1M1K1

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k100
3CD61 3CCL1 3OW2Z 1VQ81 1YI21 1JJ2Y 3CCRZ 3CCVZ 1K9M1 1VQ6Z 1QVGY 3G71Z 1VQN1 3CCMZ 1Q861 3CC71 1VQPZ 1VQ91 1JJ2Z 1VQ8Z 1KD12 1NJI2 1YI2Z 3CCU1 1YITZ 2QA41 3G4S1 1W2BY 3CC2Z 1VQ5Z 3CCQ1 1QVFZ 2QEX1 1VQLZ 3I561 1M901 1S721 3CMAZ 1VQNZ 1VQO1 2OTJ1 3CME1 3G6E1 1Q811 1VQ9Z 1M1K1 1Q7Y2 3I55Z 1VQ41 1K8A1 2QA4Z 3CPWY 1VQ7Z 1K732 3CD6Z 3CCLZ 3CCQZ 1KQSY 1YJW1 2OTJZ 3CXCY 1Q862 3CCJ1 3CMEZ 1QVGZ 3CC41 3CPWZ 1VQ4Z 3CCE1 2OTL1 3CCS1 1Q821 1KC81 3CC7Z 1YJN1 1YIJ1 1W2BZ 1KD11 3CCJZ 1N8R1 1NJI1 3CCUZ 3G4SZ 3CCV1 1YHQ1 1K9M2 1YJ91 3CCEZ 3CCSZ 2QEXZ 3I56Z 3G711 1S72Z 1VQOZ 3CCM1 1VQK1 3G6EZ 1VQP1 1YJNZ 1Q7Y1 1YIJZ 1VQM1 1YIT1 1YHQZ 1KQSZ 1K731 1YJ9Z 3CC21 1Q822 3CXCZ 1VQ51 1M902 1YJWZ 1VQL1 3CMA1 1KC82 1QVFY 1VQKZ 1Q812 1M1K2 3CCR1 3OW2Y 3CC4Z 3I551 1VQ61 1N8R2 1K8A2 1VQMZ 2OTLZ 1VQ71
chains in the Genus database with same CATH superfamily
4RVGA 3OW2Z 4X6AI 4DK1A 4NBCA 3CCRZ 2I3CA 2VF1A 1USPB 4E33A 4E31A 1QVGY 3VMGA 1ZB9A 2P3YA 4E2ZA 3CC71 2VPYA 1VQPZ 4TNUA 2R92I 2JIMA 2VUGA 3G4S1 3S15I 4Y7NI 4A3KI 3S17I 3D9XA 1VQ5Z 4NBAA 1QYPA 1VQNZ 1M1K1 1Q7Y2 3S14I 1K8A1 3CPWY 3D2LA 3TDHB 4MD7A 3I07A 3CCQZ 3J81b 4A3EI 3PO3S 2VPWA 4NBDA 2F4OA 3CMEZ 2W03A 4A3FI 1Z01A 2JIOA 2HF1A 1RQFA 3BG1B 2LFUA 1RO2A 2RBLA 1W2BZ 3TE5B 3CCJZ 2LEXA 2WB1A 2Q51A 1YJ91 2QEXZ 3GTJI 3H3VJ 2NVXI 1VQOZ 4E2WA 4Y52I 1VQP1 3QWUA 4HGYA 2Y0SA 4MD9A 1NUIA 2G2KA 1YIJZ 3Q87A 4QTUA 3H0GI 2DE5A 5A2Qb 1I3QI 5D1PA 1VQ51 1YJWZ 2BJOA 1X3WA 3J81f 1Q812 5FLXb 5T67A 1VQ61 3NH5A 3EERA 2K3RA 2QREB 4A3MI 2EGTA 1RO4A 2KPIA 1ZH1A 1VQ81 5IP7I 3JAMf 1USPA 3M3YI 3NH8A 1K9M1 2JS4A 4BBSI 3M4OI 2OOYB 3G71Z 1TWFI 3GTMS 3S1NI 1VQ91 5FLMI 1JJ2Z 1RNIA 1KD12 2E2JI 1YI2Z 1RLYA 2QA41 1W2BY 4A3JI 4MXUA 2NVTI 2NVYI 4S1TA 1QVFZ 2QEX1 1M901 5A2Qf 4NB9A 3CMAZ 1VQO1 4DGLA 3S16I 2QKDA 2WAQA 3GKQA 2QRCB 4EWCA 3I55Z 1VQ41 2RT9A 4CL1A 4MD8A 4NOZA 1K732 2RPRA 3CD6Z 2GTHA 1YJW1 2JA8I 1I50I 4DQYB 4A93I 3GTMI 2OTJZ 2E7ZA 3FKII 2QR1B 2RIQA 4HH4A 3CCE1 2V3VA 3CCS1 4BY7I 3MONA 3F3FC 1Z03A 1WZNA 3S1QI 1KC81 4NB8A 1N2FA 2E9HA 