3CMEZ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmeZ00
1VQ6Z 2OTJ1 1QVFZ 1K732 3CC7Z 1VQN1 3G4S1 2OTJZ 3CPWZ 1VQP1 1VQ41 1VQNZ 3G4SZ 1QVGY 3CCR1 1VQ51 1VQPZ 1VQ4Z 3CCS1 1M902 3I551 1JJ2Z 3CCRZ 1VQ5Z 1K731 3CCSZ 3I55Z 3CMA1 1Q7Y1 1Q822 3OW2Z 3G711 1VQO1 1Q862 3CCUZ 3G71Z 1M901 1VQOZ 1VQ81 3CCJ1 1KD12 1W2BY 1YHQ1 1VQ8Z 3CCJZ 1VQ71 3CC41 1Q821 1YHQZ 1Q861 1VQ7Z 3CC4Z 1QVFY 1M1K2 3CXCY 1KD11 1NJI2 1KC82 1N8R2 3CCU1 3CCMZ 1S72Z 1KQSZ 3CCV1 2QEX1 1VQM1 1JJ2Y 3CCE1 1YJW1 1M1K1 1YI21 3CCVZ 3CME1 1K8A2 2QEXZ 1VQMZ 3CCEZ 1YJWZ 1YI2Z 3CMEZ 2QA41 3OW2Y 1N8R1 1VQL1 1YITZ 2QA4Z 1VQLZ 1YIJ1 1K8A1 2OTLZ 3CCM1 1K9M2 1YIJZ 3CPWY 1QVGZ 1S721 1Q812 1YJ91 3CXCZ 3CD61 3CCL1 1YJ9Z 3I561 1Q7Y2 3CD6Z 3CCLZ 3I56Z 1NJI1 1K9M1 1YIT1 1YJN1 1Q811 1KC81 1VQ91 1VQK1 1KQSY 1YJNZ 3G6E1 3CC21 3CCQ1 1VQ9Z 2OTL1 1W2BZ 1VQKZ 3G6EZ 3CC2Z 3CCQZ 1VQ61 3CMAZ 3CC71
chains in the Genus database with same CATH superfamily
5IP7I 4NB9A 3RZDI 4NBCA 2NVTI 4EWCA 3JAMf 3TDHB 2VPWA 1VQ41 3NDJA 1QVGY 3CCR1 4BXXI 2OZKA 5C4XI 1KRLA 1VQ4Z 2DE7A 1M902 3I551 3CCRZ 3I4NI 1ZB9A 4XX2A 3I55Z 2QRCB 3P5JB 3GKQA 2V8IA 5T67A 1VQO1 3I07A 2BJOA 4QTTA 3MONA 2K3RA 3LUSA 2JUBA 5FLXf 1VQOZ 4S1TA 2M6NA 1PFTA 2HU9A 4HH4A 1Q821 1Z02A 3MZLB 1Q861 2LIYA 1QVFY 1M1K2 1WZNA 4E2YA 2QRDB 1KD11 1NJI2 3GTOI 4E33A 5C44I 3CCMZ 1RO0A 3NDIA 1VQM1 2JA7I 2R93I 1YI21 3IX0A 2E2JI 3J7A4 1VQMZ 3S2HI 3T4NB 4CL1A 1YI2Z 3OW2Y 4A3BI 1I3QI 1S7MA 1N2FA 2WAQA 2RIQA 1I6HI 3S1QI 2NVQI 1YIJ1 2DE5A 3GTMS 1K8A1 1YIJZ 1QVGZ 4E31A 3VB9A 2JNYA 3NH5A 1YJ91 3U50C 2IZ4A 4NBAA 1YJ9Z 3I561 3K7AI 3I56Z 4DQYB 2B63I 4NFRA 1VQK1 3GTQI 1WW9A 2AKLA 2KI7B 3EEDA 3FQMA 1VQKZ 2Q51A 4A3EI 4X6AI 3S15I 1Z03A 2VUMI 3BG1B 1AA6A 3J81b 3CC71 2LFUA 1QVFZ 5A2Qf 3CC7Z 5CM2M 1FDOA 1VQP1 3HOUI 2R6MA 3Q87A 1VQPZ 3GTPI 4A3MI 3D6WA 1R9TI 1USPB 1Q7Y1 3OW2Z 3G711 3S1MI 3GTMI 2VPYA 1DL6A 3G71Z 4BBRI 1M901 1VQ81 3PO2I 3CCJ1 3HKZA 1WJ2A 3KIHA 1YHQ1 1VQ8Z 5T6BA 3CCJZ 3EERA 1YHQZ 2GU2A 5D1PA 4NBEA 3BG0B 1Y8CA 2M48A 1ZB8A 3D9XA 1YUKA 4A3FI 2JA8I 4A3DI 2OOYB 4RVHA 2JR6A 4NBBA 5D1OB 4NBHA 1LQLA 2QKDA 3NH4A 3VMGA 1S72Z 