3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting/DNA response regulator
publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Dna binding protein
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
2EOTA 1SAPA 2E2II 1VMCA 4RAUC 1CA6A 3MTSA 1TFIA 1Y1VI 4BY7I 2D9UA 4NB9A 1L1OC 3ESWA 4XX2A 3F2UA 2X6GA 3GTGI 2NVXI 3I4NI 2RSNA 3IL8A 5T1IA 1F9QA 2B2YA 1G6ZA 2X69A 2B2WA 3S1RI 2BDNA 5EJWA 1IKLA 3S1MI 1X3ZA 3HOYI 4XT3B 1WTOA 1ML0D 5C4XI 3S2HI 1O7ZA 3S1NI 1USPA 1SDFA 4NBEA 1NAPA 2L9HA 3RZOI 1EQTA 1N2FA 2K05A 1SFOI 1RO4A 4A3BI 3HOXI 2KEEA 3R93A 4XDXA 4XT1B 2NWGA 4IURA 1WW9A 2JA8I 3DEPA 3MWYW 1NR4A 2KVMA 4NW2A 1VMPA 1G2SA 1PLFA 3HOWI 1U4LA 2L1BA 1ILPA 5EPKA 5EPJA 1WTWA 1ML8A 3SVMA 1HRJA 3RZDI 1B50A 2KECA 4HCSA 1QNKA 4X6AI 3G7LA 1WTPA 1EOTA 3GTOI 5E4WC 1YUAA 2FINB 5CM2M 5DNFA 1Q3LA 1HUNA 1J9OA 2K01A 1X3QA 2RA4A 2CVRA 3EERA 2B2UC 2FMMA 4X3KA 1QE6A 2K5RA 1S4ZA 3GV6A 4HSVA 2NVYI 5EQ0A 2IL8A 3FDTA 3Q87A 1HUMA 3S2DI 2HDMA 3I3CA 3D6WA 3GCFA 4NBHA 4ZAIA 4A3JI 2B63I 1KNAA 1B3AA 1RJTA 3S15I 1EIGA 5EPLA 1AZPA 3VB9A 1DL6A 1ILQA 2HF1A 1CM9A 1PFBA 1XYIA 3VMGA 4A3KI 1SSOA 5CBAE 4UAIA 4NBBA 4ZKBB 2FJ2A 5EKIA 1XX8A 2B2TA 1RHPA 4CJ0B 4QUCA 2AKLA 2SDFA 4ZLTF 3K7AI 3GTJI 4MH4A 2JA6I 4A3MI 1EL0A 2JA7I 1DOLA 1NUIA 1JE4A 3TN2A 3M4OI 4A3II 1LQLA 2HCCA 3HOVI 1BBXC 1X32A 1QYPA 4A3CI 1Y1WI 3ONAB 3N52A 3CQZI 2L4NA 3VMIA 5T1GA 1ZB9A 1TWCI 1PFMA 2MGSA 1DOKA 2H1EA 3I91A 3GTLI 3H91A 1TWAI 2PK7A 4HAEA 3I8ZA 4A3EI 3U50C 2E2JI 4QTUA 2P3YA 4QTTA 1BNZA 4MN3A 2N88A 2J7ZA 4R9WA 1QG7A 1IL8A 5CORA 2K1BA 3H3VJ 1TWFI 1JICA 1CA5A 3LWEA 3KUPA 4NBGA 4IUPA 2Q8RE 1F9SA 1WVLA 1GUWA 3DEOA 1G91A 1WCMI 1O80A 4OIKA 3TZDA 3I4MI 2DY8A 3P7JA 1WTRA 1AZQA 4ZKCB 1R9TI 1IKMA 