1NJI1 2JUBA 1YHQ1 3VTNA 2IZ3A 4A3DI 5C3EI 1KRLA 1QXFA 3I56Z 3G711 4AYBA 1Y1VS 3G6EZ 3HOUI 3IFUA 1YJNZ 1DL6A 4RVFA 2V8JA 4RV9A 1VQM1 2O53A 3HOYI 3GCFA 1KQSZ 3S2DI 3LUSA 2YU9I 3U50C 1QF8A 3CMA1 1KC82 1SFOI 1QVFY 1VQKZ 1M1K2 4RVHA 2AYDA 3CCR1 3FQMA 3IR7A 3OW2Y 3GTOI 2IZ4A 3I551 1Y1WI 1K8A2 4MH4A 2QLVB 3GTLI 2OZKA 5T64A 2DE7A 3IX0A 3CD61 2LIYA 3RZOI 3S1MI 2F4MA 3GTQI 3NFZA 1JWHC 1Y1VI 3T4NB 4BBRI 2VUMI 1YUAA 3MZLB 1VQN1 1PFTA 3VMIA 5C4XI 1Q861 2PK7A 1I6HI 3HOWI 3IF8A 3MZKB 2B63I 1WW9A 2PMZA 1FDOA 3NDIA 3CCQ1 5D1OB 1VQLZ 3I561 1Y8CA 5T6BA 2RHBA 1LQLA 4QTTA 3CME1 3G6E1 3RZDI 2JIRA 2ZAEB 1Q16A 3VB9A 4E2XA 3VMHA 3J80b 2J6AA 2V8IA 3CCLZ 1KQSY 4NBGA 2VPZA 2JIPA 1Q862 3CCJ1 2NAPA 2JA7I 3CPWZ 3CQZI 3F3PC 1Q821 3HOXI 2YADA 2Q4ZA 2V8KA 4RVDA 3GTKI 4MONA 3HOZI 3FQQA 1YIJ1 5CM2M 4NH1C 5FLXf 3CCUZ 4XX2A 4A3II 2K5RA 1WCMI 3HKZA 1K9M2 2M48A 2JR6A 2R93I 3PO2I 2E2HI 1X0TA 5IT9b 1S7MA 1S72Z 4MRIA 3S1RI 1Q7Y1 4NBBA 3NDJA 4A3BI 1VLAA 1YJ9Z 2O4HA 3J80f 2H85A 1Q822 3CXCZ 3S2HI 1M902 1VQL1 1WJ2A 4NBFA 1SIWA 3CC4Z 4HGZA 4RS4A 2OTLZ 3NH4A 2V45A 4A3LI 3CCL1 3KIHA 1ZB8A 1L1OC 3P5JB 2HU9A 1P9NA 1WIIA 2DE6A 1YI21 1JJ2Y 2P28A 3CCVZ 2M6NA 1TWAI 1VQ6Z 1TWCI 5IP9I 1YUKA 2GU2A 2QRDB 3CCMZ 5IT9f 1VQ8Z 4NBHA 1NJI2 3CCU1 1YITZ 1R9TI 3ESWA 4A3GI 3CC2Z 5D1OA 2KI7B 5C4JI 3HOVI 2JNYA 4NBEA 2JIQA 1RO0A 2JA5I 1S721 2OTJ1 2R6MA 1Q811 2JA6I 1VQ9Z 3JAMb 2JMOA 4NFRA 2QA4Z 3GTGI 3GTPI 2R7ZI 1VQ7Z 3D6WA 1TFIA 2GTIA 1ML8A 4E32A 3EEDA 4BXXI 3CXCY 1QVGZ 2E2II 1K83I 1FDIA 4E2YA 5C44I 3CC41 1TWHI 2IV2X 3PO3I 3I4NI 1VQ4Z 2OTL1 1Z02A 1TWGI 3CC7Z 3I4MI 2W04A 2PM9A 1YJN1 3KIFA 2OOXB 1KD11 1N8R1 4BY1I 3G4SZ 3CCV1 3CCEZ 3CCSZ 3CCM1 1VQK1 4A3CI 1X3ZA 2VPXA 1YIT1 3K7AI 2NVQI 1YHQZ 1K731 3CC21 2AKLA 3BG0B 1NP6A 3J7A4 5AN9F 1N8R2 1VQMZ 5LL6f 1AA6A 4E30A 1VQ71
chains in the Genus database with same CATH topology