3CCV1 1JJ2Y 2NAPA 1YJW1 1M1K1 3CCVZ 3PO3S 3IFUA 1YJWZ 2I3CA 1P9NA 1VQL1 5IT9b 4MD8A 1YITZ 1VQLZ 2V3VA 4NBFA 2O4HA 1USPA 2V8JA 3I4MI 3CCM1 1Q812 3GTJI 1SIWA 1RNIA 2Y0SA 3CD61 2JA6I 2VPZA 3J80b 3NFZA 1RO2A 3NH8A 3CD6Z 3HOZI 4A3II 1TWHI 4E30A 1YJN1 3HOVI 1KC81 1QXFA 1VQ91 1YJNZ 3GTKI 3CC21 2W04A 1VQ9Z 1NUIA 4BBSI 4BY7I 2YADA 5D1OA 3CC2Z 1TWFI 5FLMI 3IF8A 2RT9A 3CMAZ 4E2ZA 2RBLA 4RVDA 1K732 5C4JI 4A3CI 3G4S1 3CPWZ 2JIRA 4A3LI 3G4SZ 4MRIA 4QTUA 3S16I 1WCMI 2HF1A 3PO3I 3CCS1 3MZKB 1JJ2Z 3S2DI 2JIOA 3CCSZ 3GCFA 4Y7NI 4E32A 3JAMb 1RLYA 4RS4A 2R7ZI 1QYPA 3CCUZ 3F3PC 2NVYI 1L1OC 4A3GI 1K83I 1X0TA 1ZH1A 2V8KA 4RVFA 2WB1A 4A93I 3GTLI 3CC41 2F4OA 4NH1C 3CC4Z 1X3ZA 2GTIA 1Y1WI 5FLXb 2KPIA 3RZOI 3HOWI 1N8R2 1I50I 4AYBA 2QEX1 1VLAA 2E9HA 3CME1 2IZ3A 2QEXZ 2NVXI 4A3KI 1JWHC 3CMEZ 1TFIA 2ZAEB 1QF8A 3FQQA 2VUGA 1TWAI 2OTLZ 3S1RI 1K9M2 1RQFA 3CPWY 2R92I 4NOZA 3HOXI 1S721 2J6AA 3TE5B 4Y52I 3H0GI 2P28A 4E2WA 3CXCZ 3ESWA 1X3WA 1WIIA 1Q7Y2 2PM9A 1TWGI 2JIMA 1NJI1 3J81f 1YIT1 1Q811 2RPRA 1KQSY 2OOXB 1Y1VS 4HGYA 3G6E1 1TWCI 3CCQ1 5LL6f 3G6EZ 1Q16A 3CCQZ 5C3EI 1VQ61 3VMHA 1FDIA 4NBDA 1VQ6Z 2OTJ1 4MH4A 3IR7A 3VTNA 3S17I 1VQN1 2H85A 2OTJZ 4MD7A 4TNUA 1VQNZ 1VQ51 3HOYI 3VMIA 2K5RA 1VQ5Z 2PK7A 2F4MA 1K731 5A2Qb 3GTGI 2YU9I 1Z01A 3CMA1 1Q822 4MD9A 3H3VJ 1Q862 5T64A 2AYDA 4NBGA 1KD12 2QREB 1W2BY 4DK1A 4DGLA 1ML8A 2DE6A 1VQ71 2QLVB 4BY1I 2V45A 1VQ7Z 3D2LA 3CXCY 4A3JI 1Y1VI 4NB8A 1RO4A 1KC82 5IT9f 4MONA 2E2II 3CCU1 3F3FC 2IV2X 3S1NI 2P3YA 1KQSZ 2VPXA 3KIFA 4HGZA 3CCE1 1K8A2 2QR1B 2Q4ZA 3CCEZ 2QA41 1N8R1 3S14I 3FKII 2QA4Z 3M4OI 3J80f 2G2KA 2JIPA 2JIQA 2RHBA 2JA5I 3CQZI 2PMZA 1NP6A 2JS4A 2E7ZA 2E2HI 1YUAA 3CCL1 2O53A 4E2XA 4RV9A 2VF1A 5AN9F 3CCLZ 5IP9I 1K9M1 2W03A 2LEXA 2OTL1 4RVGA 1W2BZ 3QWUA 2GTHA 4MXUA 2EGTA 3M3YI 2JMOA 1SFOI
chains in the Genus database with same CATH topology