5CBEE 3FKII 4X3SA 3LUSA 3GTPI 3QO2A 2JP1A 2RVLA 2DE5A 2B2VC 3DM1A 1G2TA 4BBSI 2K04A 2R93I 2KEDA 1ZB8A 1F9PA 1BO0A 1WTXA 4LMQD 1B53A 2R92I 3HOUI 1BF4A 5IP7I 2L12A 1EIHA 2NVQI 1HFGA 4A93I 2NZ1D 1HFNA 1PFNA 4A3GI 5AFWA 3GTKI 2B2YC 2VUMI 3IFDA 2JA5I 1PFTA 4O42A 1WTQA 2B2WC 3S17I 1X3WA 1MI2A 4A3LI 2XIWA 1X3PA 1B4OA 2RSOA 2EE1A 4QUFA 3GTMS 3GKQA 4X3TA 5D65A 4NB8A 2EPBA 2B2UA 4RA8A 2BJOA 3PO3S 4A3FI 1WD0A 3PO2I 5CMDA 2NYZD 1WD1A 4Y7NI 4X3UA 3Q6SA 2K28A 5IP9I 1I50I 2E2HI 4ZK9B 2FFKB 4IUVA 1Y1VS 5FLMI 3UI2A 5D14A 1TVXA 2R7ZI 1I6HI 4NOZA 5COYA 3FPUB 2MJ8A 5C44I 1MSHA 2KOLA 2JR6A 1I3QI 1NR2A 1VLAA 1O7YA 2L11A 2MP1A 2K03A 2JYOA 2N55A 1K83I 3H0GI 2F4OA 4NBFA 1TWGI 1LV9A 4Y52I 4MHEA 5C3EI 4OIJA 1F9RA 4A3DI 2J6AA 3I90A 2YU9I 2RBLA 5JJZA 2HDLA 1ICWA 2DY7A 1RTOA 4IUQA 1DOMA 3HOZI 1RLYA 1NCVA 4NBAA 1DONA 4NBCA 1ZXTA 3M3YI 3VMHA 1DZ1A 5C4JI 4BY1I 1AP0A 3S1QI 1ESRA 1MGSA 2KUMA 3GV3A 1A15A 1USPB 4HEDA 1B2TA 4RWSC 1C8CA 1F2LA 4NBDA 2M2LA 3GTQI 2F4MA 4IUUA 5E4XA 1RTNA 3S14I 2NVTI 4CJ1B 1PDQA 2KPIA 1HHVA 4IUTA 1MSGA 2FHTA 4DN4M 2B2TC 1J8IA 2JNYA 1KNEA 1RODA 4BXXI 3GTMI 3KBXA 1E0BA 1M8AA 1HA6A 4BBRI 2HUGA 2MPMA 2VXWA 2Q8TA 2HCIA 3PO3I 3I07A 2X6LA 2DE6A 2JS4A 2R3ZA 4U68A 1WTVA 2B2VA 4R8IA 3HP3A 1U4MA 1U4RA 4CJ2C 1U4PA 2DE7A 3S16I 1TWHI
chains in the Genus database with same CATH superfamily
2HD3A 4NFRA 5D1OB 2E2II 3L0OA 1IZ6A 2JIPA 4A3KH 1UAPA 4KKTA 2VUMG 1U5KA 3K0XA 3SE0A 2F0VA 4LF7L 4R1JA 5M5XB 4DK6C 1IBLL 3VYRA 2NVXI 2F0OA 2F0QA 2RSNA 1NSNS 1QUQB 4L5RC 2B2YA 3CMA1 2EXDA 1EZ8A 3JAMf 1SMYC 5IT9E 3ULJA 3EEDA 2LXKA 4ZUJA 4A3IH 2IX1A 3T4AC 4ODGA 1O7ZA 4A3FG 2K5DA 5J22A 1I50H 2HQLA 2QA4Z 1SMXA 3NEMA 1C9OA 2EXZA 1NAPA 4J15A 1SR3A 2QW7A 4A75A 1HNWL 4V0BA 