1M1K1

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k100
1VQPZ 3CC2Z 1VQN1 3CD6Z 3G4SZ 3CC71 3CCL1 1VQ5Z 1VQNZ 3CCUZ 1VQP1 1KC82 3CC41 3CCE1 3CCM1 1W2BZ 1JJ2Y 3I56Z 3CCQ1 3I561 1K8A1 1VQ4Z 3CME1 3CCS1 2OTL1 1VQKZ 1M901 1YHQZ 1Q7Y2 3CC7Z 3CXCZ 1YI2Z 3G4S1 1VQO1 1VQ51 3G6EZ 3CCJZ 1M902 3G6E1 3I55Z 1M1K1 3CC21 1S72Z 1QVGZ 1YJW1 1N8R1 3CPWY 3CCVZ 3G711 2QEX1 3CCRZ 1YIJ1 3CMAZ 3CPWZ 1VQMZ 3CCV1 2OTLZ 3CCSZ 3OW2Z 3CCEZ 3CCMZ 3CC4Z 1KQSY 3I551 1YIT1 1Q7Y1 1Q811 1YJ91 1NJI1 1YHQ1 1YJ9Z 1VQK1 1YI21 1M1K2 1YITZ 1W2BY 1JJ2Z 1YJNZ 1YIJZ 1K9M2 1VQM1 3CCQZ 3CCU1 3CMA1 2OTJZ 3CCLZ 1Q822 1YJWZ 2QA41 1VQ9Z 1K8A2 3CD61 1VQL1 1KQSZ 1QVFZ 1QVGY 1KC81 1K9M1 1K732 1VQ81 3CCJ1 1KD11 1VQ61 1VQLZ 1VQ91 1VQOZ 2QA4Z 1QVFY 1N8R2 2OTJ1 3CMEZ 1KD12 1K731 1VQ7Z 3G71Z 2QEXZ 1YJN1 1VQ71 1NJI2 3OW2Y 3CCR1 1VQ41 1Q812 1S721 1Q862 3CXCY 1Q861 1VQ6Z 1VQ8Z 1Q821
chains in the Genus database with same CATH superfamily
1VQPZ 3CC2Z 2AKLA 4NB8A 3G4SZ 2DE6A 3CC71 3KIHA 2PM9A 1VQ5Z 3VMHA 1ZH1A 1VQNZ 3PO3I 1Z01A 2VPYA 3J80f 1JJ2Y 2V45A 2QRCB 3M3YI 1Z03A 3I561 3CME1 2OTL1 3J7A4 3H3VJ 1VQKZ 1M901 2OOYB 3T4NB 2JIRA 1YI2Z 3S14I 3G4S1 3K7AI 3G6EZ 1M902 2K3RA 3CC21 3PO2I 1TFIA 2JA8I 2VPWA 2V8JA 2KI7B 1RO0A 4A3FI 3OW2Z 4S1TA 3I551 3NH4A 2IZ4A 1YIT1 3GTLI 4E2WA 1PFTA 3Q87A 4NBAA 4XX2A 4E30A 2O53A 3IX0A 1NUIA 3J81b 3EERA 1YJNZ 2NVYI 4Y52I 1QYPA 2E7ZA 2V8KA 1YIJZ 1S7MA 2LFUA 1WCMI 2VUGA 3P5JB 2QLVB 3CCLZ 1Q822 5IT9b 1VQL1 5T67A 5FLXb 4E2YA 1K732 3CCJ1 3VMGA 3HOXI 2QA4Z 4NB9A 1QVFY 2Q51A 1KD12 3M4OI 1VQ7Z 1RNIA 1VQ71 2JIMA 1NJI2 3OW2Y 2V3VA 3CCR1 3S1NI 3GTMI 2K5RA 2VPZA 2OZKA 3CD6Z 4NFRA 5D1PA 4E2ZA 3VTNA 5FLMI 2RT9A 2VF1A 1KC82 3CCE1 4NBBA 2JUBA 4MONA 3S17I 1TWGI 1K8A1 1VQ4Z 4A3DI 1X0TA 2JIQA 2B63I 2P3YA 5C4XI 1YHQZ 2GTHA 1Y8CA 3TDHB 5FLXf 3NFZA 3S1MI 4Y7NI 1Z02A 1ZB9A 3U50C 2M6NA 1QVGZ 1YJW1 4MXUA 3CPWY 3CCRZ 3CMAZ 1VQMZ 3MZLB 4NBFA 3CCSZ 1WJ2A 2R93I 4E32A 2JNYA 5T6BA 1KQSY 1TWHI 3CQZI 1N2FA 1NP6A 1Y1VI 1Q811 4NBDA 2GTIA 4DQYB 4A93I 2AYDA 1YHQ1 4MRIA 1YI21 2LEXA 1M1K2 2E2HI 2RPRA 1W2BY 3I4NI 5D1OB 1X3ZA 1SFOI 1K9M2 2WAQA 