5IP7I 4NB9A 3RZDI 4NBCA 2NVTI 4EWCA 3JAMf 3TDHB 1VQ41 3NDJA 1QVGY 3CCR1 4BXXI 2OZKA 5C4XI 1KRLA 1VQ4Z 2DE7A 1M902 3I551 3CCRZ 3I4NI 1ZB9A 4XX2A 3I55Z 2QRCB 3P5JB 3GKQA 2V8IA 5T67A 1VQO1 3I07A 2BJOA 4QTTA 3MONA 2K3RA 3LUSA 2JUBA 5FLXf 1VQOZ 4S1TA 2M6NA 1PFTA 2HU9A 4HH4A 1Q821 1Z02A 3MZLB 1Q861 2LIYA 1QVFY 1M1K2 4E2YA 2QRDB 1KD11 1NJI2 3GTOI 4E33A 5C44I 3CCMZ 1RO0A 3NDIA 1VQM1 2JA7I 2R93I 1YI21 3IX0A 2E2JI 3J7A4 1VQMZ 3S2HI 3T4NB 4CL1A 1YI2Z 3OW2Y 4A3BI 1I3QI 1S7MA 1N2FA 2WAQA 2RIQA 1I6HI 3S1QI 2NVQI 1YIJ1 2DE5A 3GTMS 1K8A1 1YIJZ 1QVGZ 4E31A 3VB9A 2JNYA 3NH5A 1YJ91 3U50C 2IZ4A 4NBAA 1YJ9Z 3I561 3K7AI 3I56Z 4DQYB 2B63I 4NFRA 1VQK1 3GTQI 1WW9A 2AKLA 2KI7B 3EEDA 3FQMA 1VQKZ 2Q51A 4A3EI 4X6AI 3S15I 1Z03A 2VUMI 3BG1B 3J81b 3CC71 2LFUA 1QVFZ 5A2Qf 3CC7Z 5CM2M 1VQP1 3HOUI 2R6MA 3Q87A 1VQPZ 3GTPI 4A3MI 3D6WA 1R9TI 1USPB 1Q7Y1 3OW2Z 3G711 3S1MI 3GTMI 1DL6A 3G71Z 4BBRI 1M901 1VQ81 3PO2I 3CCJ1 3HKZA 3KIHA 1YHQ1 1VQ8Z 5T6BA 3CCJZ 3EERA 1YHQZ 2GU2A 5D1PA 4NBEA 3BG0B 2M48A 1ZB8A 3D9XA 1YUKA 4A3FI 2JA8I 4A3DI 2OOYB 4RVHA 2JR6A 4NBBA 5D1OB 4NBHA 1LQLA 2QKDA 3NH4A 3VMGA 1S72Z 3CCV1 1JJ2Y 1YJW1 1M1K1 3CCVZ 3PO3S 3IFUA 1YJWZ 2I3CA 1P9NA 1VQL1 5IT9b 4MD8A 1YITZ 1VQLZ 4NBFA 2O4HA 1USPA 2V8JA 3I4MI 3CCM1 1Q812 3GTJI 1RNIA 2Y0SA 3CD61 2JA6I 3J80b 3NFZA 1RO2A 3NH8A 3CD6Z 3HOZI 4A3II 1TWHI 4E30A 1YJN1 3HOVI 1KC81 1VQ91 1YJNZ 3GTKI 3CC21 2W04A 1VQ9Z 1NUIA 4BBSI 4BY7I 2YADA 5D1OA 3CC2Z 1TWFI 5FLMI 3IF8A 2RT9A 3CMAZ 4E2ZA 2RBLA 4RVDA 1K732 5C4JI 4A3CI 3G4S1 3CPWZ 4A3LI 3G4SZ 4MRIA 4QTUA 3S16I 1WCMI 2HF1A 3PO3I 3CCS1 3MZKB 1JJ2Z 3S2DI 3CCSZ 3GCFA 4Y7NI 4E32A 3JAMb 1RLYA 4RS4A 2R7ZI 1QYPA 3CCUZ 3F3PC 2NVYI 1L1OC 4A3GI 1K83I 1X0TA 1ZH1A 2V8KA 4RVFA 2WB1A 4A93I 3GTLI 3CC41 2F4OA 4NH1C 3CC4Z 1X3ZA 2GTIA 1Y1WI 5FLXb 2KPIA 3RZOI 3HOWI 1N8R2 1I50I 4AYBA 2QEX1 1VLAA 2E9HA 3CME1 2IZ3A 2QEXZ 2NVXI 4A3KI 1JWHC 3CMEZ 1TFIA 2ZAEB 1QF8A 3FQQA 2VUGA 1TWAI 2OTLZ 3S1RI 1K9M2 1RQFA 3CPWY 2R92I 4NOZA 3HOXI 1S721 2J6AA 3TE5B 4Y52I 3H0GI 2P28A 4E2WA 3CXCZ 3ESWA 1X3WA 1WIIA 1Q7Y2 2PM9A 1TWGI 1NJI1 3J81f 1YIT1 1Q811 2RPRA 1KQSY 2OOXB 1Y1VS 4HGYA 3G6E1 1TWCI 3CCQ1 5LL6f 3G6EZ 3CCQZ 5C3EI 1VQ61 3VMHA 4NBDA 1VQ6Z 2OTJ1 4MH4A 3VTNA 3S17I 1VQN1 2H85A 2OTJZ 4MD7A 4TNUA 1VQNZ 1VQ51 3HOYI 3VMIA 2K5RA 1VQ5Z 2PK7A 2F4MA 1K731 5A2Qb 3GTGI 2YU9I 1Z01A 3CMA1 1Q822 4MD9A 3H3VJ 