3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
3I56Z 3CC7Z 2OTLZ 1QVGZ 1VQLZ 3CCR1 1QVFY 3CCL1 1QVGY 1YHQZ 1N8R1 3CD6Z 1VQOZ 3CCEZ 3I55Z 3G711 3CXCY 1Q811 3CC2Z 1Q821 1VQ61 1YJ9Z 3CCQZ 1M902 1VQN1 1Q7Y1 1KD11 1YJN1 3G6EZ 1N8R2 3CC41 3CPWZ 1K8A2 1VQPZ 1VQ41 2QA4Z 1VQKZ 1KC82 3CMEZ 3CCV1 1VQ9Z 1K8A1 1VQ51 1W2BY 1M1K2 1YIT1 1K9M2 1VQL1 3CPWY 3CCM1 1Q7Y2 3G4SZ 1KQSZ 1YHQ1 3CD61 3CC71 1VQ7Z 1VQ6Z 3CC21 1YI2Z 3CCLZ 1NJI2 1QVFZ 3G71Z 2OTJZ 1M1K1 1VQP1 1VQ4Z 1YJ91 3CMA1 3CME1 3CCVZ 1KC81 1S721 1YJNZ 1VQ91 2QEX1 3OW2Y 1JJ2Z 1VQ8Z 3CC4Z 1KQSY 1YJW1 3CCSZ 3CCU1 2QA41 3CCJZ 1VQK1 3OW2Z 1JJ2Y 1KD12 1YIJ1 3CXCZ 1VQMZ 1Q812 1VQ71 1K731 2OTL1 3CCRZ 1K9M1 3G4S1 1Q862 3I561 1VQO1 3I551 1YI21 1VQNZ 1Q861 1S72Z 2QEXZ 3G6E1 1NJI1 1YJWZ 1K732 2OTJ1 3CCE1 1W2BZ 1M901 3CCJ1 3CMAZ 1Q822 3CCQ1 1YIJZ 1VQM1 1VQ81 3CCS1 1VQ5Z 3CCUZ 1YITZ 3CCMZ
chains in the Genus database with same CATH superfamily
2DE5A 3I56Z 1TWGI 5FLXb 2B63I 2V45A 3D2LA 2R6MA 3HKZA 2E7ZA 1VQLZ 3CCR1 2NVTI 1QVFY 3CCL1 2JIMA 3IFUA 4A3GI 4NBEA 1Q811 1VQN1 1RQFA 3G6EZ 5IT9b 5D1PA 3NH8A 1TWAI 1K8A2 2EGTA 4EWCA 1VQKZ 2PM9A 4HH4A 3S2DI 3GTPI 2JMOA 1K8A1 4A3BI 4NBGA 5IP9I 1WCMI 4NBFA 1TWCI 2VUGA 3HOYI 4A3KI 1Q7Y2 2GU2A 3U50C 3GCFA 2I3CA 2W03A 3NDIA 3GKQA 4CL1A 3MZKB 4Y7NI 3JAMf 1NJI2 1QVFZ 3J7A4 1VQP1 4E31A 1QXFA 3CMA1 1ZB8A 3JAMb 1RLYA 1KC81 1YJNZ 3VTNA 3NDJA 3OW2Y 1JJ2Z 1VQ8Z 3CCU1 2QA41 5C4XI 4NBCA 1YUKA 3MONA 2M6NA 1VQMZ 3S1MI 1Y8CA 3GTMS 3G4S1 3ESWA 1Q862 3HOXI 1AA6A 2O4HA 4Y52I 2JIOA 2JA8I 1L1OC 4HGZA 2YADA 2HU9A 5CM2M 4NOZA 3PO2I 3HOVI 3CCE1 1I3QI 3LUSA 3HOUI 1Q822 2QLVB 3EEDA 3GTGI 1ZB9A 3VB9A 3CCS1 5C3EI 3S1NI 1USPA 3S14I 1S7MA 3MZLB 3J81b 2DE7A 2JUBA 4A3DI 2P3YA 3GTMI 2ZAEB 3I07A 3M4OI 1VQOZ 5IP7I 2JA6I 1VLAA 3G711 3CXCY 2NVXI 3CC2Z 4RV9A 5AN9F 3S2HI 3CCQZ 2VF1A 1M902 3GTOI 1Q7Y1 3S17I 1RO2A 1RO4A 2GTHA 5LL6f 5A2Qb 4S1TA 3CPWZ 4RVHA 4MXUA 1VQ41 3Q87A 3CMEZ 1VQ9Z 4BY1I 4MD8A 2Q51A 2JS4A 1VQ51 1M1K2 2W04A 2V8JA 1Z03A 4E32A 1Q16A 3CCM1 1KQSZ 3CQZI 1YHQ1 3CD61 2J6AA 2QRCB 3P5JB 1VQ6Z 3FQMA 4E2ZA 3BG0B 3CCLZ 2JIQA 2BJOA 5IT9f 2NVYI 