1M1K1

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k100
1YI2Z 3CCVZ 2OTLZ 1M1K1 1VQL1 1S721 1VQP1 1JJ2Y 3CCSZ 3CPWZ 3OW2Y 3CMA1 3CCL1 1K8A2 1YJN1 1VQ9Z 1Q822 1JJ2Z 1YHQ1 1QVFZ 1VQ61 1VQ71 1VQ5Z 1VQ4Z 3G6E1 1YJ91 3CD61 3OW2Z 1N8R2 3CPWY 1VQLZ 1S72Z 1VQPZ 1YIJ1 1KC81 3CCM1 3CMAZ 3CCU1 1VQ81 1VQO1 1QVFY 3CC21 3CCLZ 3CCE1 1Q811 1YJNZ 3CC41 3CCR1 3CC71 1YHQZ 1YJW1 1Q7Y1 1VQ6Z 1VQ7Z 3G6EZ 1KD11 1YJ9Z 3CD6Z 1K731 1Q861 1M901 2QA41 1NJI1 3G4S1 1YIT1 1YIJZ 1M1K2 3CCMZ 1VQM1 3CCUZ 1VQOZ 3CC2Z 3CCEZ 3CCQ1 3CCRZ 3CC7Z 1YJWZ 3CC4Z 1W2BZ 1VQK1 3G711 1QVGZ 2QEX1 2QA4Z 3CME1 3G4SZ 1KQSZ 1VQN1 3CXCZ 1YITZ 3CCJ1 1K8A1 3I551 1K9M1 1VQMZ 3I561 1KC82 2OTJ1 1N8R1 3CCQZ 1W2BY 1YI21 3CCV1 1VQ8Z 1QVGY 2OTL1 1Q812 1KQSY 3CXCY 1VQKZ 3G71Z 1Q7Y2 2QEXZ 3CCS1 1VQNZ 3CMEZ 1KD12 1K732 3CCJZ 3I55Z 1Q862 1M902 1K9M2 1NJI2 3I56Z 2OTJZ 1VQ91 1Q821 1VQ51 1VQ41
chains in the Genus database with same CATH superfamily
2RBLA 4CL1A 2DE6A 4E32A 3KIFA 3HKZA 1Z01A 1VQP1 4MXUA 3S16I 1JJ2Y 3M3YI 1QXFA 3OW2Y 3CMA1 1TFIA 4E2YA 1YJN1 2HU9A 1Q822 2VF1A 1YHQ1 2R92I 3D2LA 4S1TA 4E2XA 2QR1B 3M4OI 1Z02A 5IT9f 1S72Z 3CCM1 1Y1VS 1NUIA 1N2FA 3CCU1 1QVFY 3CCE1 5IP7I 1VLAA 4MD8A 1SFOI 3G6EZ 5FLMI 1RO2A 3Q87A 2JNYA 2V8JA 2M48A 4TNUA 1TWAI 2OOYB 1M1K2 2EGTA 2B63I 1RNIA 5LL6f 1ZB9A 3CC2Z 4Y52I 4MD9A 2NVXI 3CC7Z 1YJWZ 4A93I 3J81f 4RVGA 3VMIA 2NVYI 5FLXf 3G711 1NP6A 5C44I 1WW9A 2G2KA 3GTPI 1K9M1 3NDIA 1KC82 3CCQZ 1W2BY 1PFTA 2PMZA 3J80b 4X6AI 3S1MI 1TWCI 2JA6I 1VQKZ 3FKII 3GTMI 5A2Qb 3HOVI 2BJOA 1KD12 3NH4A 1Z03A 3S15I 1Q862 4A3MI 1NJI2 2KI7B 4NBBA 1VQ41 1YI2Z 2VPXA 3I4MI 3BG1B 5IP9I 3D9XA 3I4NI 1RQFA 2Y0SA 3CCSZ 2JIMA 3CPWZ 4RV9A 3IF8A 2NAPA 3I07A 4MRIA 3CCL1 3HOZI 1K8A2 1TWFI 1VQ9Z 1VQ61 2LIYA 3P5JB 5C3EI 1VQ71 1VQ5Z 1QF8A 1YJ91 3CD61 3KIHA 2I3CA 2DE5A 5C4XI 4DGLA 3S17I 1VQPZ 4XX2A 4RVHA 1Q16A 5D1OA 3CMAZ 1Y1VI 4E30A 3S2HI 2RHBA 4EWCA 2W03A 4NOZA 2JIQA 1YJNZ 4A3FI 3PO3S 3CC41 2J6AA 1Q7Y1 1YHQZ 1K731 4NBEA 3MZLB 4Y7NI 2QA41 2VUGA 3JAMf 3G4S1 3GTLI 1WIIA 4BBRI 4AYBA 3CCMZ 2NVTI 2W04A 2JUBA 2VPWA 1VQM1 3H3VJ 3HOWI 2QLVB 3CCUZ 4A3KI 3VTNA 