1Q862 5T64A 4NBGA 1KD12 2QREB 1W2BY 4DK1A 4DGLA 1ML8A 2DE6A 1VQ71 2QLVB 4BY1I 1VQ7Z 3CXCY 4A3JI 1Y1VI 4NB8A 1RO4A 1KC82 5IT9f 4MONA 2E2II 3CCU1 3F3FC 3S1NI 2P3YA 1KQSZ 3KIFA 4HGZA 3CCE1 1K8A2 2QR1B 2Q4ZA 3CCEZ 2QA41 1N8R1 3S14I 3FKII 2QA4Z 3M4OI 3J80f 2G2KA 2RHBA 2JA5I 3CQZI 2PMZA 1NP6A 2JS4A 2E2HI 1YUAA 3CCL1 2O53A 4E2XA 4RV9A 2VF1A 5AN9F 3CCLZ 5IP9I 1K9M1 2W03A 2OTL1 4RVGA 1W2BZ 3QWUA 2GTHA 4MXUA 2EGTA 3M3YI 2JMOA 1SFOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Z;  2OTJ 1;  1QVF Z;  1K73 2;  3CC7 Z;  1VQN 1;  3G4S 1;  2OTJ Z;  3CPW Z;  1VQP 1;  1VQ4 1;  1VQN Z;  3G4S Z;  1QVG Y;  3CCR 1;  1VQ5 1;  1VQP Z;  1VQ4 Z;  3CCS 1;  1M90 2;  3I55 1;  1JJ2 Z;  3CCR Z;  1VQ5 Z;  1K73 1;  3CCS Z;  3I55 Z;  3CMA 1;  1Q7Y 1;  1Q82 2;  3OW2 Z;  3G71 1;  1VQO 1;  1Q86 2;  3CCU Z;  3G71 Z;  1M90 1;  1VQO Z;  1VQ8 1;  3CCJ 1;  1KD1 2;  1W2B Y;  1YHQ 1;  1VQ8 Z;  3CCJ Z;  1VQ7 1;  3CC4 1;  1Q82 1;  1YHQ Z;  1Q86 1;  1VQ7 Z;  3CC4 Z;  1QVF Y;  1M1K 2;  3CXC Y;  1KD1 1;  1NJI 2;  1KC8 2;  1N8R 2;  3CCU 1;  3CCM Z;  1S72 Z;  1KQS Z;  3CCV 1;  2QEX 1;  1VQM 1;  1JJ2 Y;  3CCE 1;  1YJW 1;  1M1K 1;  1YI2 1;  3CCV Z;  3CME 1;  1K8A 2;  2QEX Z;  1VQM Z;  3CCE Z;  1YJW Z;  1YI2 Z;  3CME Z;  2QA4 1;  3OW2 Y;  1N8R 1;  1VQL 1;  1YIT Z;  2QA4 Z;  1VQL Z;  1YIJ 1;  1K8A 1;  2OTL Z;  3CCM 1;  1K9M 2;  1YIJ Z;  3CPW Y;  1QVG Z;  1S72 1;  1Q81 2;  1YJ9 1;  3CXC Z;  3CD6 1;  3CCL 1;  1YJ9 Z;  3I56 1;  1Q7Y 2;  3CD6 Z;  3CCL Z;  3I56 Z;  1NJI 1;  1K9M 1;  1YIT 1;  1YJN 1;  1Q81 1;  1KC8 1;  1VQ9 1;  1VQK 1;  1KQS Y;  1YJN Z;  3G6E 1;  3CC2 1;  3CCQ 1;  1VQ9 Z;  2OTL 1;  1W2B Z;  1VQK Z;  3G6E Z;  3CC2 Z;  3CCQ Z;  1VQ6 1;  3CMA Z;  3CC7 1; 
#chains in the Genus database with same CATH topology
 5IP7 I;  4NB9 A;  3RZD I;  4NBC A;  2NVT I;  4EWC A;  3JAM f;  3TDH B;  2VPW A;  1VQ4 1;  3NDJ A;  1QVG Y;  3CCR 1;  4BXX I;  2OZK A;  5C4X I;  1KRL A;  1VQ4 Z;  2DE7 A;  1M90 2;  3I55 1;  3CCR Z;  3I4N I;  1ZB9 A;  4XX2 A;  3I55 Z;  2QRC B;  3P5J B;  3GKQ A;  2V8I A;  5T67 A;  1VQO 1;  3I07 A;  2BJO A;  4QTT A;  3MON