4RVGA 3OW2Z 4X6AI 4DK1A 4NBCA 3CCRZ 2I3CA 2VF1A 1USPB 4E33A 4E31A 1QVGY 3VMGA 1ZB9A 2P3YA 4E2ZA 3CC71 1VQPZ 4TNUA 2R92I 2VUGA 3G4S1 3S15I 4Y7NI 4A3KI 3S17I 3D9XA 1VQ5Z 4NBAA 1QYPA 1VQNZ 1M1K1 1Q7Y2 3S14I 1K8A1 3CPWY 3TDHB 4MD7A 3I07A 3CCQZ 3J81b 4A3EI 3PO3S 4NBDA 2F4OA 3CMEZ 2W03A 4A3FI 1Z01A 2HF1A 1RQFA 3BG1B 2LFUA 1RO2A 2RBLA 1W2BZ 3TE5B 3CCJZ 2WB1A 2Q51A 1YJ91 2QEXZ 3GTJI 3H3VJ 2NVXI 1VQOZ 4E2WA 4Y52I 1VQP1 3QWUA 4HGYA 2Y0SA 4MD9A 1NUIA 2G2KA 1YIJZ 3Q87A 4QTUA 3H0GI 2DE5A 5A2Qb 1I3QI 5D1PA 1VQ51 1YJWZ 2BJOA 1X3WA 3J81f 1Q812 5FLXb 5T67A 1VQ61 3NH5A 3EERA 2K3RA 2QREB 4A3MI 2EGTA 1RO4A 2KPIA 1ZH1A 1VQ81 5IP7I 3JAMf 1USPA 3M3YI 3NH8A 1K9M1 2JS4A 4BBSI 3M4OI 2OOYB 3G71Z 1TWFI 3GTMS 3S1NI 1VQ91 5FLMI 1JJ2Z 1RNIA 1KD12 2E2JI 1YI2Z 1RLYA 2QA41 1W2BY 4A3JI 4MXUA 2NVTI 2NVYI 4S1TA 1QVFZ 2QEX1 1M901 5A2Qf 4NB9A 3CMAZ 1VQO1 4DGLA 3S16I 2QKDA 2WAQA 3GKQA 2QRCB 4EWCA 3I55Z 1VQ41 2RT9A 4CL1A 4MD8A 4NOZA 1K732 2RPRA 3CD6Z 2GTHA 1YJW1 2JA8I 1I50I 4DQYB 4A93I 3GTMI 2OTJZ 3FKII 2QR1B 2RIQA 4HH4A 3CCE1 3CCS1 4BY7I 3MONA 3F3FC 1Z03A 3S1QI 1KC81 4NB8A 1N2FA 2E9HA 1NJI1 2JUBA 1YHQ1 3VTNA 2IZ3A 4A3DI 5C3EI 1KRLA 3I56Z 3G711 4AYBA 1Y1VS 3G6EZ 3HOUI 3IFUA 1YJNZ 1DL6A 4RVFA 2V8JA 4RV9A 1VQM1 2O53A 3HOYI 3GCFA 1KQSZ 3S2DI 3LUSA 2YU9I 3U50C 1QF8A 3CMA1 1KC82 1SFOI 1QVFY 1VQKZ 1M1K2 4RVHA 3CCR1 3OW2Y 3FQMA 3GTOI 2IZ4A 3I551 1Y1WI 1K8A2 4MH4A 2QLVB 3GTLI 2OZKA 5T64A 2DE7A 3IX0A 3CD61 2LIYA 3RZOI 3S1MI 2F4MA 3GTQI 3NFZA 1JWHC 1Y1VI 3T4NB 4BBRI 2VUMI 1YUAA 3MZLB 1VQN1 1PFTA 3VMIA 5C4XI 1Q861 2PK7A 1I6HI 3HOWI 3IF8A 3MZKB 2B63I 1WW9A 2PMZA 3NDIA 3CCQ1 5D1OB 1VQLZ 3I561 5T6BA 2RHBA 1LQLA 4QTTA 3CME1 3G6E1 3RZDI 2ZAEB 3VB9A 4E2XA 3VMHA 3J80b 2J6AA 2V8IA 3CCLZ 1KQSY 4NBGA 1Q862 3CCJ1 2JA7I 3CPWZ 3CQZI 3F3PC 1Q821 3HOXI 2YADA 2Q4ZA 2V8KA 4RVDA 3GTKI 4MONA 3HOZI 3FQQA 1YIJ1 5CM2M 4NH1C 5FLXf 3CCUZ 4XX2A 4A3II 2K5RA 1WCMI 3HKZA 1K9M2 2M48A 2JR6A 2R93I 3PO2I 2E2HI 1X0TA 5IT9b 1S7MA 1S72Z 4MRIA 3S1RI 1Q7Y1 4NBBA 3NDJA 4A3BI 1VLAA 1YJ9Z 2O4HA 3J80f 2H85A 1Q822 3CXCZ 3S2HI 1M902 1VQL1 4NBFA 3CC4Z 4HGZA 4RS4A 2OTLZ 3NH4A 4A3LI 3CCL1 3KIHA 1ZB8A 1L1OC 3P5JB 2HU9A 1P9NA 1WIIA 2DE6A 1YI21 1JJ2Y 2P28A 3CCVZ 2M6NA 1TWAI 1VQ6Z 1TWCI 5IP9I 1YUKA 2GU2A 2QRDB 3CCMZ 5IT9f 1VQ8Z 4NBHA 1NJI2 3CCU1 1YITZ 1R9TI 3ESWA 4A3GI 3CC2Z 5D1OA 2KI7B 5C4JI 3HOVI 2JNYA 4NBEA 