1AA6A 3CMA1 4A3CI 2YADA 3VMIA 5C4JI 1QXFA 2O4HA 3CD61 1JWHC 4E31A 4NBHA 1KQSZ 4A3II 1QVGY 3LUSA 1KD11 1VQ61 1VQLZ 1RO2A 2VUMI 1I50I 2PMZA 3FQMA 2HF1A 1N8R2 2I3CA 1ML8A 2OTJ1 2JR6A 4A3KI 1K731 3G71Z 2QEXZ 4BY1I 1USPA 3HOUI 4MD9A 1Q861 2JIOA 1VQ6Z 1VQ8Z 1Q821 1FDOA 2QRDB 2NAPA 2PK7A 5IT9f 3CCL1 4A3BI 3CCUZ 1VLAA 3CC41 3CCM1 2W03A 1W2BZ 3I56Z 1Y1WI 4EWCA 1I3QI 3GTMS 4RV9A 2E9HA 3IFUA 5IP7I 1TWAI 4CL1A 3RZOI 4NBCA 3GTOI 3CC7Z 3CXCZ 3J80b 4MD8A 1KRLA 1VQ51 2GU2A 2DE5A 3CCJZ 2JS4A 4QTTA 3GTJI 2IZ3A 3I55Z 4HH4A 3JAMf 1S72Z 2Q4ZA 4NOZA 4BBRI 2V8IA 3CCVZ 2F4OA 3MONA 3G711 2QEX1 2P28A 3KIFA 2HU9A 1YIJ1 3CPWZ 3MZKB 2JMOA 3CCV1 2OTLZ 1X3WA 4X6AI 3CCEZ 5T64A 2JIPA 2BJOA 4AYBA 3QWUA 1Y1VS 3PO3S 1YJ91 4QTUA 3NDJA 2ZAEB 1FDIA 4BXXI 2RBLA 2EGTA 1YJ9Z 1VQK1 1YUAA 2OOXB 4DK1A 3GTPI 2R7ZI 1YITZ 3S2DI 2E2JI 2JA7I 1R9TI 4RVDA 3CCQZ 3CCU1 3S16I 2RHBA 2QKDA 3GKQA 1RO4A 2OTJZ 2F4MA 1ZB8A 4E33A 1WIIA 4TNUA 3HOVI 3EEDA 1K9M1 1VQ91 3I4MI 3NDIA 3I07A 3CMEZ 4A3JI 1YJN1 3RZDI 5C3EI 3GTGI 4RS4A 3BG0B 4A3EI 2JA5I 4RVFA 4HGZA 1SIWA 3VB9A 5C44I 4A3MI 4BBSI 1Q812 4A3LI 3JAMb 2Y0SA 3CXCY 1LQLA 1WW9A 5A2Qf 1VQN1 3D2LA 3NH5A 1L1OC 3BG1B 3S2HI 4BY7I 3F3PC 1DL6A 4DGLA 5IP9I 1VQP1 3GTQI 5AN9F 3CCQ1 3S1QI 3HKZA 2NVQI 2RIQA 2W04A 3S15I 3CCS1 1WZNA 1Q7Y2 4NBGA 4MD7A 1VQO1 3GTKI 3G6E1 1I6HI 1P9NA 1M1K1 1Q16A 1RQFA 1N8R1 5A2Qb 3ESWA 3FKII 4RVHA 2NVTI 2R6MA 3GCFA 2IV2X 1TWFI 3CCMZ 3CC4Z 4A3GI 4MH4A 2E2II 3D6WA 2YU9I 1Q7Y1 3HOZI 5LL6f 3HOYI 2LIYA 1NJI1 3D9XA 2WB1A 3F3FC 2VPXA 2QREB 3IF8A 4HGYA 4E2XA 1JJ2Z 3HOWI 2H85A 1YUKA 3FQQA 1VQM1 1TWCI 1YJWZ 2QA41 1RLYA 1VQ9Z 1K8A2 5CM2M 5D1OA 1USPB 3IR7A 2G2KA 1QVFZ 3S1RI 1KC81 3TE5B 1VQ81 4NBEA 2DE7A 1VQOZ 2NVXI 2QR1B 3NH8A 2J6AA 2M48A 2KPIA 1K83I 1VQ41 1S721 2R92I 3J81f 2JA6I 1Q862 4NH1C 3H0GI 4RVGA 1QF8A
chains in the Genus database with same CATH topology