3CCVZ 2RIQA 1S721 2QEX1 2JIRA 1WW9A 1YJW1 2RPRA 1VQK1 1Y1WI 2PMZA 3KIHA 1KD12 1YIJ1 3CXCZ 3GTQI 1VQ71 2K5RA 2E2II 2OTL1 1K9M1 1PFTA 2E2HI 2JIPA 3J80f 1SFOI 3I561 5C44I 4A3LI 3I551 1ML8A 1Q861 4QTTA 4RS4A 1NJI1 2VPXA 1M901 2JNYA 1KRLA 3CMAZ 3CCJ1 4NB8A 3D9XA 3IX0A 3HOWI 3VMHA 3RZOI 4E2YA 1VQ81 4A3II 1R9TI 1RNIA 4NH1C 3CCUZ 1YITZ 1USPB 2LEXA 2NAPA 2E2JI 2YU9I 3CC7Z 4RVFA 4BBSI 2OZKA 4A3MI 1I50I 4NBAA 3S16I 1JWHC 3GTJI 2PK7A 3H0GI 3NFZA 1Q821 1YJ9Z 4RVGA 1X0TA 2F4OA 3GTLI 1KD11 1TWHI 3CC41 2LFUA 5FLMI 1VQPZ 1SIWA 1KC82 2VPYA 1WJ2A 4A3EI 4NBHA 3S1QI 1W2BY 2RBLA 1VQL1 2OOXB 3F3FC 1LQLA 3TE5B 1X3WA 3EERA 2RT9A 2R7ZI 1YI2Z 2NVQI 1ZH1A 3G71Z 5T67A 4MD7A 2OTJZ 1M1K1 5D1OB 2AKLA 5D1OA 2P28A 4XX2A 2KI7B 3NH4A 3OW2Z 1JJ2Y 3IR7A 3NH5A 2R92I 4MONA 1Q812 5A2Qf 1YUAA 2V3VA 3IF8A 3CCRZ 2V8IA 4BXXI 1TWFI 4E2XA 2VUMI 3F3PC 3PO3S 2WB1A 3D6WA 1VQNZ 2JA5I 2M48A 2H85A 3RZDI 2IZ3A 4MRIA 4NB9A 3G6E1 4TNUA 4A3CI 1W2BZ 2Y0SA 4A3FI 3CCQ1 1TFIA 1VQM1 4NFRA 3H3VJ 3K7AI 4E33A 2R93I 1X3ZA 4AYBA 1I6HI 2OTLZ 1QVGZ 1Z01A 1Z02A 1YHQZ 1QVGY 1N8R1 3CD6Z 4E30A 3CCEZ 3I55Z 2O53A 1VQ61 2JR6A 2DE6A 4NBDA 5T6BA 3FQQA 3S15I 3J81f 1YJN1 2V8KA 1N8R2 3J80b 2VPWA 2QRDB 3I4NI 2QA4Z 1Y1VI 4BY7I 2RHBA 3CCV1 4A93I 3QWUA 3GTKI 1WIIA 2KPIA 1YIT1 1K9M2 3CPWY 1NP6A 2IV2X 3I4MI 3G4SZ 3CC71 5T64A 4DK1A 1VQ7Z 1WZNA 2IZ4A 3TDHB 3CC21 1NUIA 4RVDA 2G2KA 3KIFA 2HF1A 2GTIA 3FKII 2Q4ZA 3S1RI 1VQ4Z 1YJ91 3CME1 4HGYA 4X6AI 1FDOA 1VQ91 2K3RA 4BBRI 1RO0A 1QF8A 4E2WA 1FDIA 2OOYB 4QTUA 3CC4Z 4A3JI 1KQSY 3CCSZ 2E9HA 1K83I 3VMGA 3CCJZ 5C4JI 4MD9A 1N2FA 2F4MA 4NBBA 1Y1VS 2VPZA 3PO3I 2LIYA 2AYDA 1K731 1P9NA 3M3YI 5FLXf 2WAQA 3VMIA 3HOZI 4DQYB 3T4NB 4MH4A 1VQO1 2JA7I 1DL6A 3BG1B 1YI21 1S72Z 2QEXZ 2QKDA 1YJWZ 1K732 2OTJ1 1YIJZ 2QR1B 1QYPA 4DGLA 1VQ5Z 2QREB 3CCMZ
chains in the Genus database with same CATH topology