3CCEZ 2V3VA 2JA7I 3F3PC 4HH4A 2IV2X 1YUAA 2R93I 2JA8I 3GTQI 5T67A 1QVGZ 2QEX1 1I3QI 2QREB 2O4HA 3CME1 3CXCZ 1USPB 3TDHB 3CCJ1 2JIOA 3I551 3I561 2P28A 3EEDA 3H0GI 2O53A 2JS4A 3CCV1 1VQ8Z 2OTL1 1Q812 4E2WA 1KQSY 4A3DI 3G71Z 1RO0A 4A3BI 5C4JI 2E2II 3S1QI 2JA5I 5T64A 2IZ3A 3U50C 1K9M2 1M902 1ZH1A 2GTIA 3GTGI 3RZOI 2OZKA 2E7ZA 3GCFA 1RO4A 2R6MA 3F3FC 1RLYA 1M1K1 3S1RI 1VQL1 2E9HA 3VMHA 3IFUA 1Y8CA 2ZAEB 1QVFZ 1VQ4Z 2JIRA 1N8R2 4MH4A 2K3RA 5AN9F 1YIJ1 2E2JI 1KC81 4NBCA 1K83I 1JWHC 3J80f 1VQO1 2WB1A 3CCLZ 3FQMA 3RZDI 3S2DI 3CCR1 1VQ6Z 5A2Qf 1VQ7Z 3PO3I 4RVFA 1KD11 2RT9A 1YJ9Z 3CD6Z 1I50I 1Q861 1NJI1 3S1NI 3NFZA 4MD7A 1YIT1 2V8KA 2VUMI 1L1OC 4HGZA 3CQZI 3NH5A 4MONA 1TWGI 4DQYB 4NFRA 3GTMS 2P3YA 2Q4ZA 2YU9I 3CC4Z 4DK1A 4A3GI 4QTTA 1W2BZ 1KRLA 2R7ZI 2QA4Z 3MONA 3G4SZ 1VQN1 3PO2I 1K8A1 3IX0A 1VQMZ 5IT9b 2OTJ1 3D6WA 1S7MA 4RVDA 2GU2A 1WCMI 4A3II 1FDIA 2Q51A 4A3EI 2WAQA 1YUKA 2QEXZ 2RIQA 3CMEZ 4HGYA 3CCJZ 3I55Z 3MZKB 4BY7I 4NBFA 3VMGA 3I56Z 1Q821 1X3WA 1X0TA 3CCVZ 2OTLZ 1X3ZA 2DE7A 3K7AI 4RS4A 1S721 2HF1A 3NDJA 3J81b 4NBGA 1P9NA 4NBDA 4BY1I 1DL6A 2M6NA 3FQQA 5FLXb 3T4NB 3QWUA 2LEXA 4E31A 1JJ2Z 5D1OB 3J7A4 3G6E1 1ML8A 4A3JI 3OW2Z 4NBHA 2GTHA 3CPWY 1VQLZ 2VPYA 1TWHI 1AA6A 2RPRA 2KPIA 2PM9A 1WJ2A 1VQ81 3CC21 1Q811 3CC71 1YJW1 3BG0B 2JR6A 2QRDB 1QYPA 3HOXI 5T6BA 1M901 3HOUI 1YIJZ 4BXXI 3NH8A 3IR7A 1Y1WI 2PK7A 1I6HI 2V8IA 2VPZA 1VQOZ 1R9TI 3CCQ1 1ZB8A 4NBAA 3GTKI 3EERA 2F4OA 5CM2M 4NB8A 3CCRZ 3ESWA 2F4MA 2QRCB 1VQK1 2AYDA 4BBSI 2H85A 1WZNA 2LFUA 4QTUA 1KQSZ 1YITZ 1FDOA 2V45A 2E2HI 3GKQA 2AKLA 2YADA 4A3CI 2K5RA 3S14I 1N8R1 2NVQI 3GTOI 3HOYI 1YI21 1USPA 1SIWA 1QVGY 4A3LI 4NH1C 2OOXB 3VB9A 3CXCY 4E33A 1LQLA 4NB9A 2JIPA 1Q7Y2 3CCS1 1VQNZ 2IZ4A 4E2ZA 1K732 2JMOA 3JAMb 2QKDA 3TE5B 2OTJZ 1VQ91 3GTJI 5D1PA 3LUSA 1VQ51
chains in the Genus database with same CATH topology