1RO0A 2JA5I 1S721 2OTJ1 2R6MA 1Q811 2JA6I 1VQ9Z 3JAMb 2JMOA 4NFRA 2QA4Z 3GTGI 3GTPI 2R7ZI 1VQ7Z 3D6WA 1TFIA 2GTIA 1ML8A 4E32A 3EEDA 4BXXI 3CXCY 1QVGZ 2E2II 1K83I 3CC41 4E2YA 5C44I 3PO3I 1TWHI 3I4NI 1VQ4Z 2OTL1 1Z02A 1TWGI 3CC7Z 3I4MI 2W04A 2PM9A 1YJN1 3KIFA 2OOXB 1KD11 1N8R1 4BY1I 3G4SZ 3CCV1 3CCEZ 3CCSZ 3CCM1 1VQK1 4A3CI 1X3ZA 1YIT1 3K7AI 2NVQI 1YHQZ 1K731 3CC21 2AKLA 3BG0B 1NP6A 3J7A4 5AN9F 1N8R2 1VQMZ 5LL6f 4E30A 1VQ71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 1;  3CCL 1;  3OW2 Z;  1VQ8 1;  1YI2 1;  1JJ2 Y;  3CCR Z;  3CCV Z;  1K9M 1;  1VQ6 Z;  1QVG Y;  3G71 Z;  1VQN 1;  3CCM Z;  1Q86 1;  3CC7 1;  1VQP Z;  1VQ9 1;  1JJ2 Z;  1VQ8 Z;  1KD1 2;  1NJI 2;  1YI2 Z;  3CCU 1;  1YIT Z;  2QA4 1;  3G4S 1;  1W2B Y;  3CC2 Z;  1VQ5 Z;  3CCQ 1;  1QVF Z;  2QEX 1;  1VQL Z;  3I56 1;  1M90 1;  1S72 1;  3CMA Z;  1VQN Z;  1VQO 1;  2OTJ 1;  3CME 1;  3G6E 1;  1Q81 1;  1VQ9 Z;  1M1K 1;  1Q7Y 2;  3I55 Z;  1VQ4 1;  1K8A 1;  2QA4 Z;  3CPW Y;  1VQ7 Z;  1K73 2;  3CD6 Z;  3CCL Z;  3CCQ Z;  1KQS Y;  1YJW 1;  2OTJ Z;  3CXC Y;  1Q86 2;  3CCJ 1;  3CME Z;  1QVG Z;  3CC4 1;  3CPW Z;  1VQ4 Z;  3CCE 1;  2OTL 1;  3CCS 1;  1Q82 1;  1KC8 1;  3CC7 Z;  1YJN 1;  1YIJ 1;  1W2B Z;  1KD1 1;  3CCJ Z;  1N8R 1;  1NJI 1;  3CCU Z;  3G4S Z;  3CCV 1;  1YHQ 1;  1K9M 2;  1YJ9 1;  3CCE Z;  3CCS Z;  2QEX Z;  3I56 Z;  3G71 1;  1S72 Z;  1VQO Z;  3CCM 1;  1VQK 1;  3G6E Z;  1VQP 1;  1YJN Z;  1Q7Y 1;  1YIJ Z;  1VQM 1;  1YIT 1;  1YHQ Z;  1KQS Z;  1K73 1;  1YJ9 Z;  3CC2 1;  1Q82 2;  3CXC Z;  1VQ5 1;  1M90 2;  1YJW Z;  1VQL 1;  3CMA 1;  1KC8 2;  1QVF Y;  1VQK Z;  1Q81 2;  1M1K 2;  3CCR 1;  3OW2 Y;  3CC4 Z;  3I55 1;  1VQ6 1;  1N8R 2;  1K8A 2;  1VQM Z;  2OTL Z;  1VQ7 1; 
#chains in the Genus database with same CATH topology
 4RVG A;  3OW2 Z;  4X6A I;  4DK1 A;  4NBC A;  3CCR Z;  2I3C A;  2VF1 A;  1USP B;  4E33 A;  4E31 A;  1QVG Y;  3VMG A;  1ZB9 A;  2P3Y A;  4E2Z A;  3CC7 1;  2VPY A;  1VQP Z;  4TNU A;  2R92 I;  2JIM A;  2VUG A;  3G4S 1;  3S15 I;  4Y7N I;  4A3K I;  3S17 I;  3D9X A;  1VQ5 Z;  4NBA A;  1QYP A;  1VQN Z;  1M1K 1;  1Q7Y 2;  3S14 