A;  2K3R A;  3LUS A;  2JUB A;  5FLX f;  1VQO Z;  4S1T A;  2M6N A;  1PFT A;  2HU9 A;  4HH4 A;  1Q82 1;  1Z02 A;  3MZL B;  1Q86 1;  2LIY A;  1QVF Y;  1M1K 2;  1WZN A;  4E2Y A;  2QRD B;  1KD1 1;  1NJI 2;  3GTO I;  4E33 A;  5C44 I;  3CCM Z;  1RO0 A;  3NDI A;  1VQM 1;  2JA7 I;  2R93 I;  1YI2 1;  3IX0 A;  2E2J I;  3J7A 4;  1VQM Z;  3S2H I;  3T4N B;  4CL1 A;  1YI2 Z;  3OW2 Y;  4A3B I;  1I3Q I;  1S7M A;  1N2F A;  2WAQ A;  2RIQ A;  1I6H I;  3S1Q I;  2NVQ I;  1YIJ 1;  2DE5 A;  3GTM S;  1K8A 1;  1YIJ Z;  1QVG Z;  4E31 A;  3VB9 A;  2JNY A;  3NH5 A;  1YJ9 1;  3U50 C;  2IZ4 A;  4NBA A;  1YJ9 Z;  3I56 1;  3K7A I;  3I56 Z;  4DQY B;  2B63 I;  4NFR A;  1VQK 1;  3GTQ I;  1WW9 A;  2AKL A;  2KI7 B;  3EED A;  3FQM A;  1VQK Z;  2Q51 A;  4A3E I;  4X6A I;  3S15 I;  1Z03 A;  2VUM I;  3BG1 B;  1AA6 A;  3J81 b;  3CC7 1;  2LFU A;  1QVF Z;  5A2Q f;  3CC7 Z;  5CM2 M;  1FDO A;  1VQP 1;  3HOU I;  2R6M A;  3Q87 A;  1VQP Z;  3GTP I;  4A3M I;  3D6W A;  1R9T I;  1USP B;  1Q7Y 1;  3OW2 Z;  3G71 1;  3S1M I;  3GTM I;  2VPY A;  1DL6 A;  3G71 Z;  4BBR I;  1M90 1;  1VQ8 1;  3PO2 I;  3CCJ 1;  3HKZ A;  1WJ2 A;  3KIH A;  1YHQ 1;  1VQ8 Z;  5T6B A;  3CCJ Z;  3EER A;  1YHQ Z;  2GU2 A;  5D1P A;  4NBE A;  3BG0 B;  1Y8C A;  2M48 A;  1ZB8 A;  3D9X A;  1YUK A;  4A3F I;  2JA8 I;  4A3D I;  2OOY B;  4RVH A;  2JR6 A;  4NBB A;  5D1O B;  4NBH A;  1LQL A;  2QKD A;  3NH4 A;  3VMG A;  1S72 Z;  3CCV 1;  1JJ2 Y;  2NAP A;  1YJW 1;  1M1K 1;  3CCV Z;  3PO3 S;  3IFU A;  1YJW Z;  2I3C A;  1P9N A;  1VQL 1;  5IT9 b;  4MD8 A;  1YIT Z;  1VQL Z;  2V3V A;  4NBF A;  2O4H A;  1USP A;  2V8J A;  3I4M I;  3CCM 1;  1Q81 2;  3GTJ I;  1SIW A;  1RNI A;  2Y0S A;  3CD6 1;  2JA6 I;  2VPZ A;  3J80 b;  3NFZ A;  1RO2 A;  3NH8 A;  3CD6 Z;  3HOZ I;  4A3I I;  1TWH I;  4E30 A;  1YJN 1;  3HOV I;  1KC8 1;  1QXF A;  1VQ9 1;  1YJN Z;  3GTK I;  3CC2 1;  2W04 A;  1VQ9 Z;  1NUI A;  4BBS I;  4BY7 I;  2YAD A;  5D1O A;  3CC2 Z;  1TWF I;  5FLM I;  3IF8 A;  2RT9 A;  3CMA Z;  4E2Z A;  2RBL A;  4RVD A;  1K73 2;  5C4J I;  4A3C I;  3G4S 1;  3CPW Z;  2JIR A;  4A3L I;  3G4S Z;  4MRI A;  4QTU