2RBLA 4CL1A 2DE6A 4E32A 3KIFA 3HKZA 1Z01A 1VQP1 4MXUA 3S16I 1JJ2Y 3M3YI 3OW2Y 3CMA1 1TFIA 4E2YA 1YJN1 2HU9A 1Q822 2VF1A 1YHQ1 2R92I 4S1TA 4E2XA 2QR1B 3M4OI 1Z02A 5IT9f 1S72Z 3CCM1 1Y1VS 1NUIA 1N2FA 3CCU1 1QVFY 3CCE1 5IP7I 1VLAA 4MD8A 1SFOI 3G6EZ 5FLMI 1RO2A 3Q87A 2JNYA 2V8JA 2M48A 4TNUA 1TWAI 2OOYB 1M1K2 2EGTA 2B63I 1RNIA 5LL6f 1ZB9A 3CC2Z 4Y52I 4MD9A 2NVXI 3CC7Z 1YJWZ 4A93I 3J81f 4RVGA 3VMIA 2NVYI 5FLXf 3G711 1NP6A 5C44I 1WW9A 2G2KA 3GTPI 1K9M1 3NDIA 1KC82 3CCQZ 1W2BY 1PFTA 2PMZA 3J80b 4X6AI 3S1MI 1TWCI 2JA6I 1VQKZ 3FKII 3GTMI 5A2Qb 3HOVI 2BJOA 1KD12 3NH4A 1Z03A 3S15I 1Q862 4A3MI 1NJI2 2KI7B 4NBBA 1VQ41 1YI2Z 3I4MI 3BG1B 5IP9I 3D9XA 3I4NI 1RQFA 2Y0SA 3CCSZ 3CPWZ 4RV9A 3IF8A 3I07A 4MRIA 3HOZI 3CCL1 1K8A2 1TWFI 1VQ9Z 1VQ61 2LIYA 3P5JB 5C3EI 1VQ71 1VQ5Z 1QF8A 1YJ91 3CD61 3KIHA 2I3CA 2DE5A 5C4XI 4DGLA 3S17I 1VQPZ 4XX2A 4RVHA 5D1OA 3CMAZ 1Y1VI 4E30A 3S2HI 2RHBA 4EWCA 2W03A 4NOZA 1YJNZ 4A3FI 3PO3S 3CC41 2J6AA 1Q7Y1 1YHQZ 1K731 4NBEA 3MZLB 4Y7NI 2QA41 2VUGA 3JAMf 3G4S1 3GTLI 1WIIA 4BBRI 4AYBA 3CCMZ 2NVTI 2W04A 2JUBA 1VQM1 3H3VJ 3HOWI 2QLVB 3CCUZ 4A3KI 3VTNA 3CCEZ 2JA7I 3F3PC 4HH4A 1YUAA 2R93I 2JA8I 3GTQI 5T67A 1QVGZ 2QEX1 1I3QI 2QREB 2O4HA 3CME1 3CXCZ 1USPB 3TDHB 3CCJ1 3I551 3I561 2P28A 3EEDA 3H0GI 2O53A 2JS4A 3CCV1 1VQ8Z 2OTL1 1Q812 4E2WA 1KQSY 4A3DI 3G71Z 1RO0A 4A3BI 5C4JI 2E2II 3S1QI 2JA5I 5T64A 2IZ3A 3U50C 1K9M2 1M902 1ZH1A 2GTIA 3GTGI 3RZOI 2OZKA 3GCFA 1RO4A 2R6MA 3F3FC 1RLYA 1M1K1 3S1RI 1VQL1 2E9HA 3VMHA 3IFUA 2ZAEB 1QVFZ 1VQ4Z 1N8R2 4MH4A 2K3RA 5AN9F 1YIJ1 2E2JI 1KC81 4NBCA 1K83I 1JWHC 3J80f 1VQO1 2WB1A 3CCLZ 3FQMA 3RZDI 3S2DI 3CCR1 1VQ6Z 5A2Qf 1VQ7Z 3PO3I 4RVFA 1KD11 2RT9A 1YJ9Z 3CD6Z 1I50I 1Q861 1NJI1 3S1NI 3NFZA 4MD7A 1YIT1 2V8KA 2VUMI 1L1OC 4HGZA 3CQZI 3NH5A 4MONA 1TWGI 4DQYB 4NFRA 3GTMS 2P3YA 2Q4ZA 2YU9I 3CC4Z 4DK1A 4A3GI 4QTTA 1W2BZ 1KRLA 2R7ZI 2QA4Z 3MONA 3G4SZ 1VQN1 3PO2I 1K8A1 3IX0A 1VQMZ 5IT9b 2OTJ1 3D6WA 1S7MA 4RVDA 2GU2A 1WCMI 4A3II 2Q51A 4A3EI 2WAQA 1YUKA 2QEXZ 2RIQA 3CMEZ 4HGYA 3CCJZ 3I55Z 3MZKB 4BY7I 4NBFA 3VMGA 3I56Z 1Q821 1X3WA 1X0TA 3CCVZ 2OTLZ 1X3ZA 2DE7A 3K7AI 4RS4A 1S721 2HF1A 3NDJA 3J81b 4NBGA 1P9NA 4NBDA 4BY1I 1DL6A 2M6NA 3FQQA 5FLXb 3T4NB 3QWUA 4E31A 1JJ2Z 5D1OB 3J7A4 3G6E1 1ML8A 4A3JI 3OW2Z 4NBHA 2GTHA 3CPWY 1VQLZ 1TWHI 2RPRA 2KPIA 2PM9A 1VQ81 3CC21 1Q811 3CC71 1YJW1 3BG0B 2JR6A 2QRDB 