2DE5A 3I56Z 1TWGI 5FLXb 2B63I 2R6MA 3HKZA 1VQLZ 3CCR1 2NVTI 1QVFY 3CCL1 3IFUA 4A3GI 4NBEA 1Q811 1VQN1 1RQFA 3G6EZ 5IT9b 5D1PA 3NH8A 1TWAI 1K8A2 2EGTA 4EWCA 1VQKZ 2PM9A 4HH4A 3S2DI 3GTPI 2JMOA 1K8A1 4A3BI 4NBGA 5IP9I 1WCMI 4NBFA 1TWCI 2VUGA 3HOYI 4A3KI 1Q7Y2 2GU2A 3U50C 3GCFA 2I3CA 2W03A 3NDIA 3GKQA 4CL1A 3MZKB 4Y7NI 3JAMf 1NJI2 1QVFZ 3J7A4 1VQP1 4E31A 3CMA1 1ZB8A 3JAMb 1RLYA 1KC81 1YJNZ 3VTNA 3NDJA 3OW2Y 1JJ2Z 1VQ8Z 3CCU1 2QA41 5C4XI 4NBCA 1YUKA 3MONA 2M6NA 1VQMZ 3S1MI 3GTMS 3G4S1 3ESWA 1Q862 3HOXI 2O4HA 4Y52I 2JA8I 1L1OC 4HGZA 2YADA 2HU9A 5CM2M 4NOZA 3PO2I 3HOVI 3CCE1 1I3QI 3LUSA 3HOUI 1Q822 2QLVB 3EEDA 3GTGI 1ZB9A 3VB9A 3CCS1 5C3EI 3S1NI 1USPA 3S14I 1S7MA 3MZLB 3J81b 2DE7A 2JUBA 4A3DI 2P3YA 3GTMI 2ZAEB 3I07A 3M4OI 1VQOZ 5IP7I 2JA6I 1VLAA 3G711 3CXCY 2NVXI 3CC2Z 4RV9A 5AN9F 3S2HI 3CCQZ 2VF1A 1M902 3GTOI 1Q7Y1 3S17I 1RO2A 1RO4A 2GTHA 5LL6f 5A2Qb 4S1TA 3CPWZ 4RVHA 4MXUA 1VQ41 3Q87A 3CMEZ 1VQ9Z 4BY1I 4MD8A 2Q51A 2JS4A 1VQ51 1M1K2 2W04A 2V8JA 1Z03A 4E32A 3CCM1 1KQSZ 3CQZI 1YHQ1 3CD61 2J6AA 2QRCB 3P5JB 1VQ6Z 3FQMA 4E2ZA 3BG0B 3CCLZ 2BJOA 5IT9f 2NVYI 3CCVZ 1S721 2RIQA 2QEX1 1WW9A 1YJW1 2RPRA 1VQK1 1Y1WI 2PMZA 3KIHA 1KD12 1YIJ1 3CXCZ 3GTQI 1VQ71 2K5RA 2E2II 2OTL1 1K9M1 1PFTA 2E2HI 3J80f 1SFOI 3I561 5C44I 4A3LI 3I551 1ML8A 1Q861 4QTTA 4RS4A 1NJI1 1M901 2JNYA 1KRLA 3CMAZ 3CCJ1 4NB8A 3D9XA 3IX0A 3HOWI 3VMHA 3RZOI 4E2YA 1VQ81 4A3II 1R9TI 1RNIA 4NH1C 3CCUZ 1YITZ 1USPB 2E2JI 2YU9I 3CC7Z 4RVFA 4BBSI 2OZKA 4A3MI 1I50I 4NBAA 3S16I 1JWHC 3GTJI 2PK7A 3H0GI 3NFZA 1Q821 1YJ9Z 4RVGA 1X0TA 2F4OA 3GTLI 1KD11 1TWHI 3CC41 2LFUA 5FLMI 1VQPZ 1KC82 4A3EI 4NBHA 3S1QI 1W2BY 2RBLA 1VQL1 2OOXB 3F3FC 1LQLA 3TE5B 1X3WA 3EERA 2RT9A 2R7ZI 1YI2Z 2NVQI 1ZH1A 3G71Z 5T67A 4MD7A 2OTJZ 1M1K1 5D1OB 2AKLA 5D1OA 2P28A 4XX2A 2KI7B 3NH4A 3OW2Z 1JJ2Y 3NH5A 2R92I 4MONA 1Q812 5A2Qf 1YUAA 3IF8A 3CCRZ 2V8IA 4BXXI 1TWFI 4E2XA 2VUMI 3F3PC 3PO3S 2WB1A 3D6WA 1VQNZ 2JA5I 2M48A 2H85A 3RZDI 2IZ3A 4MRIA 4NB9A 3G6E1 4TNUA 4A3CI 1W2BZ 2Y0SA 4A3FI 3CCQ1 1TFIA 1VQM1 4NFRA 3H3VJ 3K7AI 4E33A 2R93I 1X3ZA 4AYBA 1I6HI 2OTLZ 1QVGZ 1Z01A 1Z02A 1YHQZ 1QVGY 1N8R1 3CD6Z 4E30A 3CCEZ 3I55Z 2O53A 1VQ61 2JR6A 2DE6A 4NBDA 5T6BA 3FQQA 3S15I 3J81f 1YJN1 2V8KA 1N8R2 3J80b 2QRDB 3I4NI 2QA4Z 1Y1VI 4BY7I 2RHBA 3CCV1 4A93I 3QWUA 3GTKI 1WIIA 2KPIA 1YIT1 1K9M2 3CPWY 1NP6A 3I4MI 3G4SZ 3CC71 5T64A 4DK1A 