1VQLZ 4LK1C 2CCZA 2K05A 3M7GA 5JPMC 4A3BI 2KEEA 4XT1B 3J81E 1Q86C 2JEAI 2NWGA 1A3UA 1IBKQ 2WB1G 2XWJB 4PV1C 3SHLA 1UEBA 3J81i 2A6HC 1YJ9Z 4HGZA 3DEPA 3RLOA 1CTMA 2OF1A 1A63A 2KBNA 4NW2A 4ALPA 1U4LA 1TY2A 5C44G 4G7HC 1DCZA 2YTYA 2E2DC 1ILPA 4K5VA 2G9DA 2LFNA 1I4GA 4AYBG 5JJLA 2JA6B 1FDIA 1Z01A 2DUDA 1TWFH 3GO5A 1Z6HA 5D3IB 1KRLA 4LWCA 4MZ9A 4QCLA 5K36H 1SRUA 3NP8A 4A3DH 4BS9A 3S2HB 2NUCA 3SK4A 1LTID 1UE5A 5BN3A 1XPRA 3RZDI 2VPXA 2KECA 2F3IA 4X6AI 1QZHA 1EOTA 4YWKA 2VUGA 1AEXA 2UUCQ 2NZHA 2YYZA 3FKIH 4BA2I 1LO5D 1H9KA 1Q3LA 4UY8C 4JI2Q 3J81c 1X3QA 3HOZG 2D62A 2CVRA 1K73C 3QR8A 3RNUA 4E32A 1OXVA 4OEMB 4A3EB 4JOIC 2FMMA 2NTSA 3MZ5A 3TS2A 3CCU1 3A56A 4KKUA 3GTQH 2R92H 1S4ZA 5IP7H 4DR5L 1VQ61 3EROA 4OELB 3NUCA 1OXTA 1BBWA 1JCKB 2NVQH 1JWSD 1TWFB 2IL8A 1KAWA 3I3CA 1Z47A 1NTGA 4LUZA 1EWIA 2EYHA 3OMGA 3EIVA 1S721 3EN2A 5E7NA 2VUMH 2F0KA 1B3AA 1WCMB 3A8IE 3NK9A 2Z4IA 4E31A 4UP7A 5FKAC 3S15I 3SEBA 1Q822 1EIGA 1HNXL 1K0SA 1STHA 4B3RQ 2LEXA 3FPPA 1KD12 4G4KA 4H02A 1UE6A 4XYQA 1STNA 1LT3D 1CM9A 4M8AA 5FOBB 1XYIA 5JJKA 4CDDC 2JIQA 1JMCA 5JEAJ 1GUTA 1TKWB 1VQ4A 2C5CA 5KIXA 1M1K2 1K28A 4IQZA 3KDFB 5EKIA 4A3FH 1PRTD 2NVYB 2QKIC 4DAYB 3BDLA 4E2XA 2EYMA 3CPWZ 2I5MX 1Y8CA 4P75A 1JB3A 4LF6Q 4U673 3R8BA 3GTJI 3PSIA 1M90C 4OWWB 4JC0A 3J81L 1VQ6A 3OTOL 5IYBH 3TN2A 2XWBB 1QXFA 1EY4A 3I561 4OO1H 1GKHA 2HCCA 3CCEZ 3HOVI 3PUYA 1B9MA 1S5ED 1X32A 2VUMB 4ZYSA 1I6HH 1QYPA 5I2XA 2JN4A 4L6TB 5LHY1 1PZID 4IO9A 3ONAB 1PTOC 2L4NA 4ID6A 2PMZA 3VMIA 1TIID 4IOAA 1EQRA 1DGSA 3AU7A 1BKBA 1IW7C 1X54A 3CPWY 1XJVA 1KXLA 2WKCA 3G71Z 1TWAI 2VW9A 1L1OA 1IBKL 2GA4B 3CCQZ 1JJ2Z 1JWUD 2XRQD 3OWFA 3PF4A 1ASYA 2XGTA 3DWPA 1FVIA 3G6JB 4QTUA 1I4QA 2P3YA 5GAHC 2N88A 2R7FA 4X64Q 