1VQPZ 3CC2Z 2AKLA 4NB8A 3G4SZ 2DE6A 3CC71 3KIHA 2PM9A 1VQ5Z 3VMHA 1ZH1A 1VQNZ 3PO3I 1Z01A 3J80f 1JJ2Y 2QRCB 3M3YI 1Z03A 3I561 3CME1 2OTL1 3J7A4 3H3VJ 1VQKZ 1M901 2OOYB 3T4NB 1YI2Z 3S14I 3G4S1 3K7AI 3G6EZ 1M902 2K3RA 3CC21 3PO2I 1TFIA 2JA8I 2V8JA 2KI7B 1RO0A 4A3FI 3OW2Z 4S1TA 3I551 3NH4A 2IZ4A 1YIT1 3GTLI 4E2WA 1PFTA 3Q87A 4NBAA 4XX2A 4E30A 2O53A 3IX0A 1NUIA 3J81b 3EERA 1YJNZ 2NVYI 4Y52I 1QYPA 2V8KA 1YIJZ 1S7MA 2LFUA 1WCMI 2VUGA 3P5JB 2QLVB 3CCLZ 1Q822 5IT9b 1VQL1 5T67A 5FLXb 4E2YA 1K732 3CCJ1 3VMGA 3HOXI 2QA4Z 4NB9A 1QVFY 2Q51A 1KD12 3M4OI 1VQ7Z 1RNIA 1VQ71 1NJI2 3OW2Y 3CCR1 3S1NI 3GTMI 2K5RA 2OZKA 3CD6Z 4NFRA 5D1PA 4E2ZA 3VTNA 5FLMI 2RT9A 2VF1A 1KC82 3CCE1 4NBBA 2JUBA 4MONA 3S17I 1TWGI 1K8A1 1VQ4Z 4A3DI 1X0TA 2B63I 2P3YA 5C4XI 1YHQZ 2GTHA 3TDHB 5FLXf 3NFZA 3S1MI 4Y7NI 1Z02A 1ZB9A 3U50C 2M6NA 1QVGZ 1YJW1 4MXUA 3CPWY 3CCRZ 3CMAZ 1VQMZ 3MZLB 4NBFA 3CCSZ 2R93I 4E32A 2JNYA 5T6BA 1KQSY 1TWHI 3CQZI 1N2FA 1NP6A 1Y1VI 1Q811 4NBDA 2GTIA 4DQYB 4A93I 1YHQ1 4MRIA 1YI21 1M1K2 2E2HI 2RPRA 1W2BY 3I4NI 5D1OB 1X3ZA 1SFOI 1K9M2 2WAQA 3CMA1 4A3CI 2YADA 3VMIA 5C4JI 2O4HA 3CD61 1JWHC 4E31A 4NBHA 1KQSZ 4A3II 1QVGY 3LUSA 1KD11 1VQ61 1VQLZ 1RO2A 2VUMI 1I50I 2PMZA 3FQMA 2HF1A 1N8R2 2I3CA 1ML8A 2OTJ1 2JR6A 4A3KI 1K731 3G71Z 2QEXZ 4BY1I 1USPA 3HOUI 4MD9A 1Q861 1VQ6Z 1VQ8Z 1Q821 2QRDB 2PK7A 5IT9f 3CCL1 4A3BI 3CCUZ 1VLAA 3CC41 3CCM1 2W03A 1W2BZ 3I56Z 1Y1WI 4EWCA 1I3QI 3GTMS 4RV9A 2E9HA 3IFUA 5IP7I 1TWAI 4CL1A 3RZOI 4NBCA 3GTOI 3CC7Z 3CXCZ 3J80b 4MD8A 1KRLA 1VQ51 2GU2A 2DE5A 3CCJZ 2JS4A 4QTTA 3GTJI 2IZ3A 3I55Z 4HH4A 3JAMf 1S72Z 2Q4ZA 4NOZA 4BBRI 2V8IA 3CCVZ 2F4OA 3MONA 3G711 2QEX1 2P28A 3KIFA 2HU9A 1YIJ1 3CPWZ 3MZKB 2JMOA 3CCV1 2OTLZ 1X3WA 4X6AI 3CCEZ 5T64A 2BJOA 4AYBA 3QWUA 1Y1VS 3PO3S 1YJ91 4QTUA 3NDJA 2ZAEB 4BXXI 2RBLA 2EGTA 1YJ9Z 1VQK1 1YUAA 2OOXB 4DK1A 3GTPI 2R7ZI 1YITZ 3S2DI 2E2JI 2JA7I 1R9TI 4RVDA 3CCQZ 3CCU1 3S16I 2RHBA 2QKDA 3GKQA 1RO4A 2OTJZ 2F4MA 1ZB8A 4E33A 1WIIA 4TNUA 3HOVI 3EEDA 1K9M1 1VQ91 3I4MI 3NDIA 3I07A 3CMEZ 4A3JI 1YJN1 3RZDI 5C3EI 3GTGI 4RS4A 3BG0B 4A3EI 2JA5I 4RVFA 4HGZA 3VB9A 5C44I 4A3MI 4BBSI 1Q812 4A3LI 3JAMb 2Y0SA 3CXCY 1LQLA 1WW9A 5A2Qf 1VQN1 3NH5A 1L1OC 3BG1B 3S2HI 4BY7I 3F3PC 1DL6A 4DGLA 5IP9I 1VQP1 3GTQI 5AN9F 3CCQ1 3S1QI 3HKZA 2NVQI 2RIQA 2W04A 3S15I 3CCS1 1Q7Y2 4NBGA 4MD7A 1VQO1 3GTKI 3G6E1 1I6HI 1P9NA 1M1K1 