I;  1K8A 1;  3CPW Y;  3D2L A;  3TDH B;  4MD7 A;  3I07 A;  3CCQ Z;  3J81 b;  4A3E I;  3PO3 S;  2VPW A;  4NBD A;  2F4O A;  3CME Z;  2W03 A;  4A3F I;  1Z01 A;  2JIO A;  2HF1 A;  1RQF A;  3BG1 B;  2LFU A;  1RO2 A;  2RBL A;  1W2B Z;  3TE5 B;  3CCJ Z;  2LEX A;  2WB1 A;  2Q51 A;  1YJ9 1;  2QEX Z;  3GTJ I;  3H3V J;  2NVX I;  1VQO Z;  4E2W A;  4Y52 I;  1VQP 1;  3QWU A;  4HGY A;  2Y0S A;  4MD9 A;  1NUI A;  2G2K A;  1YIJ Z;  3Q87 A;  4QTU A;  3H0G I;  2DE5 A;  5A2Q b;  1I3Q I;  5D1P A;  1VQ5 1;  1YJW Z;  2BJO A;  1X3W A;  3J81 f;  1Q81 2;  5FLX b;  5T67 A;  1VQ6 1;  3NH5 A;  3EER A;  2K3R A;  2QRE B;  4A3M I;  2EGT A;  1RO4 A;  2KPI A;  1ZH1 A;  1VQ8 1;  5IP7 I;  3JAM f;  1USP A;  3M3Y I;  3NH8 A;  1K9M 1;  2JS4 A;  4BBS I;  3M4O I;  2OOY B;  3G71 Z;  1TWF I;  3GTM S;  3S1N I;  1VQ9 1;  5FLM I;  1JJ2 Z;  1RNI A;  1KD1 2;  2E2J I;  1YI2 Z;  1RLY A;  2QA4 1;  1W2B Y;  4A3J I;  4MXU A;  2NVT I;  2NVY I;  4S1T A;  1QVF Z;  2QEX 1;  1M90 1;  5A2Q f;  4NB9 A;  3CMA Z;  1VQO 1;  4DGL A;  3S16 I;  2QKD A;  2WAQ A;  3GKQ A;  2QRC B;  4EWC A;  3I55 Z;  1VQ4 1;  2RT9 A;  4CL1 A;  4MD8 A;  4NOZ A;  1K73 2;  2RPR A;  3CD6 Z;  2GTH A;  1YJW 1;  2JA8 I;  1I50 I;  4DQY B;  4A93 I;  3GTM I;  2OTJ Z;  2E7Z A;  3FKI I;  2QR1 B;  2RIQ A;  4HH4 A;  3CCE 1;  2V3V A;  3CCS 1;  4BY7 I;  3MON A;  3F3F C;  1Z03 A;  1WZN A;  3S1Q I;  1KC8 1;  4NB8 A;  1N2F A;  2E9H A;  1NJI 1;  2JUB A;  1YHQ 1;  3VTN A;  2IZ3 A;  4A3D I;  5C3E I;  1KRL A;  1QXF A;  3I56 Z;  3G71 1;  4AYB A;  1Y1V S;  3G6E Z;  3HOU I;  3IFU A;  1YJN Z;  1DL6 A;  4RVF A;  2V8J A;  4RV9 A;  1VQM 1;  2O53 A;  3HOY I;  3GCF A;  1KQS Z;  3S2D I;  3LUS A;  2YU9 I;  3U50 C;  1QF8 A;  3CMA 1;  1KC8 2;  1SFO I;  1QVF Y;  1VQK Z;  1M1K 2;  4RVH A;  2AYD A;  3CCR 1;  3FQM A;  3IR7 A;  3OW2 Y;  3GTO I;  2IZ4 A;  3I55 1;  1Y1W I;  1K8A 2;  4MH4 A;  2QLV B;  3GTL I;  2OZK A;  5T64 A;  2DE7 A;  3IX0 A;  3CD6 1;  2LIY A;  3RZO I;  3S1M I;  2F4M A;  3GTQ I;  3NFZ A;  1JWH C;  1Y1V I;  3T4N B;  4BBR I;  2VUM I;  1YUA A;  3MZL B;  1VQN 1;  1PFT A;  3VMI A;  5C4X I;  