  1VQK Z;  3S17 I;  4A3J I;  5IT9 f;  3H3V J;  2LIY A;  3RZO I;  2NVX I;  3I07 A;  4Y7N I;  1LQL A;  2KI7 B;  1VQ7 Z;  2NVT I;  2NVY I;  4MH4 A;  2RPR A;  4E2Y A;  3NFZ A;  3CCL 1;  2PM9 A;  3J7A 4;  1VQO Z;  1TWH I;  4NFR A;  3PO2 I;  1VQL 1;  3S1R I;  3NH4 A;  4DK1 A;  3IX0 A;  2VF1 A;  4MON A;  3VMG A;  1S7M A;  3S14 I;  2I3C A;  3CD6 1;  3CC4 Z;  2HU9 A;  1USP B;  2V8K A;  2RIQ A;  1Y1V S;  2JNY A;  1VLA A;  1VQ6 1;  4NH1 C;  5FLX f;  1VQ4 1;  4E2Z A;  5D1O A;  1RLY A;  2LFU A;  1VQ4 Z;  5T6B A;  5C4J I;  1N8R 1;  4RVG A;  2Q51 A;  1YI2 Z;  1RO2 A;  1X0T A;  4MXU A;  4A3G I;  5D1P A;  3P5J B;  1K73 1;  2AKL A;  4X6A I;  3BG1 B;  3MZL B;  1ZH1 A;  1K8A 1;  3VMH A;  1YUA A;  4RVD A;  4DQY B;  4MD7 A;  1VQ5 Z;  2F4M A;  2IZ4 A;  3FKI I;  4HH4 A;  3F3F C;  3G4S Z;  2JUB A;  1M90 2;  1VQ7 1;  2E2J I;  1TFI A;  4Y52 I;  5IP7 I;  1W2B Z;  4BXX I;  2K5R A;  4TNU A;  3OW2 Y;  4A93 I;  4EWC A;  3U50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...