A;  3S16 I;  1WCM I;  2HF1 A;  3PO3 I;  3CCS 1;  3MZK B;  1JJ2 Z;  3S2D I;  2JIO A;  3CCS Z;  3GCF A;  4Y7N I;  4E32 A;  3JAM b;  1RLY A;  4RS4 A;  2R7Z I;  1QYP A;  3CCU Z;  3F3P C;  2NVY I;  1L1O C;  4A3G I;  1K83 I;  1X0T A;  1ZH1 A;  2V8K A;  4RVF A;  2WB1 A;  4A93 I;  3GTL I;  3CC4 1;  2F4O A;  4NH1 C;  3CC4 Z;  1X3Z A;  2GTI A;  1Y1W I;  5FLX b;  2KPI A;  3RZO I;  3HOW I;  1N8R 2;  1I50 I;  4AYB A;  2QEX 1;  1VLA A;  2E9H A;  3CME 1;  2IZ3 A;  2QEX Z;  2NVX I;  4A3K I;  1JWH C;  3CME Z;  1TFI A;  2ZAE B;  1QF8 A;  3FQQ A;  2VUG A;  1TWA I;  2OTL Z;  3S1R I;  1K9M 2;  1RQF A;  3CPW Y;  2R92 I;  4NOZ A;  3HOX I;  1S72 1;  2J6A A;  3TE5 B;  4Y52 I;  3H0G I;  2P28 A;  4E2W A;  3CXC Z;  3ESW A;  1X3W A;  1WII A;  1Q7Y 2;  2PM9 A;  1TWG I;  2JIM A;  1NJI 1;  3J81 f;  1YIT 1;  1Q81 1;  2RPR A;  1KQS Y;  2OOX B;  1Y1V S;  4HGY A;  3G6E 1;  1TWC I;  3CCQ 1;  5LL6 f;  3G6E Z;  1Q16 A;  3CCQ Z;  5C3E I;  1VQ6 1;  3VMH A;  1FDI A;  4NBD A;  1VQ6 Z;  2OTJ 1;  4MH4 A;  3IR7 A;  3VTN A;  3S17 I;  1VQN 1;  2H85 A;  2OTJ Z;  4MD7 A;  4TNU A;  1VQN Z;  1VQ5 1;  3HOY I;  3VMI A;  2K5R A;  1VQ5 Z;  2PK7 A;  2F4M A;  1K73 1;  5A2Q b;  3GTG I;  2YU9 I;  1Z01 A;  3CMA 1;  1Q82 2;  4MD9 A;  3H3V J;  1Q86 2;  5T64 A;  2AYD A;  4NBG A;  1KD1 2;  2QRE B;  1W2B Y;  4DK1 A;  4DGL A;  1ML8 A;  2DE6 A;  1VQ7 1;  2QLV B;  4BY1 I;  2V45 A;  1VQ7 Z;  3D2L A;  3CXC Y;  4A3J I;  1Y1V I;  4NB8 A;  1RO4 A;  1KC8 2;  5IT9 f;  4MON A;  2E2I I;  3CCU 1;  3F3F C;  2IV2 X;  3S1N I;  2P3Y A;  1KQS Z;  2VPX A;  3KIF A;  4HGZ A;  3CCE 1;  1K8A 2;  2QR1 B;  2Q4Z A;  3CCE Z;  2QA4 1;  1N8R 1;  3S14 I;  3FKI I;  2QA4 Z;  3M4O I;  3J80 f;  2G2K A;  2JIP A;  2JIQ A;  2RHB A;  2JA5 I;  3CQZ I;  2PMZ A;  1NP6 A;  2JS4 A;  2E7Z A;  2E2H I;  1YUA A;  3CCL 1;  2O53 A;  4E2X A;  4RV9 A;  2VF1 A;  5AN9 F;  3CCL Z;  5IP9 I;  1K9M 1;  2W03 A;  2LEX A;  2OTL 1;  4RVG A;  1W2B Z;  3QWU A;  2GTH A;  4MXU A;  2EGT A;  3M3Y I;  2JMO A;  1SFO I; 
#chains in the Genus database with same CATH homology