1RQFA 1N8R1 5A2Qb 3ESWA 3FKII 4RVHA 2NVTI 2R6MA 3GCFA 1TWFI 3CCMZ 3CC4Z 4A3GI 4MH4A 2E2II 3D6WA 2YU9I 1Q7Y1 3HOZI 5LL6f 3HOYI 2LIYA 1NJI1 3D9XA 2WB1A 3F3FC 2QREB 3IF8A 4HGYA 4E2XA 1JJ2Z 3HOWI 2H85A 1YUKA 3FQQA 1VQM1 1TWCI 1YJWZ 2QA41 1RLYA 1VQ9Z 1K8A2 5CM2M 5D1OA 1USPB 2G2KA 1QVFZ 3S1RI 1KC81 3TE5B 1VQ81 4NBEA 2DE7A 1VQOZ 2NVXI 2QR1B 3NH8A 2J6AA 2M48A 2KPIA 1K83I 1VQ41 1S721 2R92I 3J81f 2JA6I 1Q862 4NH1C 3H0GI 4RVGA 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Z;  3CC2 Z;  1VQN 1;  3CD6 Z;  3G4S Z;  3CC7 1;  3CCL 1;  1VQ5 Z;  1VQN Z;  3CCU Z;  1VQP 1;  1KC8 2;  3CC4 1;  3CCE 1;  3CCM 1;  1W2B Z;  1JJ2 Y;  3I56 Z;  3CCQ 1;  3I56 1;  1K8A 1;  1VQ4 Z;  3CME 1;  3CCS 1;  2OTL 1;  1VQK Z;  1M90 1;  1YHQ Z;  1Q7Y 2;  3CC7 Z;  3CXC Z;  1YI2 Z;  3G4S 1;  1VQO 1;  1VQ5 1;  3G6E Z;  3CCJ Z;  1M90 2;  3G6E 1;  3I55 Z;  1M1K 1;  3CC2 1;  1S72 Z;  1QVG Z;  1YJW 1;  1N8R 1;  3CPW Y;  3CCV Z;  3G71 1;  2QEX 1;  3CCR Z;  1YIJ 1;  3CMA Z;  3CPW Z;  1VQM Z;  3CCV 1;  2OTL Z;  3CCS Z;  3OW2 Z;  3CCE Z;  3CCM Z;  3CC4 Z;  1KQS Y;  3I55 1;  1YIT 1;  1Q7Y 1;  1Q81 1;  1YJ9 1;  1NJI 1;  1YHQ 1;  1YJ9 Z;  1VQK 1;  1YI2 1;  1M1K 2;  1YIT Z;  1W2B Y;  1JJ2 Z;  1YJN Z;  1YIJ Z;  1K9M 2;  1VQM 1;  3CCQ Z;  3CCU 1;  3CMA 1;  2OTJ Z;  3CCL Z;  1Q82 2;  1YJW Z;  2QA4 1;  1VQ9 Z;  1K8A 2;  3CD6 1;  1VQL 1;  1KQS Z;  1QVF Z;  1QVG Y;  1KC8 1;  1K9M 1;  1K73 2;  1VQ8 1;  3CCJ 1;  1KD1 1;  1VQ6 1;  1VQL Z;  1VQ9 1;  1VQO Z;  2QA4 Z;  1QVF Y;  1N8R 2;  2OTJ 1;  3CME Z;  1KD1 2;  1K73 1;  1VQ7 Z;  3G71 Z;  2QEX Z;  1YJN 1;  1VQ7 1;  1NJI 2;  3OW2 Y;  3CCR 1;  1VQ4 1;  1Q81 2;  1S72 1;  1Q86 2;  3CXC Y;  1Q86 1;  1VQ6 Z;  1VQ8 Z;  1Q82 1; 
#chains in the Genus database with same CATH topology
 1VQP Z;  3CC2 Z;  2AKL A;  4NB8 A;  3G4S Z;  2DE6 A;  3CC7 1;  3KIH A;  2PM9 A;  1VQ5 Z;  3VMH A;  1ZH1 A;  1VQN Z;  3PO3 I;  1Z01 A;  2VPY A;  3J80 f;  1JJ2 Y;  2V45 A;  2QRC B;  3M3Y I;  1Z03 A;  3I56 1;  3CME 1;  2OTL 1;  3J7A 4;  3H3V J;  1VQK Z;  1M90 1;  2OOY B;  3T4N B;  2JIR A;  1YI2 Z;  3S14 I;  3G4S 1;  3K7A