1QYPA 3HOXI 5T6BA 1M901 3HOUI 1YIJZ 4BXXI 3NH8A 1Y1WI 2PK7A 1I6HI 2V8IA 1VQOZ 1R9TI 3CCQ1 1ZB8A 4NBAA 3GTKI 3EERA 2F4OA 5CM2M 4NB8A 3CCRZ 3ESWA 2F4MA 2QRCB 1VQK1 4BBSI 2H85A 2LFUA 4QTUA 1KQSZ 1YITZ 2E2HI 3GKQA 2AKLA 2YADA 4A3CI 2K5RA 3S14I 1N8R1 2NVQI 3GTOI 3HOYI 1YI21 1USPA 4A3LI 1QVGY 4NH1C 2OOXB 3VB9A 3CXCY 4E33A 1LQLA 4NB9A 1Q7Y2 3CCS1 1VQNZ 2IZ4A 4E2ZA 1K732 2JMOA 3JAMb 2QKDA 3TE5B 2OTJZ 1VQ91 3GTJI 5D1PA 3LUSA 1VQ51
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Z;  3CCV Z;  2OTL Z;  1M1K 1;  1VQL 1;  1S72 1;  1VQP 1;  1JJ2 Y;  3CCS Z;  3CPW Z;  3OW2 Y;  3CMA 1;  3CCL 1;  1K8A 2;  1YJN 1;  1VQ9 Z;  1Q82 2;  1JJ2 Z;  1YHQ 1;  1QVF Z;  1VQ6 1;  1VQ7 1;  1VQ5 Z;  1VQ4 Z;  3G6E 1;  1YJ9 1;  3CD6 1;  3OW2 Z;  1N8R 2;  3CPW Y;  1VQL Z;  1S72 Z;  1VQP Z;  1YIJ 1;  1KC8 1;  3CCM 1;  3CMA Z;  3CCU 1;  1VQ8 1;  1VQO 1;  1QVF Y;  3CC2 1;  3CCL Z;  3CCE 1;  1Q81 1;  1YJN Z;  3CC4 1;  3CCR 1;  3CC7 1;  1YHQ Z;  1YJW 1;  1Q7Y 1;  1VQ6 Z;  1VQ7 Z;  3G6E Z;  1KD1 1;  1YJ9 Z;  3CD6 Z;  1K73 1;  1Q86 1;  1M90 1;  2QA4 1;  1NJI 1;  3G4S 1;  1YIT 1;  1YIJ Z;  1M1K 2;  3CCM Z;  1VQM 1;  3CCU Z;  1VQO Z;  3CC2 Z;  3CCE Z;  3CCQ 1;  3CCR Z;  3CC7 Z;  1YJW Z;  3CC4 Z;  1W2B Z;  1VQK 1;  3G71 1;  1QVG Z;  2QEX 1;  2QA4 Z;  3CME 1;  3G4S Z;  1KQS Z;  1VQN 1;  3CXC Z;  1YIT Z;  3CCJ 1;  1K8A 1;  3I55 1;  1K9M 1;  1VQM Z;  3I56 1;  1KC8 2;  2OTJ 1;  1N8R 1;  3CCQ Z;  1W2B Y;  1YI2 1;  3CCV 1;  1VQ8 Z;  1QVG Y;  2OTL 1;  1Q81 2;  1KQS Y;  3CXC Y;  1VQK Z;  3G71 Z;  1Q7Y 2;  2QEX Z;  3CCS 1;  1VQN Z;  3CME Z;  1KD1 2;  1K73 2;  3CCJ Z;  3I55 Z;  1Q86 2;  1M90 2;  1K9M 2;  1NJI 2;  3I56 Z;  2OTJ Z;  1VQ9 1;  1Q82 1;  1VQ5 1;  1VQ4 1; 
#chains in the Genus database with same CATH topology
 2RBL A;  4CL1 A;  2DE6 A;  4E32 A;  3KIF A;  3HKZ A;  1Z01 A;  1VQP 1;  4MXU A;  3S16 I;  1JJ2 Y;  3M3Y I;  1QXF A;  3OW2 Y;  3CMA 1;  1TFI A;  4E2Y A;  1YJN 1;  2HU9 A;  1Q82 2;  2VF1 A;  1YHQ 1;  2R92 I;  3D2L A;  4S1T A;  4E2X A;  2QR1 B;  3M4O I;  1Z02 A;  5IT9 f;  1S72 Z;  3CCM 1;  1Y1V S;  1NUI A;  1N2F A;  3CCU 