1VQ7Z 2IZ4A 3TDHB 3CC21 1NUIA 4RVDA 2G2KA 3KIFA 2HF1A 2GTIA 3FKII 2Q4ZA 3S1RI 1VQ4Z 1YJ91 3CME1 4HGYA 4X6AI 4BBRI 1VQ91 2K3RA 1RO0A 1QF8A 4E2WA 2OOYB 4QTUA 3CC4Z 4A3JI 1KQSY 3CCSZ 2E9HA 1K83I 3VMGA 3CCJZ 5C4JI 4MD9A 1N2FA 2F4MA 4NBBA 1Y1VS 3PO3I 2LIYA 1K731 1P9NA 3M3YI 5FLXf 2WAQA 3VMIA 3HOZI 4DQYB 3T4NB 4MH4A 1VQO1 2JA7I 1DL6A 3BG1B 1YI21 1S72Z 2QEXZ 2QKDA 1YJWZ 1K732 2OTJ1 1YIJZ 2QR1B 1QYPA 4DGLA 1VQ5Z 2QREB 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  3CC7 Z;  2OTL Z;  1QVG Z;  1VQL Z;  3CCR 1;  1QVF Y;  3CCL 1;  1QVG Y;  1YHQ Z;  1N8R 1;  3CD6 Z;  1VQO Z;  3CCE Z;  3I55 Z;  3G71 1;  3CXC Y;  1Q81 1;  3CC2 Z;  1Q82 1;  1VQ6 1;  1YJ9 Z;  3CCQ Z;  1M90 2;  1VQN 1;  1Q7Y 1;  1KD1 1;  1YJN 1;  3G6E Z;  1N8R 2;  3CC4 1;  3CPW Z;  1K8A 2;  1VQP Z;  1VQ4 1;  2QA4 Z;  1VQK Z;  1KC8 2;  3CME Z;  3CCV 1;  1VQ9 Z;  1K8A 1;  1VQ5 1;  1W2B Y;  1M1K 2;  1YIT 1;  1K9M 2;  1VQL 1;  3CPW Y;  3CCM 1;  1Q7Y 2;  3G4S Z;  1KQS Z;  1YHQ 1;  3CD6 1;  3CC7 1;  1VQ7 Z;  1VQ6 Z;  3CC2 1;  1YI2 Z;  3CCL Z;  1NJI 2;  1QVF Z;  3G71 Z;  2OTJ Z;  1M1K 1;  1VQP 1;  1VQ4 Z;  1YJ9 1;  3CMA 1;  3CME 1;  3CCV Z;  1KC8 1;  1S72 1;  1YJN Z;  1VQ9 1;  2QEX 1;  3OW2 Y;  1JJ2 Z;  1VQ8 Z;  3CC4 Z;  1KQS Y;  1YJW 1;  3CCS Z;  3CCU 1;  2QA4 1;  3CCJ Z;  1VQK 1;  3OW2 Z;  1JJ2 Y;  1KD1 2;  1YIJ 1;  3CXC Z;  1VQM Z;  1Q81 2;  1VQ7 1;  1K73 1;  2OTL 1;  3CCR Z;  1K9M 1;  3G4S 1;  1Q86 2;  3I56 1;  1VQO 1;  3I55 1;  1YI2 1;  1VQN Z;  1Q86 1;  1S72 Z;  2QEX Z;  3G6E 1;  1NJI 1;  1YJW Z;  1K73 2;  2OTJ 1;  3CCE 1;  1W2B Z;  1M90 1;  3CCJ 1;  3CMA Z;  1Q82 2;  3CCQ 1;  1YIJ Z;  1VQM 1;  1VQ8 1;  3CCS 1;  1VQ5 Z;  3CCU Z;  1YIT Z;  3CCM Z; 
#chains in the Genus database with same CATH topology
 2DE5 A;  3I56 Z;  1TWG I;  5FLX b;  2B63 I;  2V45 A;  3D2L A;  2R6M A;  3HKZ A;  2E7Z A;  1VQL Z;  3CCR 1;  2NVT I;  1QVF Y;  3CCL 1;  2JIM A;  3IFU A;  4A3G I;  4NBE A;  1Q81 1;  1VQN 1;  1RQF A;  3G6E Z;  5IT9 b;  5D1P A;  3NH8 A;  1TWA I;  1K8A 2;  2EGT A;  4EWC A;  1VQK Z;  2PM9 A;  4HH4 A;  3S2D I;  3GTP I;  2JMO A;  