1Q86 1;  2PK7 A;  1I6H I;  3HOW I;  3IF8 A;  3MZK B;  2B63 I;  1WW9 A;  2PMZ A;  1FDO A;  3NDI A;  3CCQ 1;  5D1O B;  1VQL Z;  3I56 1;  1Y8C A;  5T6B A;  2RHB A;  1LQL A;  4QTT A;  3CME 1;  3G6E 1;  3RZD I;  2JIR A;  2ZAE B;  1Q16 A;  3VB9 A;  4E2X A;  3VMH A;  3J80 b;  2J6A A;  2V8I A;  3CCL Z;  1KQS Y;  4NBG A;  2VPZ A;  2JIP A;  1Q86 2;  3CCJ 1;  2NAP A;  2JA7 I;  3CPW Z;  3CQZ I;  3F3P C;  1Q82 1;  3HOX I;  2YAD A;  2Q4Z A;  2V8K A;  4RVD A;  3GTK I;  4MON A;  3HOZ I;  3FQQ A;  1YIJ 1;  5CM2 M;  4NH1 C;  5FLX f;  3CCU Z;  4XX2 A;  4A3I I;  2K5R A;  1WCM I;  3HKZ A;  1K9M 2;  2M48 A;  2JR6 A;  2R93 I;  3PO2 I;  2E2H I;  1X0T A;  5IT9 b;  1S7M A;  1S72 Z;  4MRI A;  3S1R I;  1Q7Y 1;  4NBB A;  3NDJ A;  4A3B I;  1VLA A;  1YJ9 Z;  2O4H A;  3J80 f;  2H85 A;  1Q82 2;  3CXC Z;  3S2H I;  1M90 2;  1VQL 1;  1WJ2 A;  4NBF A;  1SIW A;  3CC4 Z;  4HGZ A;  4RS4 A;  2OTL Z;  3NH4 A;  2V45 A;  4A3L I;  3CCL 1;  3KIH A;  1ZB8 A;  1L1O C;  3P5J B;  2HU9 A;  1P9N A;  1WII A;  2DE6 A;  1YI2 1;  1JJ2 Y;  2P28 A;  3CCV Z;  2M6N A;  1TWA I;  1VQ6 Z;  1TWC I;  5IP9 I;  1YUK A;  2GU2 A;  2QRD B;  3CCM Z;  5IT9 f;  1VQ8 Z;  4NBH A;  1NJI 2;  3CCU 1;  1YIT Z;  1R9T I;  3ESW A;  4A3G I;  3CC2 Z;  5D1O A;  2KI7 B;  5C4J I;  3HOV I;  2JNY A;  4NBE A;  2JIQ A;  1RO0 A;  2JA5 I;  1S72 1;  2OTJ 1;  2R6M A;  1Q81 1;  2JA6 I;  1VQ9 Z;  3JAM b;  2JMO A;  4NFR A;  2QA4 Z;  3GTG I;  3GTP I;  2R7Z I;  1VQ7 Z;  3D6W A;  1TFI A;  2GTI A;  1ML8 A;  4E32 A;  3EED A;  4BXX I;  3CXC Y;  1QVG Z;  2E2I I;  1K83 I;  1FDI A;  4E2Y A;  5C44 I;  3CC4 1;  1TWH I;  2IV2 X;  3PO3 I;  3I4N I;  1VQ4 Z;  2OTL 1;  1Z02 A;  1TWG I;  3CC7 Z;  3I4M I;  2W04 A;  2PM9 A;  1YJN 1;  3KIF A;  2OOX B;  1KD1 1;  1N8R 1;  4BY1 I;  3G4S Z;  3CCV 1;  3CCE Z;  3CCS Z;  3CCM 1;  1VQK 1;  4A3C I;  1X3Z A;  2VPX A;  1YIT 1;  3K7A I;  2NVQ I;  1YHQ Z;  1K73 1;  3CC2 1;  2AKL A;  3BG0 B;  1NP6 A;  3J7A 4;  5AN9 F;  1N8R 2;  1VQM Z;  5LL6 f;  1AA6 A;  4E30 A;  1VQ7 1; 
#chains in the Genus database with same CATH homology
 4RVG A;  3OW2 Z;  4X6A I;  4DK1 A;  4NBC A;  3CCR Z;  2I3C A;  2VF1 A;  1USP B;  4E33 A;  4E31 A;  1QVG Y;  3VMG A;  1ZB9 A;  2P3Y A;  4E2Z A;  3CC7 1;  1VQP Z;  4TNU A;  2R92 I;  2VUG A;  3G4S 1;  3S15 I;  4Y7N I;  4A3K I;  3S17 I;  3D9X A;  1VQ5 Z;  4NBA A;  1QYP A;  1VQN Z;  1M1K 1;  1Q7Y 2;  3S14 I;  1K8A 1;  3CPW Y;  3TDH B;  4MD7 A;  3I07 A;  3CCQ Z;  3J81 b;  4A3E I;  3PO3 S;  4NBD A;  2F4O A;  3CME Z;  2W03 A;  4A3F I;  1Z01 A;  2HF1 A;  1RQF A;  3BG1 B;  2LFU A;  1RO2 A;  2RBL A;  1W2B Z;  3TE5 B;  3CCJ Z;  2WB1 A;  2Q51 A;  1YJ9 1;  2QEX Z;  3GTJ I;  3H3V J;  2NVX I;  1VQO Z;  4E2W A;  4Y52 I;  1VQP 1;  3QWU A;  4HGY A;  2Y0S A;  4MD9 A;  1NUI A;  2G2K A;  1YIJ Z;  3Q87 A;  4QTU A;  3H0G I;  2DE5 A;  5A2Q b;  1I3Q I;  5D1P A;  1VQ5 1;  1YJW Z;  2BJO A;  1X3W A;  3J81 f;  1Q81 2;  5FLX b;  5T67 A;  1VQ6 1;  3NH5 A;  3EER A;  2K3R A;  2QRE B;  4A3M I;  2EGT A;  1RO4 A;  2KPI A;  1ZH1 A;  1VQ8 1;  5IP7 I;  3JAM f;  1USP A;  3M3Y I;  3NH8 A;  1K9M 1;  2JS4 A;  4BBS I;  3M4O I;  2OOY B;  3G71 Z;  1TWF I;  3GTM S;  3S1N I;  1VQ9 1;  5FLM I;  1JJ2 Z;  1RNI A;  1KD1 2;  2E2J I;  1YI2 Z;  1RLY A;  2QA4 1;  1W2B Y;  4A3J I;  4MXU A;  2NVT I;  2NVY I;  4S1T A;  1QVF Z;  2QEX 1;  1M90 1;  5A2Q f;  4NB9 A;  3CMA Z;  1VQO 1;  4DGL A;  3S16 I;  2QKD A;  2WAQ A;  3GKQ A;  2QRC B;  4EWC A;  3I55 Z;  1VQ4 1;  2RT9 A;  4CL1 A;  4MD8 A;  4NOZ A;  1K73 2;  2RPR A;  3CD6 Z;  2GTH A;  1YJW 1;  2JA8 I;  1I50 I;  4DQY B;  4A93 I;  3GTM I;  2OTJ Z;  3FKI I;  2QR1 B;  2RIQ A;  4HH4 A;  3CCE 1;  3CCS 1;  4BY7 I;  3MON A;  3F3F C;  1Z03 A;  3S1Q I;  1KC8 1;  4NB8 A;  1N2F A;  2E9H A;  1NJI 1;  2JUB A;  1YHQ 1;  3VTN A;  2IZ3 A;  4A3D I;  5C3E I;  1KRL A;  3I56 Z;  3G71 1;  4AYB A;  1Y1V S;  3G6E Z;  3HOU I;  3IFU A;  1YJN Z;  1DL6 A;  4RVF A;  2V8J A;  4RV9 A;  1VQM 1;  2O53 A;  3HOY I;  3GCF A;  1KQS Z;  3S2D I;  3LUS A;  2YU9 I;  3U50 C;  1QF8 A;  3CMA 1;  1KC8 2;  1SFO I;  1QVF Y;  1VQK Z;  1M1K 2;  4RVH A;  3CCR 1;  3OW2 Y;  3FQM A;  3GTO I;  2IZ4 A;  3I55 1;  1Y1W I;  1K8A 2;  4MH4 A;  2QLV B;  3GTL I;  2OZK A;  5T64 A;  2DE7 A;  