I;  3G6E Z;  1M90 2;  2K3R A;  3CC2 1;  3PO2 I;  1TFI A;  2JA8 I;  2VPW A;  2V8J A;  2KI7 B;  1RO0 A;  4A3F I;  3OW2 Z;  4S1T A;  3I55 1;  3NH4 A;  2IZ4 A;  1YIT 1;  3GTL I;  4E2W A;  1PFT A;  3Q87 A;  4NBA A;  4XX2 A;  4E30 A;  2O53 A;  3IX0 A;  1NUI A;  3J81 b;  3EER A;  1YJN Z;  2NVY I;  4Y52 I;  1QYP A;  2E7Z A;  2V8K A;  1YIJ Z;  1S7M A;  2LFU A;  1WCM I;  2VUG A;  3P5J B;  2QLV B;  3CCL Z;  1Q82 2;  5IT9 b;  1VQL 1;  5T67 A;  5FLX b;  4E2Y A;  1K73 2;  3CCJ 1;  3VMG A;  3HOX I;  2QA4 Z;  4NB9 A;  1QVF Y;  2Q51 A;  1KD1 2;  3M4O I;  1VQ7 Z;  1RNI A;  1VQ7 1;  2JIM A;  1NJI 2;  3OW2 Y;  2V3V A;  3CCR 1;  3S1N I;  3GTM I;  2K5R A;  2VPZ A;  2OZK A;  3CD6 Z;  4NFR A;  5D1P A;  4E2Z A;  3VTN A;  5FLM I;  2RT9 A;  2VF1 A;  1KC8 2;  3CCE 1;  4NBB A;  2JUB A;  4MON A;  3S17 I;  1TWG I;  1K8A 1;  1VQ4 Z;  4A3D I;  1X0T A;  2JIQ A;  2B63 I;  2P3Y A;  5C4X I;  1YHQ Z;  2GTH A;  1Y8C A;  3TDH B;  5FLX f;  3NFZ A;  3S1M I;  4Y7N I;  1Z02 A;  1ZB9 A;  3U50 C;  2M6N A;  1QVG Z;  1YJW 1;  4MXU A;  3CPW Y;  3CCR Z;  3CMA Z;  1VQM Z;  3MZL B;  4NBF A;  3CCS Z;  1WJ2 A;  2R93 I;  4E32 A;  2JNY A;  5T6B A;  1KQS Y;  1TWH I;  3CQZ I;  1N2F A;  1NP6 A;  1Y1V I;  1Q81 1;  4NBD A;  2GTI A;  4DQY B;  4A93 I;  2AYD A;  1YHQ 1;  4MRI A;  1YI2 1;  2LEX A;  1M1K 2;  2E2H I;  2RPR A;  1W2B Y;  3I4N I;  5D1O B;  1X3Z A;  1SFO I;  1K9M 2;  2WAQ A;  1AA6 A;  3CMA 1;  4A3C I;  2YAD A;  3VMI A;  5C4J I;  1QXF A;  2O4H A;  3CD6 1;  1JWH C;  4E31 A;  4NBH A;  1KQS Z;  4A3I I;  1QVG Y;  3LUS A;  1KD1 1;  1VQ6 1;  1VQL Z;  1RO2 A;  2VUM I;  1I50 I;  2PMZ A;  3FQM A;  2HF1 A;  1N8R 2;  2I3C A;  1ML8 A;  2OTJ 1;  2JR6 A;  4A3K I;  1K73 1;  3G71 Z;  2QEX Z;  4BY1 I;  1USP A;  3HOU I;  4MD9 A;  1Q86 1;  2JIO A;  1VQ6 Z;  1VQ8 Z;  1Q82 1;  1FDO A;  2QRD B;  2NAP A;  2PK7 A;  5IT9 f;  3CCL 1;  4A3B I;  3CCU Z;  1VLA A;  3CC4 1;  3CCM 1;  2W03 A;  1W2B Z;  3I56 Z;  1Y1W I;  4EWC A;  1I3Q I;  3GTM S;  4RV9 A;  2E9H A;  3IFU A;  5IP7 I;  1TWA I;  4CL1 A;  3RZO I;  4NBC A;  3GTO I;  3CC7 Z;  3CXC Z;  3J80 b;  4MD8 A;  