3P20A 1VQ8Z 1QG7A 2ZTDA 1IL8A 3X3MA 3H3VJ 4CDCC 4GZYC 1CA5A 2LS01 3LWEA 4LFAQ 1F9SA 4UP8A 1GXDC 2PZWA 4K5WA 1AFPA 2RIQA 5J1ZA 1K8GA 2WB1B 3DEOA 2W03A 2DNEA 3EQLC 3DXJC 4FXDA 4CL1A 1KD11 1I6HB 1KRSA 1LYLA 4HN7A 4QF4A 3I56A 3TZDA 3I4MI 5C0XI 4HJ8A 5C44B 2I07B 1WTRA 2VZAA 4JBJA 2Q51A 4WJ4A 1TWCB 3D2LA 2Y0SE 5CBEE 2DJGC 2RPRA 3LUSA 4AYBB 3GTPI 1SJED 4JI2L 2RVLA 2ASBA 3U9OA 1YIJ1 2EYFA 1XPUA 2E2JB 2CW0C 4BBSI 2K04A 2R93I 3A74A 3SDZA 3VA7A 3CCSZ 1YHQA 2BA1A 1DM0B 1Q82C 1VQOA 5EBCA 1CSQA 2M00A 1BO0A 2KQ3A 4OX9Q 1WTXA 1F2ZA 2A69D 3HOUI 3S14H 4OGQC 2JE6I 3FQQA 3I55Z 2HIXA 2CH4A 1UNSA 1CZGA 3CCVZ 2NZ1D 3PIOA 3GTMH 1YI2Z 5D1PA 2ZM6L 1KAAA 1M1KC 4DR2Q 3OW2Z 4IPCA 1PFNA 3KLRA 3OOCA 5A35A 1ONLA 2NTTA 3PUXA 5AFWA 3HOZB 3GTKI 3K59A 1XMQQ 2MFIA 3MEHA 4GN4B 1WTQA 3S17I 4N8FA 4HSPA 1X3WA 4F8MA 4K6DA 1R9TB 2QEJC 4CKCA 3RLFA 3GTMS 1SNMA 1E2ZA 4QUFA 3BS1A 4B3RL 5CV8A 4X3TA 5E3FA 1AW7A 3VTNA 2E2IH 5A2Qb 1YIJA 4LF4Q 1WD0A 2VB3X 3IRBA 4LF8Q 4RMFA 3S14B 1VQEA 2MNAA 4N9PA 4LF6L 4ZCKA 2L5TA 2NVXH 1UE1A 4EVOA 1I50I 4C2MH 4EQPA 1PHJA 5FLMI 2C35B 3MXUA 1YNJD 2R7ZI 1W6JA 3OW7A 3DMUA 2RHBA 2JA7H 4RHSA 5HY6A 2MJ8A 1KRTA 2JR6A 1Q812 2KOLA 4GOPB 1I4XA 1BCPF 4NMZA 2YTVA 4DNTB 4LF5Q 3J81f 3CCM1 3KIHA 4DUZQ 3CCJZ 3CC2Z 2N55A 3EJIA 4A3BH 4A3CH 3H0GI 2CKZB 1Y1WH 4IUNA 1OTCA 2F4OA 1K3BC 2PQEA 1TWGI 2Z1CA 4HJ9A 4HIDA 5M3MG 4CKBA 3HEJA 2ZTCA 4KD3A 3HOVG 3I73A 4IFDI 4Y7NB 1TS3A 1JOOA 3S9WA 4X64L 1RL2A 4OIJA 5T64A 5CV6A 4A3DI 2AQ1B 4C3JH 2R7DA 2YU9I 1FD7D 2E2HB 1S5DD 1LLRD 1VQ71 3RN5A 2K14A 1GJXA 4PQXA 1DOMA 2E76C 2V45A 4C2MB 2AWNA 1RKNA 3NH5A 1MJCA 1RLYA 4BWGB 2IX3A 3E0JA 2PMZE 4S1TA 4JI0Q 3KJOA 1ZXTA 3BZDB 5IGEA 3M3YI 3F2CA 3HKZA 3ER0A 4HCEA 3X3NA 3RZDH 5C4JI 4FF3A 