3IX0 A;  3CD6 1;  2LIY A;  3RZO I;  3S1M I;  2F4M A;  3GTQ I;  3NFZ A;  1JWH C;  1Y1V I;  3T4N B;  4BBR I;  2VUM I;  1YUA A;  3MZL B;  1VQN 1;  1PFT A;  3VMI A;  5C4X I;  1Q86 1;  2PK7 A;  1I6H I;  3HOW I;  3IF8 A;  3MZK B;  2B63 I;  1WW9 A;  2PMZ A;  3NDI A;  3CCQ 1;  5D1O B;  1VQL Z;  3I56 1;  5T6B A;  2RHB A;  1LQL A;  4QTT A;  3CME 1;  3G6E 1;  3RZD I;  2ZAE B;  3VB9 A;  4E2X A;  3VMH A;  3J80 b;  2J6A A;  2V8I A;  3CCL Z;  1KQS Y;  4NBG A;  1Q86 2;  3CCJ 1;  2JA7 I;  3CPW Z;  3CQZ I;  3F3P C;  1Q82 1;  3HOX I;  2YAD A;  2Q4Z A;  2V8K A;  4RVD A;  3GTK I;  4MON A;  3HOZ I;  3FQQ A;  1YIJ 1;  5CM2 M;  4NH1 C;  5FLX f;  3CCU Z;  4XX2 A;  4A3I I;  2K5R A;  1WCM I;  3HKZ A;  1K9M 2;  2M48 A;  2JR6 A;  2R93 I;  3PO2 I;  2E2H I;  1X0T A;  5IT9 b;  1S7M A;  1S72 Z;  4MRI A;  3S1R I;  1Q7Y 1;  4NBB A;  3NDJ A;  4A3B I;  1VLA A;  1YJ9 Z;  2O4H A;  3J80 f;  2H85 A;  1Q82 2;  3CXC Z;  3S2H I;  1M90 2;  1VQL 1;  4NBF A;  3CC4 Z;  4HGZ A;  4RS4 A;  2OTL Z;  3NH4 A;  4A3L I;  3CCL 1;  3KIH A;  1ZB8 A;  1L1O C;  3P5J B;  2HU9 A;  1P9N A;  1WII A;  2DE6 A;  1YI2 1;  1JJ2 Y;  2P28 A;  3CCV Z;  2M6N A;  1TWA I;  1VQ6 Z;  1TWC I;  5IP9 I;  1YUK A;  2GU2 A;  2QRD B;  3CCM Z;  5IT9 f;  1VQ8 Z;  4NBH A;  1NJI 2;  3CCU 1;  1YIT Z;  1R9T I;  3ESW A;  4A3G I;  3CC2 Z;  5D1O A;  2KI7 B;  5C4J I;  3HOV I;  2JNY A;  4NBE A;  1RO0 A;  2JA5 I;  1S72 1;  2OTJ 1;  2R6M A;  1Q81 1;  2JA6 I;  1VQ9 Z;  3JAM b;  2JMO A;  4NFR A;  2QA4 Z;  3GTG I;  3GTP I;  2R7Z I;  1VQ7 Z;  3D6W A;  1TFI A;  2GTI A;  1ML8 A;  4E32 A;  3EED A;  4BXX I;  3CXC Y;  1QVG Z;  2E2I I;  1K83 I;  3CC4 1;  4E2Y A;  5C44 I;  3PO3 I;  1TWH I;  3I4N I;  1VQ4 Z;  2OTL 1;  1Z02 A;  1TWG I;  3CC7 Z;  3I4M I;  2W04 A;  2PM9 A;  1YJN 1;  3KIF A;  2OOX B;  1KD1 1;  1N8R 1;  4BY1 I;  3G4S Z;  3CCV 1;  3CCE Z;  3CCS Z;  3CCM 1;  1VQK 1;  4A3C I;  1X3Z A;  1YIT 1;  3K7A I;  2NVQ I;  1YHQ Z;  1K73 1;  3CC2 1;  2AKL A;  3BG0 B;  1NP6 A;  3J7A 4;  5AN9 F;  1N8R 2;  1VQM Z;  5LL6 f;  4E30 A;  1VQ7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...