1K8A 1;  4A3B I;  4NBG A;  5IP9 I;  1WCM I;  4NBF A;  1TWC I;  2VUG A;  3HOY I;  4A3K I;  1Q7Y 2;  2GU2 A;  3U50 C;  3GCF A;  2I3C A;  2W03 A;  3NDI A;  3GKQ A;  4CL1 A;  3MZK B;  4Y7N I;  3JAM f;  1NJI 2;  1QVF Z;  3J7A 4;  1VQP 1;  4E31 A;  1QXF A;  3CMA 1;  1ZB8 A;  3JAM b;  1RLY A;  1KC8 1;  1YJN Z;  3VTN A;  3NDJ A;  3OW2 Y;  1JJ2 Z;  1VQ8 Z;  3CCU 1;  2QA4 1;  5C4X I;  4NBC A;  1YUK A;  3MON A;  2M6N A;  1VQM Z;  3S1M I;  1Y8C A;  3GTM S;  3G4S 1;  3ESW A;  1Q86 2;  3HOX I;  1AA6 A;  2O4H A;  4Y52 I;  2JIO A;  2JA8 I;  1L1O C;  4HGZ A;  2YAD A;  2HU9 A;  5CM2 M;  4NOZ A;  3PO2 I;  3HOV I;  3CCE 1;  1I3Q I;  3LUS A;  3HOU I;  1Q82 2;  2QLV B;  3EED A;  3GTG I;  1ZB9 A;  3VB9 A;  3CCS 1;  5C3E I;  3S1N I;  1USP A;  3S14 I;  1S7M A;  3MZL B;  3J81 b;  2DE7 A;  2JUB A;  4A3D I;  2P3Y A;  3GTM I;  2ZAE B;  3I07 A;  3M4O I;  1VQO Z;  5IP7 I;  2JA6 I;  1VLA A;  3G71 1;  3CXC Y;  2NVX I;  3CC2 Z;  4RV9 A;  5AN9 F;  3S2H I;  3CCQ Z;  2VF1 A;  1M90 2;  3GTO I;  1Q7Y 1;  3S17 I;  1RO2 A;  1RO4 A;  2GTH A;  5LL6 f;  5A2Q b;  4S1T A;  3CPW Z;  4RVH A;  4MXU A;  1VQ4 1;  3Q87 A;  3CME Z;  1VQ9 Z;  4BY1 I;  4MD8 A;  2Q51 A;  2JS4 A;  1VQ5 1;  1M1K 2;  2W04 A;  2V8J A;  1Z03 A;  4E32 A;  1Q16 A;  3CCM 1;  1KQS Z;  3CQZ I;  1YHQ 1;  3CD6 1;  2J6A A;  2QRC B;  3P5J B;  1VQ6 Z;  3FQM A;  4E2Z A;  3BG0 B;  3CCL Z;  2JIQ A;  2BJO A;  5IT9 f;  2NVY I;  3CCV Z;  2RIQ A;  1S72 1;  2QEX 1;  2JIR A;  1WW9 A;  1YJW 1;  2RPR A;  1VQK 1;  1Y1W I;  2PMZ A;  3KIH A;  1KD1 2;  1YIJ 1;  3CXC Z;  3GTQ I;  1VQ7 1;  2K5R A;  2E2I I;  2OTL 1;  1K9M 1;  1PFT A;  2E2H I;  2JIP A;  3J80 f;  1SFO I;  3I56 1;  5C44 I;  4A3L I;  3I55 1;  1ML8 A;  1Q86 1;  4QTT A;  4RS4 A;  1NJI 1;  2VPX A;  1M90 1;  2JNY A;  1KRL A;  3CMA Z;  3CCJ 1;  4NB8 A;  3D9X A;  3IX0 A;  3HOW I;  3VMH A;  3RZO I;  4E2Y A;  1VQ8 1;  4A3I I;  1R9T I;  1RNI A;  4NH1 C;  3CCU Z;  1YIT Z;  1USP B;  2LEX A;  2NAP A;  2E2J I;  2YU9 I;  3CC7 Z;  4RVF A;  4BBS I;  2OZK A;  4A3M I;  1I50 I;  4NBA A;  3S16 I;  1JWH C;  3GTJ I;  2PK7 A;  3H0G I;  3NFZ A;  1Q82 1;  1YJ9 Z;  4RVG A;  1X0T A;  2F4O A;  3GTL I;  1KD1 1;  1TWH I;  3CC4 1;  2LFU A;  5FLM I;  1VQP Z;  1SIW A;  1KC8 2;  2VPY A;  1WJ2 A;  4A3E I;  4NBH A;  3S1Q I;  1W2B Y;  2RBL A;  1VQL 1;  2OOX B;  3F3F C;  1LQL A;  3TE5 B;  1X3W A;  3EER A;  2RT9 A;  2R7Z I;  1YI2 Z;  2NVQ I;  1ZH1 A;  3G71 Z;  5T67 A;  4MD7 A;  2OTJ Z;  1M1K 1;  5D1O B;  2AKL A;  5D1O A;  2P28 A;  4XX2 A;  2KI7 B;  3NH4 A;  3OW2 Z;  1JJ2 Y;  3IR7 A;  3NH5 A;  2R92 I;  4MON A;  1Q81 2;  5A2Q f;  1YUA A;  2V3V A;  3IF8 A;  3CCR Z;  2V8I A;  4BXX I;  1TWF I;  4E2X A;  2VUM I;  3F3P C;  3PO3 S;  2WB1 A;  3D6W A;  1VQN Z;  2JA5 I;  2M48 A;  2H85 A;  3RZD I;  2IZ3 A;  4MRI A;  4NB9 A;  3G6E 1;  4TNU A;  4A3C I;  1W2B Z;  2Y0S A;  4A3F I;  3CCQ 1;  1TFI A;  1VQM 1;  4NFR A;  3H3V J;  3K7A I;  4E33 A;  2R93 I;  1X3Z A;  4AYB A;  1I6H I;  2OTL Z;  1QVG Z;  1Z01 A;  1Z02 A;  1YHQ Z;  1QVG Y;  1N8R 1;  3CD6 Z;  4E30 A;  3CCE Z;  3I55 Z;  2O53 A;  1VQ6 1;  2JR6 A;  2DE6 A;  4NBD A;  5T6B A;  3FQQ A;  3S15 I;  3J81 f;  1YJN 1;  2V8K A;  1N8R 2;  3J80 b;  2VPW A;  2QRD B;  3I4N I;  2QA4 Z;  1Y1V I;  4BY7 I;  2RHB A;  3CCV 1;  4A93 I;  3QWU A;  3GTK I;  1WII A;  2KPI A;  1YIT 1;  1K9M 2;  3CPW Y;  1NP6 A;  2IV2 X;  3I4M I;  3G4S Z;  3CC7 1;  5T64 A;  4DK1 A;  1VQ7 Z;  1WZN A;  2IZ4 A;  3TDH B;  3CC2 1;  1NUI A;  4RVD A;  2G2K A;  3KIF A;  2HF1 A;  2GTI A;  3FKI I;  2Q4Z A;  3S1R I;  1VQ4 Z;  1YJ9 1;  3CME 1;  4HGY A;  4X6A I;  1FDO A;  1VQ9 1;  2K3R A;  4BBR I;  1RO0 A;  1QF8 A;  4E2W A;  1FDI A;  2OOY B;  4QTU A;  3CC4 Z;  4A3J I;  1KQS Y;  3CCS Z;  2E9H A;  1K83 I;  3VMG A;  3CCJ Z;  5C4J I;  4MD9 A;  1N2F A;  2F4M A;  4NBB A;  1Y1V S;  2VPZ A;  3PO3 I;  2LIY A;  2AYD A;  1K73 1;  1P9N A;  3M3Y I;  5FLX f;  2WAQ A;  3VMI A;  3HOZ I;  4DQY B;  3T4N B;  4MH4 A;  1VQO 1;  2JA7 I;  1DL6 A;  3BG1 B;  1YI2 1;  1S72 Z;  2QEX Z;  2QKD A;  1YJW Z;  1K73 2;  2OTJ 1;  1YIJ Z;  2QR1 B;  1QYP A;  4DGL A;  1VQ5 Z;  2QRE B;  3CCM Z; 
#chains in the Genus database with same CATH homology