5H1SE 1FJGL 4X6AH 2KCCA 1HR0Q 1YEZA 3T4NB 3SK8A 4HEDA 1B2TA 5A2QE 3CCMA 2A1AA 1GD7A 1D2BA 2A68D 2OTJA 3BDOA 4DXGA 3OIQA 3GTQI 1HH2P 5LMUQ 1W2BA 4YWLA 5C3EB 2N8NA 1Y8PB 3V2TA 1VQMZ 1L0XB 5C0XG 3I4MG 2MUYA 3TSSA 1HHVA 2Y0SB 3P75A 1J8IA 5LL6f 3CC7Z 1RODA 4BXXI 4CBVA 1H9MA 1Q12A 1YITZ 1RO2A 1Y8OB 4YIJA 1A8VA 4PMWA 4DR2L 1CQVA 2VNUD 1Q811 4GNXB 2MPMA 5M5WB 1AA6A 1XMQL 3RR5A 1EFWA 2F52A 3HKSA 4BBSG 2JSOA 5I2YA 2R93G 2JA9A 2QKDA 3PO3I 3CRLC 1EYGA 1Z9FA 2QEXZ 3HOUG 3S15H 5BR8Q 1JOQA 4RVDA 3CCRZ 1XTDA 1VQPZ 2BCOA 1U4RA 4JI8L 4AQYL 4PZ8A 1Q1BA 3R3OA 2O4HA 1TWHI 1ZYRD 3D31A 5FO8B 3C2PA 4RAUC 1BXTA 3MTSA 4FF4A 3T51B 1Y1VI 5JVG3 4LF7Q 4BY7I 4DQYB 4LF8L 4APVA 3M4YA 4I7ZC 2RHQB 2WAQA 1PRTB 3LNNA 3CD6Z 1J6QA 1VQN1 2X6GA 3QOJA 1XTCD 3I4NI 2AKWB 2E74C 2F0EA 1IYUA 4OO1I 5IWAQ 4KKSA 3IL8A 3H94A 4JI5L 4C1NK 2TSSA 3GTJH 3F2BA 3Q23A 3I70A 4IN3A 4A3KG 2B2WA 2D0OA 2BDNA 1IKLA 1E1OA 3HOYI 4YCVA 1P8LA 1GUNA 1VQHA 4XT3B 3CMEZ 1EIFA 3HOVH 1WTOA 1ML0D 3D4RA 3G4S1 3A7LA 2ZTEA 3RZOI 1EQTA 3S15B 3NXWA 2BA0A 3PMFA 3IF8A 5ELEA 2K3RA 1CZWA 4DUZL 2JQOA 1HTPA 3IX0A 1QVGA 1VQ5A 1K8MA 3G6E1 4XDXA 1CSPA 5GQOA 5DM63 1E22A 1UE7A 5IGBA 1PRTF 3VYUA 1TWAH 3JC66 4QMGA 1WW9A 3U9SA 2BE5C 3C1FA 5FLMG 1KL9A 3NQIA 2R7ZG 1EQQA 1NR4A 1VQKZ 3CPFA 1RO0A 3F3FC 3HOWI 4K14A 3I72A 4RGNA 5I6YA 1N33L 5M5YH 2EYLA 3D0FA 1YNXA 4LUVA 4JI4Q 1GHKA 1WIIA 2OXPA 4C1NI 3S1RB 4Y52H 5A2QL 3GTJB 1Y8NB 1VQNA 4E2WA 3KIFA 4KD4A 3QOLA 1I4RA 3HZXA 2YTXA 3H0GG 1SLJA 4BA1I 1JJCB 3RD4A 5M3MB 4LFCQ 4DR4Q 4DGZA 1ML8A 3HOVB 3OYYA 4F7XA 4CDEC 4IFDG 4QGUA 4HCSA 5T6BA 2E9HA 1Q8KA 1BUVT 3I4MH 4B3TQ 2A5HA 3WWVA 1YNND 3GTOI 3F8TA 4OONA 1QWYA 4A3DG 5KYLA 1HR0L 1HPCA 3S24A 2FINB 5CM2M 1QILA 3GTPH 1KC82 4BY1H 