 5IP7 I;  4NB9 A;  3RZD I;  4NBC A;  2NVT I;  4EWC A;  3JAM f;  3TDH B;  1VQ4 1;  3NDJ A;  1QVG Y;  3CCR 1;  4BXX I;  2OZK A;  5C4X I;  1KRL A;  1VQ4 Z;  2DE7 A;  1M90 2;  3I55 1;  3CCR Z;  3I4N I;  1ZB9 A;  4XX2 A;  3I55 Z;  2QRC B;  3P5J B;  3GKQ A;  2V8I A;  5T67 A;  1VQO 1;  3I07 A;  2BJO A;  4QTT A;  3MON A;  2K3R A;  3LUS A;  2JUB A;  5FLX f;  1VQO Z;  4S1T A;  2M6N A;  1PFT A;  2HU9 A;  4HH4 A;  1Q82 1;  1Z02 A;  3MZL B;  1Q86 1;  2LIY A;  1QVF Y;  1M1K 2;  4E2Y A;  2QRD B;  1KD1 1;  1NJI 2;  3GTO I;  4E33 A;  5C44 I;  3CCM Z;  1RO0 A;  3NDI A;  1VQM 1;  2JA7 I;  2R93 I;  1YI2 1;  3IX0 A;  2E2J I;  3J7A 4;  1VQM Z;  3S2H I;  3T4N B;  4CL1 A;  1YI2 Z;  3OW2 Y;  4A3B I;  1I3Q I;  1S7M A;  1N2F A;  2WAQ A;  2RIQ A;  1I6H I;  3S1Q I;  2NVQ I;  1YIJ 1;  2DE5 A;  3GTM S;  1K8A 1;  1YIJ Z;  1QVG Z;  4E31 A;  3VB9 A;  2JNY A;  3NH5 A;  1YJ9 1;  3U50 C;  2IZ4 A;  4NBA A;  1YJ9 Z;  3I56 1;  3K7A I;  3I56 Z;  4DQY B;  2B63 I;  4NFR A;  1VQK 1;  3GTQ I;  1WW9 A;  2AKL A;  2KI7 B;  3EED A;  3FQM A;  1VQK Z;  2Q51 A;  4A3E I;  4X6A I;  3S15 I;  1Z03 A;  2VUM I;  3BG1 B;  3J81 b;  3CC7 1;  2LFU A;  1QVF Z;  5A2Q f;  3CC7 Z;  5CM2 M;  1VQP 1;  3HOU I;  2R6M A;  3Q87 A;  1VQP Z;  3GTP I;  4A3M I;  3D6W A;  1R9T I;  1USP B;  1Q7Y 1;  3OW2 Z;  3G71 1;  3S1M I;  3GTM I;  1DL6 A;  3G71 Z;  4BBR I;  1M90 1;  1VQ8 1;  3PO2 I;  3CCJ 1;  3HKZ A;  3KIH A;  1YHQ 1;  1VQ8 Z;  5T6B A;  3CCJ Z;  3EER A;  1YHQ Z;  2GU2 A;  5D1P A;  4NBE A;  3BG0 B;  2M48 A;  1ZB8 A;  3D9X A;  1YUK A;  4A3F I;  2JA8 I;  4A3D I;  2OOY B;  4RVH A;  2JR6 A;  4NBB A;  5D1O B;  4NBH A;  1LQL A;  2QKD A;  3NH4 A;  3VMG A;  1S72 Z;  3CCV 1;  1JJ2 Y;  1YJW 1;  1M1K 1;  3CCV Z;  3PO3 S;  3IFU A;  1YJW Z;  2I3C A;  1P9N A;  1VQL 1;  5IT9 b;  4MD8 A;  1YIT Z;  1VQL Z;  4NBF A;  2O4H A;  1USP A;  2V8J A;  3I4M I;  3CCM 1;  1Q81 2;  3GTJ I;  1RNI A;  2Y0S A;  3CD6 1;  2JA6 I;  3J80 b;  3NFZ A;  1RO2 A;  3NH8 A;  3CD6 Z;  3HOZ I;  4A3I I;  1TWH I;  4E30 A;  1YJN 1;  3HOV I;  1KC8 1;  1VQ9 1;  1YJN Z;  3GTK I;  3CC2 1;  2W04 A;  1VQ9 Z;  1NUI A;  4BBS I;  4BY7 I;  2YAD A;  