1KRL A;  1VQ5 1;  2GU2 A;  2DE5 A;  3CCJ Z;  2JS4 A;  4QTT A;  3GTJ I;  2IZ3 A;  3I55 Z;  4HH4 A;  3JAM f;  1S72 Z;  2Q4Z A;  4NOZ A;  4BBR I;  2V8I A;  3CCV Z;  2F4O A;  3MON A;  3G71 1;  2QEX 1;  2P28 A;  3KIF A;  2HU9 A;  1YIJ 1;  3CPW Z;  3MZK B;  2JMO A;  3CCV 1;  2OTL Z;  1X3W A;  4X6A I;  3CCE Z;  5T64 A;  2JIP A;  2BJO A;  4AYB A;  3QWU A;  1Y1V S;  3PO3 S;  1YJ9 1;  4QTU A;  3NDJ A;  2ZAE B;  1FDI A;  4BXX I;  2RBL A;  2EGT A;  1YJ9 Z;  1VQK 1;  1YUA A;  2OOX B;  4DK1 A;  3GTP I;  2R7Z I;  1YIT Z;  3S2D I;  2E2J I;  2JA7 I;  1R9T I;  4RVD A;  3CCQ Z;  3CCU 1;  3S16 I;  2RHB A;  2QKD A;  3GKQ A;  1RO4 A;  2OTJ Z;  2F4M A;  1ZB8 A;  4E33 A;  1WII A;  4TNU A;  3HOV I;  3EED A;  1K9M 1;  1VQ9 1;  3I4M I;  3NDI A;  3I07 A;  3CME Z;  4A3J I;  1YJN 1;  3RZD I;  5C3E I;  3GTG I;  4RS4 A;  3BG0 B;  4A3E I;  2JA5 I;  4RVF A;  4HGZ A;  1SIW A;  3VB9 A;  5C44 I;  4A3M I;  4BBS I;  1Q81 2;  4A3L I;  3JAM b;  2Y0S A;  3CXC Y;  1LQL A;  1WW9 A;  5A2Q f;  1VQN 1;  3D2L A;  3NH5 A;  1L1O C;  3BG1 B;  3S2H I;  4BY7 I;  3F3P C;  1DL6 A;  4DGL A;  5IP9 I;  1VQP 1;  3GTQ I;  5AN9 F;  3CCQ 1;  3S1Q I;  3HKZ A;  2NVQ I;  2RIQ A;  2W04 A;  3S15 I;  3CCS 1;  1WZN A;  1Q7Y 2;  4NBG A;  4MD7 A;  1VQO 1;  3GTK I;  3G6E 1;  1I6H I;  1P9N A;  1M1K 1;  1Q16 A;  1RQF A;  1N8R 1;  5A2Q b;  3ESW A;  3FKI I;  4RVH A;  2NVT I;  2R6M A;  3GCF A;  2IV2 X;  1TWF I;  3CCM Z;  3CC4 Z;  4A3G I;  4MH4 A;  2E2I I;  3D6W A;  2YU9 I;  1Q7Y 1;  3HOZ I;  5LL6 f;  3HOY I;  2LIY A;  1NJI 1;  3D9X A;  2WB1 A;  3F3F C;  2VPX A;  2QRE B;  3IF8 A;  4HGY A;  4E2X A;  1JJ2 Z;  3HOW I;  2H85 A;  1YUK A;  3FQQ A;  1VQM 1;  1TWC I;  1YJW Z;  2QA4 1;  1RLY A;  1VQ9 Z;  1K8A 2;  5CM2 M;  5D1O A;  1USP B;  3IR7 A;  2G2K A;  1QVF Z;  3S1R I;  1KC8 1;  3TE5 B;  1VQ8 1;  4NBE A;  2DE7 A;  1VQO Z;  2NVX I;  2QR1 B;  3NH8 A;  2J6A A;  2M48 A;  2KPI A;  1K83 I;  1VQ4 1;  1S72 1;  2R92 I;  3J81 f;  2JA6 I;  1Q86 2;  4NH1 C;  3H0G I;  4RVG A;  1QF8 A; 
#chains in the Genus database with same CATH homology