1HUNA 1EY8A 5CR3A 1YHBA 3PQIA 4AH6A 1EWHA 2EY2A 1S40A 2IZ4A 5DLQE 1TWAB 5DAUA 5FLXc 2PMZB 1S7MA 2Q2IA 3G6EA 5LMUL 1PH5A 4DAPA 4BBSH 1HR0W 2D5DA 5LL6X 3KLSX 3LGJA 4DV2Q 4DR5Q 1W3SA 1F2MA 3I4OA 2IX0A 2K5RA 1L1OB 1YJWA 4HSVA 5FJ8H 4FNFA 4HGYA 1KQSZ 1STGA 5EQ0A 5JPNC 4RFBA 2K5QA 2PI2E 3Q87A 3HKZG 3S2DI 2HDMA 2N49A 3D6WA 1PFSA 2SNMA 4DF7A 1PV4A 3BJUA 5FO7B 4NBHA 4ZAIA 2OEOA 4N9TA 1JWMD 3GTKH 2B63I 2K5VA 1RJTA 4QQBX 2NAPA 2GVAA 5EPLA 3I4MB 3H3VI 1ZH1A 5BR8L 2UXBQ 2EYJA 3E3XA 3GTPB 1KTKA 4BXXG 4PMBA 2EZVA 1KQSY 1V43A 5ELCA 5GAGC 4UAIA 2R93B 1VQJA 1CKNA 2B8FA 2B2TA 3PO3G 3URYA 1SYCA 4KJOA 4R4CA 5JAVA 1M4VA 3HOUB 1Z7TA 2PZUA 1PTOF 2SDFA 3OTOQ 3K7AI 1HTLD 4MH4A 3TQYA 5IWAL 4DR6Q 4A3MI 1EL0A 3OSOA 2JA7I 2O4XA 1NUIA 3E6ZX 3TP6A 4DV5Q 4ZRZA 4XQJA 3PV0A 4ABNA 2F0WA 3M4OI 1Z03A 1LQLA 4MRIA 4KK7A 5FLMH 3H6MA 4GNXC 1Y1VG 1BBXC 2R7ZH 4ME5A 2F3VA 3W5OA 1QCBD 4BY7G 4A3CI 3NPPA 3S17B 1KC81 4WORA 3IR7A 1Y1WI 3S1MH 3N52A 5IYBG 2E5LQ 3T53B 1XNQQ 2KJXA 5T1GA 1IL2A 3K57A 1ET9A 2WB1E 4OO1G 1DOKA 4A3KB 2WAQE 3HS0C 4EQ5A 3GTLI 2WAQG 3H0GH 2PK7A 3BVGA 3U4ZA 4HAEA 1BOSA 4DAMA 3NDJA 1PH2A 4P73A 1HNZL 2ALYB 1TWGH 2IJ0A 3P5JB 4HR7B 2ZJQA 3HOYG 2VPYA 4RHRA 4RKBA 4AYBE 4IFDH 3NWTA 3NBIA 3K5OA 2WP8J 4ZQ3A 2K6AA 4JI4L 3Q0AA 1PRTC 2L55A 1C0AA 2K1BA 1A62A 1SE8A 2YU9H 4A3IB 3KUPA 3A0JA 1FR3A 4NKLA 1VDZA 3KBGA 1WVLA 2N3SA 4KLKA 1I50B 3Q8DA 1JJGA 4LFCL 4DR4L 3EA6A 5TSSA 3CP0A 2IZ3A 3CCUZ 1O80A 3PUWA 1SYEA 4OIKA 3M3YH 4WJ3M 1VQ6Z 2G5DA 3A5ZB 2DY8A 1Q7Y2 3P7JA 1RNIA 1VQ41 2ZXOA 4B3TL 5C4JH 3HOWG 5A2Qf 1JC7A 3QWUA 4JK1C 1AE2A 1GVPA 3VR6A 1PH8A 1XMOL 2HU9A 5JEAG 1LTLA 4OHJA 2I5LX 1S72Z 4EWCA 4H44C 4G7OC 1TWGB 4DPGA 2K75A 2JEBI 4GLAC 4DV2L 4IOCA 2ATWA 1PH3A 1F9PA 3CC41 