5D1O A;  3CC2 Z;  1TWF I;  5FLM I;  3IF8 A;  2RT9 A;  3CMA Z;  4E2Z A;  2RBL A;  4RVD A;  1K73 2;  5C4J I;  4A3C I;  3G4S 1;  3CPW Z;  4A3L I;  3G4S Z;  4MRI A;  4QTU A;  3S16 I;  1WCM I;  2HF1 A;  3PO3 I;  3CCS 1;  3MZK B;  1JJ2 Z;  3S2D I;  3CCS Z;  3GCF A;  4Y7N I;  4E32 A;  3JAM b;  1RLY A;  4RS4 A;  2R7Z I;  1QYP A;  3CCU Z;  3F3P C;  2NVY I;  1L1O C;  4A3G I;  1K83 I;  1X0T A;  1ZH1 A;  2V8K A;  4RVF A;  2WB1 A;  4A93 I;  3GTL I;  3CC4 1;  2F4O A;  4NH1 C;  3CC4 Z;  1X3Z A;  2GTI A;  1Y1W I;  5FLX b;  2KPI A;  3RZO I;  3HOW I;  1N8R 2;  1I50 I;  4AYB A;  2QEX 1;  1VLA A;  2E9H A;  3CME 1;  2IZ3 A;  2QEX Z;  2NVX I;  4A3K I;  1JWH C;  3CME Z;  1TFI A;  2ZAE B;  1QF8 A;  3FQQ A;  2VUG A;  1TWA I;  2OTL Z;  3S1R I;  1K9M 2;  1RQF A;  3CPW Y;  2R92 I;  4NOZ A;  3HOX I;  1S72 1;  2J6A A;  3TE5 B;  4Y52 I;  3H0G I;  2P28 A;  4E2W A;  3CXC Z;  3ESW A;  1X3W A;  1WII A;  1Q7Y 2;  2PM9 A;  1TWG I;  1NJI 1;  3J81 f;  1YIT 1;  1Q81 1;  2RPR A;  1KQS Y;  2OOX B;  1Y1V S;  4HGY A;  3G6E 1;  1TWC I;  3CCQ 1;  5LL6 f;  3G6E Z;  3CCQ Z;  5C3E I;  1VQ6 1;  3VMH A;  4NBD A;  1VQ6 Z;  2OTJ 1;  4MH4 A;  3VTN A;  3S17 I;  1VQN 1;  2H85 A;  2OTJ Z;  4MD7 A;  4TNU A;  1VQN Z;  1VQ5 1;  3HOY I;  3VMI A;  2K5R A;  1VQ5 Z;  2PK7 A;  2F4M A;  1K73 1;  5A2Q b;  3GTG I;  2YU9 I;  1Z01 A;  3CMA 1;  1Q82 2;  4MD9 A;  3H3V J;  1Q86 2;  5T64 A;  4NBG A;  1KD1 2;  2QRE B;  1W2B Y;  4DK1 A;  4DGL A;  1ML8 A;  2DE6 A;  1VQ7 1;  2QLV B;  4BY1 I;  1VQ7 Z;  3CXC Y;  4A3J I;  1Y1V I;  4NB8 A;  1RO4 A;  1KC8 2;  5IT9 f;  4MON A;  2E2I I;  3CCU 1;  3F3F C;  3S1N I;  2P3Y A;  1KQS Z;  3KIF A;  4HGZ A;  3CCE 1;  1K8A 2;  2QR1 B;  2Q4Z A;  3CCE Z;  2QA4 1;  1N8R 1;  3S14 I;  3FKI I;  2QA4 Z;  3M4O I;  3J80 f;  2G2K A;  2RHB A;  2JA5 I;  3CQZ I;  2PMZ A;  1NP6 A;  2JS4 A;  2E2H I;  1YUA A;  3CCL 1;  2O53 A;  4E2X A;  4RV9 A;  2VF1 A;  5AN9 F;  3CCL Z;  5IP9 I;  1K9M 1;  2W03 A;  2OTL 1;  4RVG A;  1W2B Z;  3QWU A;  2GTH A;  4MXU A;  2EGT A;  3M3Y I;  2JMO A;  1SFO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...