1;  1QVF Y;  3CCE 1;  5IP7 I;  1VLA A;  4MD8 A;  1SFO I;  3G6E Z;  5FLM I;  1RO2 A;  3Q87 A;  2JNY A;  2V8J A;  2M48 A;  4TNU A;  1TWA I;  2OOY B;  1M1K 2;  2EGT A;  2B63 I;  1RNI A;  5LL6 f;  1ZB9 A;  3CC2 Z;  4Y52 I;  4MD9 A;  2NVX I;  3CC7 Z;  1YJW Z;  4A93 I;  3J81 f;  4RVG A;  3VMI A;  2NVY I;  5FLX f;  3G71 1;  1NP6 A;  5C44 I;  1WW9 A;  2G2K A;  3GTP I;  1K9M 1;  3NDI A;  1KC8 2;  3CCQ Z;  1W2B Y;  1PFT A;  2PMZ A;  3J80 b;  4X6A I;  3S1M I;  1TWC I;  2JA6 I;  1VQK Z;  3FKI I;  3GTM I;  5A2Q b;  3HOV I;  2BJO A;  1KD1 2;  3NH4 A;  1Z03 A;  3S15 I;  1Q86 2;  4A3M I;  1NJI 2;  2KI7 B;  4NBB A;  1VQ4 1;  1YI2 Z;  2VPX A;  3I4M I;  3BG1 B;  5IP9 I;  3D9X A;  3I4N I;  1RQF A;  2Y0S A;  3CCS Z;  2JIM A;  3CPW Z;  4RV9 A;  3IF8 A;  2NAP A;  3I07 A;  4MRI A;  3CCL 1;  3HOZ I;  1K8A 2;  1TWF I;  1VQ9 Z;  1VQ6 1;  2LIY A;  3P5J B;  5C3E I;  1VQ7 1;  1VQ5 Z;  1QF8 A;  1YJ9 1;  3CD6 1;  3KIH A;  2I3C A;  2DE5 A;  5C4X I;  4DGL A;  3S17 I;  1VQP Z;  4XX2 A;  4RVH A;  1Q16 A;  5D1O A;  3CMA Z;  1Y1V I;  4E30 A;  3S2H I;  2RHB A;  4EWC A;  2W03 A;  4NOZ A;  2JIQ A;  1YJN Z;  4A3F I;  3PO3 S;  3CC4 1;  2J6A A;  1Q7Y 1;  1YHQ Z;  1K73 1;  4NBE A;  3MZL B;  4Y7N I;  2QA4 1;  2VUG A;  3JAM f;  3G4S 1;  3GTL I;  1WII A;  4BBR I;  4AYB A;  3CCM Z;  2NVT I;  2W04 A;  2JUB A;  2VPW A;  1VQM 1;  3H3V J;  3HOW I;  2QLV B;  3CCU Z;  4A3K I;  3VTN A;  3CCE Z;  2V3V A;  2JA7 I;  3F3P C;  4HH4 A;  2IV2 X;  1YUA A;  2R93 I;  2JA8 I;  3GTQ I;  5T67 A;  1QVG Z;  2QEX 1;  1I3Q I;  2QRE B;  2O4H A;  3CME 1;  3CXC Z;  1USP B;  3TDH B;  3CCJ 1;  2JIO A;  3I55 1;  3I56 1;  2P28 A;  3EED A;  3H0G I;  2O53 A;  2JS4 A;  3CCV 1;  1VQ8 Z;  2OTL 1;  1Q81 2;  4E2W A;  1KQS Y;  4A3D I;  3G71 Z;  1RO0 A;  4A3B I;  5C4J I;  2E2I I;  3S1Q I;  2JA5 I;  5T64 A;  2IZ3 A;  3U50 C;  1K9M 2;  1M90 2;  1ZH1 A;  2GTI A;  3GTG I;  3RZO I;  2OZK A;  2E7Z A;  3GCF A;  1RO4 A;  2R6M A;  3F3F C;  1RLY A;  1M1K 1;  3S1R I;  1VQL 1;  2E9H A;  3VMH A;  3IFU A;  1Y8C A;  2ZAE B;  1QVF Z;  1VQ4 Z;  2JIR A;  1N8R 2;  4MH4 A;  2K3R A;  