 1VQP Z;  3CC2 Z;  2AKL A;  4NB8 A;  3G4S Z;  2DE6 A;  3CC7 1;  3KIH A;  2PM9 A;  1VQ5 Z;  3VMH A;  1ZH1 A;  1VQN Z;  3PO3 I;  1Z01 A;  3J80 f;  1JJ2 Y;  2QRC B;  3M3Y I;  1Z03 A;  3I56 1;  3CME 1;  2OTL 1;  3J7A 4;  3H3V J;  1VQK Z;  1M90 1;  2OOY B;  3T4N B;  1YI2 Z;  3S14 I;  3G4S 1;  3K7A I;  3G6E Z;  1M90 2;  2K3R A;  3CC2 1;  3PO2 I;  1TFI A;  2JA8 I;  2V8J A;  2KI7 B;  1RO0 A;  4A3F I;  3OW2 Z;  4S1T A;  3I55 1;  3NH4 A;  2IZ4 A;  1YIT 1;  3GTL I;  4E2W A;  1PFT A;  3Q87 A;  4NBA A;  4XX2 A;  4E30 A;  2O53 A;  3IX0 A;  1NUI A;  3J81 b;  3EER A;  1YJN Z;  2NVY I;  4Y52 I;  1QYP A;  2V8K A;  1YIJ Z;  1S7M A;  2LFU A;  1WCM I;  2VUG A;  3P5J B;  2QLV B;  3CCL Z;  1Q82 2;  5IT9 b;  1VQL 1;  5T67 A;  5FLX b;  4E2Y A;  1K73 2;  3CCJ 1;  3VMG A;  3HOX I;  2QA4 Z;  4NB9 A;  1QVF Y;  2Q51 A;  1KD1 2;  3M4O I;  1VQ7 Z;  1RNI A;  1VQ7 1;  1NJI 2;  3OW2 Y;  3CCR 1;  3S1N I;  3GTM I;  2K5R A;  2OZK A;  3CD6 Z;  4NFR A;  5D1P A;  4E2Z A;  3VTN A;  5FLM I;  2RT9 A;  2VF1 A;  1KC8 2;  3CCE 1;  4NBB A;  2JUB A;  4MON A;  3S17 I;  1TWG I;  1K8A 1;  1VQ4 Z;  4A3D I;  1X0T A;  2B63 I;  2P3Y A;  5C4X I;  1YHQ Z;  2GTH A;  3TDH B;  5FLX f;  3NFZ A;  3S1M I;  4Y7N I;  1Z02 A;  1ZB9 A;  3U50 C;  2M6N A;  1QVG Z;  1YJW 1;  4MXU A;  3CPW Y;  3CCR Z;  3CMA Z;  1VQM Z;  3MZL B;  4NBF A;  3CCS Z;  2R93 I;  4E32 A;  2JNY A;  5T6B A;  1KQS Y;  1TWH I;  3CQZ I;  1N2F A;  1NP6 A;  1Y1V I;  1Q81 1;  4NBD A;  2GTI A;  4DQY B;  4A93 I;  1YHQ 1;  4MRI A;  1YI2 1;  1M1K 2;  2E2H I;  2RPR A;  1W2B Y;  3I4N I;  5D1O B;  1X3Z A;  1SFO I;  1K9M 2;  2WAQ A;  3CMA 1;  4A3C I;  2YAD A;  3VMI A;  5C4J I;  2O4H A;  3CD6 1;  1JWH C;  4E31 A;  4NBH A;  1KQS Z;  4A3I I;  1QVG Y;  3LUS A;  1KD1 1;  1VQ6 1;  1VQL Z;  1RO2 A;  2VUM I;  1I50 I;  2PMZ A;  3FQM A;  2HF1 A;  1N8R 2;  2I3C A;  1ML8 A;  2OTJ 1;  2JR6 A;  4A3K I;  1K73 1;  3G71 Z;  2QEX Z;  4BY1 I;  1USP A;  3HOU I;  4MD9 A;  1Q86 1;  1VQ6 Z;  1VQ8 Z;  1Q82 1;  2QRD B;  2PK7 A;  5IT9 f;  3CCL 1;  4A3B I;  3CCU Z;  1VLA A;  3CC4 1;  3CCM 1;  2W03 A;  1W2B Z;  3I56 Z;  1Y1W I;  4EWC A;  1I3Q I;  3GTM