3FMCA 4PNYA 1BVSA 1U0LA 2L12A 1EIHA 1SE4A 2EJFC 2EJMA 2ZM6Q 1NP6A 2F0LA 4CKEA 4A3DB 1Q8IA 3L3OC 3BG1B 1SROA 3K7UC 2VQFQ 2YU9B 1V1QA 4I65A 2RDHA 4BXXH 4JVZA 3AYHB 1SMYD 4TVAB 2V3VA 2JA5I 1PFTA 3PUZA 4TKOB 3PO3H 3M3YB 5EGTA 3FKIB 3STBC 4A3LI 3MXGA 1KDAA 1B4OA 2RSOA 5C4JB 2EE1A 4X66Q 2UXBL 3BG0B 1E2VA 1JR0D 4N8X1 3M9BA 4KHPQ 4KJNA 4R4IA 3I56Z 1X56A 1DD2A 4PMCA 4NB8A 2A6ED 2ES2A 4JOIA 1D6EC 1TWHH 1YJ9A 1STBA 5JJIA 3PO3S 1YZ6A 4JW0A 3GTQB 1SEBD 3MVVA 2R92B 1Y1VH 1S5CD 4BY7H 3KF6A 3PO2I 3M7NA 2B63G 2JMOA 5CMDA 2NVQB 4NXMQ 1IHZA 4DKAC 3CC4A 2RBMA 2ZXPA 2RF4A 4X3UA 4DR6L 1X3EA 5IGDA 1HZ9A 3I4NH 3J80i 4DV5L 3BVZA 1VF7A 1Y1VS 3U58A 2F4IA 1JWHC 1Q7Y1 4KN7C 1SNOA 1AH9A 5DM73 2I0QA 2V8KA 3HOYH 2R61A 5COYA 1XNRQ 3FPUB 2LFUA 1A3TA 3A8KE 1MSHA 1I3QI 3W1BA 3TRZA 1E3PA 4S3SA 2QGQA 4JG2A 4P71A 2E5LL 2Z6KC 1YHQ1 3M85A 2N78A 1XNQL 3RZOH 2MP1A 2K03A 1VQO1 2JYOA 2XVSA 4A3MG 1XWEA 2JA7G 1TQOA 1PYSB 2K7VA 5C5MA 3CQZH 4NBFA 1TWHB 3A8JE 4A3FB 3E5SA 5KNCA 2HT1A 2V1CC 2OOYB 1PH9A 3C3LA 1CQFA 2F0IA 3SGIA 4LFBQ 3RUZA 3SR1A 1TR5A 4BY7B 4Y52I 2SEBD 1MJEA 1YBYA 2K4KA 4A3BG 4A3CG 1SIWA 1Y1WG 2ZAEB 3HOWH 3VR3A 3J80c 3I90A 2Z4HA 3GP7A 2AMCB 3NE5B 1YIJZ 2DY7A 4LW1A 4C3HG 4FP5D 1LTAD 5JEAH 4J8QA 2WAQB 4E33A 5AN9F 2A8VA 1JJ2Y 4HJ5A 5AJ3L 5IE8A 3CW2C 4DV3Q 4GKJQ 3RN2A 2Z6BA 1FJGQ 3HOYB 1ASZA 4L8JA 4C3JG 3WOEA 1KDBA 1LTRD 3OHXC 1DZ1A 4LNQA 2UU9Q 3U4VA 4DK3C 1EUJA 4BY1I 2L15A 1A6XA 1AP0A 3RZOB 3R2TA 1N9WA 2KENA 4RS4A 3GTOH 4AIMA 5J3BA 4F88A 4DR1Q 1C8CA 3MEFA 4R4TA 4DV6L 2VF1A 3UDFA 4KN4C 5G3LD 1EU4A 1KD1C 4B9XA 4IUUA 4IJLA 4L5TA 5E4XA 3CPWA 4NXNQ 1NJI2 4LAAA 3PIO3 5GADC 2P5ZX 2EQSA 1I5FA 1PDQA 2KPIA 2M48A 2Z8LA 3HOWB 1X9NA 2FHTA 4CHTB 4JI1L 4JV5L 1STYA 2VQFL 1E0BA 