5AN9 F;  1YIJ 1;  2E2J I;  1KC8 1;  4NBC A;  1K83 I;  1JWH C;  3J80 f;  1VQO 1;  2WB1 A;  3CCL Z;  3FQM A;  3RZD I;  3S2D I;  3CCR 1;  1VQ6 Z;  5A2Q f;  1VQ7 Z;  3PO3 I;  4RVF A;  1KD1 1;  2RT9 A;  1YJ9 Z;  3CD6 Z;  1I50 I;  1Q86 1;  1NJI 1;  3S1N I;  3NFZ A;  4MD7 A;  1YIT 1;  2V8K A;  2VUM I;  1L1O C;  4HGZ A;  3CQZ I;  3NH5 A;  4MON A;  1TWG I;  4DQY B;  4NFR A;  3GTM S;  2P3Y A;  2Q4Z A;  2YU9 I;  3CC4 Z;  4DK1 A;  4A3G I;  4QTT A;  1W2B Z;  1KRL A;  2R7Z I;  2QA4 Z;  3MON A;  3G4S Z;  1VQN 1;  3PO2 I;  1K8A 1;  3IX0 A;  1VQM Z;  5IT9 b;  2OTJ 1;  3D6W A;  1S7M A;  4RVD A;  2GU2 A;  1WCM I;  4A3I I;  1FDI A;  2Q51 A;  4A3E I;  2WAQ A;  1YUK A;  2QEX Z;  2RIQ A;  3CME Z;  4HGY A;  3CCJ Z;  3I55 Z;  3MZK B;  4BY7 I;  4NBF A;  3VMG A;  3I56 Z;  1Q82 1;  1X3W A;  1X0T A;  3CCV Z;  2OTL Z;  1X3Z A;  2DE7 A;  3K7A I;  4RS4 A;  1S72 1;  2HF1 A;  3NDJ A;  3J81 b;  4NBG A;  1P9N A;  4NBD A;  4BY1 I;  1DL6 A;  2M6N A;  3FQQ A;  5FLX b;  3T4N B;  3QWU A;  2LEX A;  4E31 A;  1JJ2 Z;  5D1O B;  3J7A 4;  3G6E 1;  1ML8 A;  4A3J I;  3OW2 Z;  4NBH A;  2GTH A;  3CPW Y;  1VQL Z;  2VPY A;  1TWH I;  1AA6 A;  2RPR A;  2KPI A;  2PM9 A;  1WJ2 A;  1VQ8 1;  3CC2 1;  1Q81 1;  3CC7 1;  1YJW 1;  3BG0 B;  2JR6 A;  2QRD B;  1QYP A;  3HOX I;  5T6B A;  1M90 1;  3HOU I;  1YIJ Z;  4BXX I;  3NH8 A;  3IR7 A;  1Y1W I;  2PK7 A;  1I6H I;  2V8I A;  2VPZ A;  1VQO Z;  1R9T I;  3CCQ 1;  1ZB8 A;  4NBA A;  3GTK I;  3EER A;  2F4O A;  5CM2 M;  4NB8 A;  3CCR Z;  3ESW A;  2F4M A;  2QRC B;  1VQK 1;  2AYD A;  4BBS I;  2H85 A;  1WZN A;  2LFU A;  4QTU A;  1KQS Z;  1YIT Z;  1FDO A;  2V45 A;  2E2H I;  3GKQ A;  2AKL A;  2YAD A;  4A3C I;  2K5R A;  3S14 I;  1N8R 1;  2NVQ I;  3GTO I;  3HOY I;  1YI2 1;  1USP A;  1SIW A;  1QVG Y;  4A3L I;  4NH1 C;  2OOX B;  3VB9 A;  3CXC Y;  4E33 A;  1LQL A;  4NB9 A;  2JIP A;  1Q7Y 2;  3CCS 1;  1VQN Z;  2IZ4 A;  4E2Z A;  1K73 2;  2JMO A;  3JAM b;  2QKD A;  3TE5 B;  2OTJ Z;  1VQ9 1;  3GTJ I;  5D1P A;  3LUS A;  1VQ5 1; 
#chains in the Genus database with same CATH homology