S;  4RV9 A;  2E9H A;  3IFU A;  5IP7 I;  1TWA I;  4CL1 A;  3RZO I;  4NBC A;  3GTO I;  3CC7 Z;  3CXC Z;  3J80 b;  4MD8 A;  1KRL A;  1VQ5 1;  2GU2 A;  2DE5 A;  3CCJ Z;  2JS4 A;  4QTT A;  3GTJ I;  2IZ3 A;  3I55 Z;  4HH4 A;  3JAM f;  1S72 Z;  2Q4Z A;  4NOZ A;  4BBR I;  2V8I A;  3CCV Z;  2F4O A;  3MON A;  3G71 1;  2QEX 1;  2P28 A;  3KIF A;  2HU9 A;  1YIJ 1;  3CPW Z;  3MZK B;  2JMO A;  3CCV 1;  2OTL Z;  1X3W A;  4X6A I;  3CCE Z;  5T64 A;  2BJO A;  4AYB A;  3QWU A;  1Y1V S;  3PO3 S;  1YJ9 1;  4QTU A;  3NDJ A;  2ZAE B;  4BXX I;  2RBL A;  2EGT A;  1YJ9 Z;  1VQK 1;  1YUA A;  2OOX B;  4DK1 A;  3GTP I;  2R7Z I;  1YIT Z;  3S2D I;  2E2J I;  2JA7 I;  1R9T I;  4RVD A;  3CCQ Z;  3CCU 1;  3S16 I;  2RHB A;  2QKD A;  3GKQ A;  1RO4 A;  2OTJ Z;  2F4M A;  1ZB8 A;  4E33 A;  1WII A;  4TNU A;  3HOV I;  3EED A;  1K9M 1;  1VQ9 1;  3I4M I;  3NDI A;  3I07 A;  3CME Z;  4A3J I;  1YJN 1;  3RZD I;  5C3E I;  3GTG I;  4RS4 A;  3BG0 B;  4A3E I;  2JA5 I;  4RVF A;  4HGZ A;  3VB9 A;  5C44 I;  4A3M I;  4BBS I;  1Q81 2;  4A3L I;  3JAM b;  2Y0S A;  3CXC Y;  1LQL A;  1WW9 A;  5A2Q f;  1VQN 1;  3NH5 A;  1L1O C;  3BG1 B;  3S2H I;  4BY7 I;  3F3P C;  1DL6 A;  4DGL A;  5IP9 I;  1VQP 1;  3GTQ I;  5AN9 F;  3CCQ 1;  3S1Q I;  3HKZ A;  2NVQ I;  2RIQ A;  2W04 A;  3S15 I;  3CCS 1;  1Q7Y 2;  4NBG A;  4MD7 A;  1VQO 1;  3GTK I;  3G6E 1;  1I6H I;  1P9N A;  1M1K 1;  1RQF A;  1N8R 1;  5A2Q b;  3ESW A;  3FKI I;  4RVH A;  2NVT I;  2R6M A;  3GCF A;  1TWF I;  3CCM Z;  3CC4 Z;  4A3G I;  4MH4 A;  2E2I I;  3D6W A;  2YU9 I;  1Q7Y 1;  3HOZ I;  5LL6 f;  3HOY I;  2LIY A;  1NJI 1;  3D9X A;  2WB1 A;  3F3F C;  2QRE B;  3IF8 A;  4HGY A;  4E2X A;  1JJ2 Z;  3HOW I;  2H85 A;  1YUK A;  3FQQ A;  1VQM 1;  1TWC I;  1YJW Z;  2QA4 1;  1RLY A;  1VQ9 Z;  1K8A 2;  5CM2 M;  5D1O A;  1USP B;  2G2K A;  1QVF Z;  3S1R I;  1KC8 1;  3TE5 B;  1VQ8 1;  4NBE A;  2DE7 A;  1VQO Z;  2NVX I;  2QR1 B;  3NH8 A;  2J6A A;  2M48 A;  2KPI A;  1K83 I;  1VQ4 1;  1S72 1;  2R92 I;  3J81 f;  2JA6 I;  1Q86 2;  4NH1 C;  3H0G I;  4RVG A;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...