 2DE5 A;  3I56 Z;  1TWG I;  5FLX b;  2B63 I;  2R6M A;  3HKZ A;  1VQL Z;  3CCR 1;  2NVT I;  1QVF Y;  3CCL 1;  3IFU A;  4A3G I;  4NBE A;  1Q81 1;  1VQN 1;  1RQF A;  3G6E Z;  5IT9 b;  5D1P A;  3NH8 A;  1TWA I;  1K8A 2;  2EGT A;  4EWC A;  1VQK Z;  2PM9 A;  4HH4 A;  3S2D I;  3GTP I;  2JMO A;  1K8A 1;  4A3B I;  4NBG A;  5IP9 I;  1WCM I;  4NBF A;  1TWC I;  2VUG A;  3HOY I;  4A3K I;  1Q7Y 2;  2GU2 A;  3U50 C;  3GCF A;  2I3C A;  2W03 A;  3NDI A;  3GKQ A;  4CL1 A;  3MZK B;  4Y7N I;  3JAM f;  1NJI 2;  1QVF Z;  3J7A 4;  1VQP 1;  4E31 A;  3CMA 1;  1ZB8 A;  3JAM b;  1RLY A;  1KC8 1;  1YJN Z;  3VTN A;  3NDJ A;  3OW2 Y;  1JJ2 Z;  1VQ8 Z;  3CCU 1;  2QA4 1;  5C4X I;  4NBC A;  1YUK A;  3MON A;  2M6N A;  1VQM Z;  3S1M I;  3GTM S;  3G4S 1;  3ESW A;  1Q86 2;  3HOX I;  2O4H A;  4Y52 I;  2JA8 I;  1L1O C;  4HGZ A;  2YAD A;  2HU9 A;  5CM2 M;  4NOZ A;  3PO2 I;  3HOV I;  3CCE 1;  1I3Q I;  3LUS A;  3HOU I;  1Q82 2;  2QLV B;  3EED A;  3GTG I;  1ZB9 A;  3VB9 A;  3CCS 1;  5C3E I;  3S1N I;  1USP A;  3S14 I;  1S7M A;  3MZL B;  3J81 b;  2DE7 A;  2JUB A;  4A3D I;  2P3Y A;  3GTM I;  2ZAE B;  3I07 A;  3M4O I;  1VQO Z;  5IP7 I;  2JA6 I;  1VLA A;  3G71 1;  3CXC Y;  2NVX I;  3CC2 Z;  4RV9 A;  5AN9 F;  3S2H I;  3CCQ Z;  2VF1 A;  1M90 2;  3GTO I;  1Q7Y 1;  3S17 I;  1RO2 A;  1RO4 A;  2GTH A;  5LL6 f;  5A2Q b;  4S1T A;  3CPW Z;  4RVH A;  4MXU A;  1VQ4 1;  3Q87 A;  3CME Z;  1VQ9 Z;  4BY1 I;  4MD8 A;  2Q51 A;  2JS4 A;  1VQ5 1;  1M1K 2;  2W04 A;  2V8J A;  1Z03 A;  4E32 A;  3CCM 1;  1KQS Z;  3CQZ I;  1YHQ 1;  3CD6 1;  2J6A A;  2QRC B;  3P5J B;  1VQ6 Z;  3FQM A;  4E2Z A;  3BG0 B;  3CCL Z;  2BJO A;  5IT9 f;  2NVY I;  3CCV Z;  1S72 1;  2RIQ A;  2QEX 1;  1WW9 A;  1YJW 1;  2RPR A;  1VQK 1;  1Y1W I;  2PMZ A;  3KIH A;  1KD1 2;  1YIJ 1;  3CXC Z;  3GTQ I;  1VQ7 1;  2K5R A;  2E2I I;  2OTL 1;  1K9M 1;  1PFT A;  2E2H I;  3J80 f;  1SFO I;  3I56 1;  5C44 I;  4A3L I;  3I55 1;  1ML8 A;  1Q86 1;  4QTT A;  4RS4 A;  1NJI 1;  1M90 1;  2JNY A;  1KRL A;  3CMA Z;  3CCJ 1;  4NB8 A;  3D9X A;  3IX0 A;  3HOW I;  3VMH A;  3RZO I;  4E2Y A;  1VQ8 1;  4A3I I;  1R9T I;  1RNI A;  4NH1 C;  3CCU