 2RBL A;  4CL1 A;  2DE6 A;  4E32 A;  3KIF A;  3HKZ A;  1Z01 A;  1VQP 1;  4MXU A;  3S16 I;  1JJ2 Y;  3M3Y I;  3OW2 Y;  3CMA 1;  1TFI A;  4E2Y A;  1YJN 1;  2HU9 A;  1Q82 2;  2VF1 A;  1YHQ 1;  2R92 I;  4S1T A;  4E2X A;  2QR1 B;  3M4O I;  1Z02 A;  5IT9 f;  1S72 Z;  3CCM 1;  1Y1V S;  1NUI A;  1N2F A;  3CCU 1;  1QVF Y;  3CCE 1;  5IP7 I;  1VLA A;  4MD8 A;  1SFO I;  3G6E Z;  5FLM I;  1RO2 A;  3Q87 A;  2JNY A;  2V8J A;  2M48 A;  4TNU A;  1TWA I;  2OOY B;  1M1K 2;  2EGT A;  2B63 I;  1RNI A;  5LL6 f;  1ZB9 A;  3CC2 Z;  4Y52 I;  4MD9 A;  2NVX I;  3CC7 Z;  1YJW Z;  4A93 I;  3J81 f;  4RVG A;  3VMI A;  2NVY I;  5FLX f;  3G71 1;  1NP6 A;  5C44 I;  1WW9 A;  2G2K A;  3GTP I;  1K9M 1;  3NDI A;  1KC8 2;  3CCQ Z;  1W2B Y;  1PFT A;  2PMZ A;  3J80 b;  4X6A I;  3S1M I;  1TWC I;  2JA6 I;  1VQK Z;  3FKI I;  3GTM I;  5A2Q b;  3HOV I;  2BJO A;  1KD1 2;  3NH4 A;  1Z03 A;  3S15 I;  1Q86 2;  4A3M I;  1NJI 2;  2KI7 B;  4NBB A;  1VQ4 1;  1YI2 Z;  3I4M I;  3BG1 B;  5IP9 I;  3D9X A;  3I4N I;  1RQF A;  2Y0S A;  3CCS Z;  3CPW Z;  4RV9 A;  3IF8 A;  3I07 A;  4MRI A;  3HOZ I;  3CCL 1;  1K8A 2;  1TWF I;  1VQ9 Z;  1VQ6 1;  2LIY A;  3P5J B;  5C3E I;  1VQ7 1;  1VQ5 Z;  1QF8 A;  1YJ9 1;  3CD6 1;  3KIH A;  2I3C A;  2DE5 A;  5C4X I;  4DGL A;  3S17 I;  1VQP Z;  4XX2 A;  4RVH A;  5D1O A;  3CMA Z;  1Y1V I;  4E30 A;  3S2H I;  2RHB A;  4EWC A;  2W03 A;  4NOZ A;  1YJN Z;  4A3F I;  3PO3 S;  3CC4 1;  2J6A A;  1Q7Y 1;  1YHQ Z;  1K73 1;  4NBE A;  3MZL B;  4Y7N I;  2QA4 1;  2VUG A;  3JAM f;  3G4S 1;  3GTL I;  1WII A;  4BBR I;  4AYB A;  3CCM Z;  2NVT I;  2W04 A;  2JUB A;  1VQM 1;  3H3V J;  3HOW I;  2QLV B;  3CCU Z;  4A3K I;  3VTN A;  3CCE Z;  2JA7 I;  3F3P C;  4HH4 A;  1YUA A;  2R93 I;  2JA8 I;  3GTQ I;  5T67 A;  1QVG Z;  2QEX 1;  1I3Q I;  2QRE B;  2O4H A;  3CME 1;  3CXC Z;  1USP B;  3TDH B;  3CCJ 1;  3I55 1;  3I56 1;  2P28 A;  3EED A;  3H0G I;  2O53 A;  2JS4 A;  3CCV 1;  1VQ8 Z;  2OTL 1;  1Q81 2;  4E2W A;  1KQS Y;  4A3D I;  3G71 Z;  1RO0 A;  4A3B I;  5C4J I;  2E2I I;  3S1Q I;  2JA5 I;  5T64 A;  2IZ3 A;  3U50 C;  1K9M 2;  1M90 2;  1ZH1 A;  2GTI A;  3GTG I;  3RZO I;  2OZK A;  