Z;  1YIT Z;  1USP B;  2E2J I;  2YU9 I;  3CC7 Z;  4RVF A;  4BBS I;  2OZK A;  4A3M I;  1I50 I;  4NBA A;  3S16 I;  1JWH C;  3GTJ I;  2PK7 A;  3H0G I;  3NFZ A;  1Q82 1;  1YJ9 Z;  4RVG A;  1X0T A;  2F4O A;  3GTL I;  1KD1 1;  1TWH I;  3CC4 1;  2LFU A;  5FLM I;  1VQP Z;  1KC8 2;  4A3E I;  4NBH A;  3S1Q I;  1W2B Y;  2RBL A;  1VQL 1;  2OOX B;  3F3F C;  1LQL A;  3TE5 B;  1X3W A;  3EER A;  2RT9 A;  2R7Z I;  1YI2 Z;  2NVQ I;  1ZH1 A;  3G71 Z;  5T67 A;  4MD7 A;  2OTJ Z;  1M1K 1;  5D1O B;  2AKL A;  5D1O A;  2P28 A;  4XX2 A;  2KI7 B;  3NH4 A;  3OW2 Z;  1JJ2 Y;  3NH5 A;  2R92 I;  4MON A;  1Q81 2;  5A2Q f;  1YUA A;  3IF8 A;  3CCR Z;  2V8I A;  4BXX I;  1TWF I;  4E2X A;  2VUM I;  3F3P C;  3PO3 S;  2WB1 A;  3D6W A;  1VQN Z;  2JA5 I;  2M48 A;  2H85 A;  3RZD I;  2IZ3 A;  4MRI A;  4NB9 A;  3G6E 1;  4TNU A;  4A3C I;  1W2B Z;  2Y0S A;  4A3F I;  3CCQ 1;  1TFI A;  1VQM 1;  4NFR A;  3H3V J;  3K7A I;  4E33 A;  2R93 I;  1X3Z A;  4AYB A;  1I6H I;  2OTL Z;  1QVG Z;  1Z01 A;  1Z02 A;  1YHQ Z;  1QVG Y;  1N8R 1;  3CD6 Z;  4E30 A;  3CCE Z;  3I55 Z;  2O53 A;  1VQ6 1;  2JR6 A;  2DE6 A;  4NBD A;  5T6B A;  3FQQ A;  3S15 I;  3J81 f;  1YJN 1;  2V8K A;  1N8R 2;  3J80 b;  2QRD B;  3I4N I;  2QA4 Z;  1Y1V I;  4BY7 I;  2RHB A;  3CCV 1;  4A93 I;  3QWU A;  3GTK I;  1WII A;  2KPI A;  1YIT 1;  1K9M 2;  3CPW Y;  1NP6 A;  3I4M I;  3G4S Z;  3CC7 1;  5T64 A;  4DK1 A;  1VQ7 Z;  2IZ4 A;  3TDH B;  3CC2 1;  1NUI A;  4RVD A;  2G2K A;  3KIF A;  2HF1 A;  2GTI A;  3FKI I;  2Q4Z A;  3S1R I;  1VQ4 Z;  1YJ9 1;  3CME 1;  4HGY A;  4X6A I;  4BBR I;  1VQ9 1;  2K3R A;  1RO0 A;  1QF8 A;  4E2W A;  2OOY B;  4QTU A;  3CC4 Z;  4A3J I;  1KQS Y;  3CCS Z;  2E9H A;  1K83 I;  3VMG A;  3CCJ Z;  5C4J I;  4MD9 A;  1N2F A;  2F4M A;  4NBB A;  1Y1V S;  3PO3 I;  2LIY A;  1K73 1;  1P9N A;  3M3Y I;  5FLX f;  2WAQ A;  3VMI A;  3HOZ I;  4DQY B;  3T4N B;  4MH4 A;  1VQO 1;  2JA7 I;  1DL6 A;  3BG1 B;  1YI2 1;  1S72 Z;  2QEX Z;  2QKD A;  1YJW Z;  1K73 2;  2OTJ 1;  1YIJ Z;  2QR1 B;  1QYP A;  4DGL A;  1VQ5 Z;  2QRE B;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...