3GCF A;  1RO4 A;  2R6M A;  3F3F C;  1RLY A;  1M1K 1;  3S1R I;  1VQL 1;  2E9H A;  3VMH A;  3IFU A;  2ZAE B;  1QVF Z;  1VQ4 Z;  1N8R 2;  4MH4 A;  2K3R A;  5AN9 F;  1YIJ 1;  2E2J I;  1KC8 1;  4NBC A;  1K83 I;  1JWH C;  3J80 f;  1VQO 1;  2WB1 A;  3CCL Z;  3FQM A;  3RZD I;  3S2D I;  3CCR 1;  1VQ6 Z;  5A2Q f;  1VQ7 Z;  3PO3 I;  4RVF A;  1KD1 1;  2RT9 A;  1YJ9 Z;  3CD6 Z;  1I50 I;  1Q86 1;  1NJI 1;  3S1N I;  3NFZ A;  4MD7 A;  1YIT 1;  2V8K A;  2VUM I;  1L1O C;  4HGZ A;  3CQZ I;  3NH5 A;  4MON A;  1TWG I;  4DQY B;  4NFR A;  3GTM S;  2P3Y A;  2Q4Z A;  2YU9 I;  3CC4 Z;  4DK1 A;  4A3G I;  4QTT A;  1W2B Z;  1KRL A;  2R7Z I;  2QA4 Z;  3MON A;  3G4S Z;  1VQN 1;  3PO2 I;  1K8A 1;  3IX0 A;  1VQM Z;  5IT9 b;  2OTJ 1;  3D6W A;  1S7M A;  4RVD A;  2GU2 A;  1WCM I;  4A3I I;  2Q51 A;  4A3E I;  2WAQ A;  1YUK A;  2QEX Z;  2RIQ A;  3CME Z;  4HGY A;  3CCJ Z;  3I55 Z;  3MZK B;  4BY7 I;  4NBF A;  3VMG A;  3I56 Z;  1Q82 1;  1X3W A;  1X0T A;  3CCV Z;  2OTL Z;  1X3Z A;  2DE7 A;  3K7A I;  4RS4 A;  1S72 1;  2HF1 A;  3NDJ A;  3J81 b;  4NBG A;  1P9N A;  4NBD A;  4BY1 I;  1DL6 A;  2M6N A;  3FQQ A;  5FLX b;  3T4N B;  3QWU A;  4E31 A;  1JJ2 Z;  5D1O B;  3J7A 4;  3G6E 1;  1ML8 A;  4A3J I;  3OW2 Z;  4NBH A;  2GTH A;  3CPW Y;  1VQL Z;  1TWH I;  2RPR A;  2KPI A;  2PM9 A;  1VQ8 1;  3CC2 1;  1Q81 1;  3CC7 1;  1YJW 1;  3BG0 B;  2JR6 A;  2QRD B;  1QYP A;  3HOX I;  5T6B A;  1M90 1;  3HOU I;  1YIJ Z;  4BXX I;  3NH8 A;  1Y1W I;  2PK7 A;  1I6H I;  2V8I A;  1VQO Z;  1R9T I;  3CCQ 1;  1ZB8 A;  4NBA A;  3GTK I;  3EER A;  2F4O A;  5CM2 M;  4NB8 A;  3CCR Z;  3ESW A;  2F4M A;  2QRC B;  1VQK 1;  4BBS I;  2H85 A;  2LFU A;  4QTU A;  1KQS Z;  1YIT Z;  2E2H I;  3GKQ A;  2AKL A;  2YAD A;  4A3C I;  2K5R A;  3S14 I;  1N8R 1;  2NVQ I;  3GTO I;  3HOY I;  1YI2 1;  1USP A;  4A3L I;  1QVG Y;  4NH1 C;  2OOX B;  3VB9 A;  3CXC Y;  4E33 A;  1LQL A;  4NB9 A;  1Q7Y 2;  3CCS 1;  1VQN Z;  2IZ4 A;  4E2Z A;  1K73 2;  2JMO A;  3JAM b;  2QKD A;  3TE5 B;  2OTJ Z;  1VQ9 1;  3GTJ I;  5D1P A;  3LUS A;  1VQ5 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...