2Q2HA 1NMGA 5EAYA 4G57A 4UHVA 3S2DH 2HUGA 1I4HA 2Q8TA 2E75C 4HIMA 1YJNA 4A93H 2FMCA 4EGVA 5BN4A 2HCIA 3DLLA 2X6LA 1SNPA 2B63H 2R3ZA 1B9NA 4JI8Q 4IPDA 4HJ7A 4AQYQ 2IPKD 4A3GH 2NB0A 4X66L 4DU9A 4MTKA 1WTVA 2WFWA 2EGTA 3H3VH 1Y14B 4KHPL 3G71A 5ISRA 1U4PA 1IW7D 2RT9A 3OW2Y 2J4XA 4DV1L 1SAPA 2ZXRA 2F0MA 1IBMQ 2D9UA 4H0LC 4NB9A 1EYDA 4A4IA 2D2CC 1TU2B 1VQ8A 3CCMZ 4NXML 5KYIA 2RQXA 1K8A1 1KLGD 4JI5Q 3GTMB 2K50A 3UE1A 2DNCA 4DV0Q 4V190 2OTL1 1W2BZ 2D0PA 3K7AH 4EQOA 1Y69U 1G6ZA 1B70B 4A3MH 1A0IA 2X69A 5EJWA 3S2DB 1GO3E 3S1MI 1X3ZA 2VB2X 2XNAC 3M4OH 4DUYQ 5F2DA 2XN9C 4DR3Q 2F3WA 5C4XI 3S2HI 5IP9H 1XNRL 1D5MC 3KLWA 1SDFA 2JXMB 4HTHA 1Q90A 4MIUA 1BQQT 2B63B 4NBEA 2OTJ1 4Q0FA 2JJQA 1K9M2 4R4QA 1N2FA 1VQ7Z 2WIIB 1I94Q 2IHFA 1H9SA 1WJJA 1RO4A 2XSCA 2PNRC 3R93A 1SYDA 4C3HH 2E2IB 1NJI1 4RG1A 1B1ZA 4XIGS 4IURA 1VQFA 3GTLH 2IT1A 3M4PA 3NTHA 4OL7A 1F2YA 2Z0SA 2CW0D 2AQ2B 1PH7A 1EOVA 1ZYRC 1K83H 4LFBL 3EVQA 3MWYW 3F1ZA 1N33Q 2OQ0A 2R6MA 4QJFA 2KVMA 3CCL1 1VMPA 2NVXB 1QOHA 2TMPA 1TXYA 2L1BA 3CCVA 1V1PA 2JIRA 1YI2A 1V9PA 1STAA 3K7AB 2QRCB 1ENCA 2JA7B 3UDGA 3PUVA 1EFID 2OTLA 4NB3A 1WTWA 3K5MA 3E9HA 2QREB 4KHZA 1KDCA 5NUCA 4DXFA 1G8ZD 4ILWA 3M4OB 4GKJL 4DV3L 4G7ZC 3HFZB 2HHHQ 2F0DA 1IYJB 4GS3A 2UU9L 4POFA 4A3BB 4JI7Q 3MFGA 1WTPA 1Y1WB 2KHIA 3J7A5 2NN6H 1QVFZ 3FP9A 3NDIA 5E4WC 1L2FA 2I3CA 5I9PA 4DR1L 5IYDH 3IKJA 1HZAA 5DNFA 1VQGA 1J9OA 1EEFD 2K01A 3S1QH 1FGBD 3GTLB 2RA4A 5FLXb 2AUKA 2B2UC 5CV4A 4NXNL 4C3JB 5I6WA 1QVGZ 1VQ5Z 5K5PA 2B29A 5ELFA 3W2DA 1QE6A 3CXCZ 3NTIA 4UP9A 5FK9C 4XQNA 4BY1G 2NVYI 3CCLA 3J7A4 1R4QB 3NHHA 3T56B 5GAEC 1EYAA 2LKVA 2NVTH 4NP5A 3FDTA 1TY0A 2RCNA 3A54A 1QVFY 1IYVA 1N36Q 1GOZA 4ZUIA 1K9M1 1LT6D 3RZDB 4A3JI 4K2KA 2IV2X 3PIPA 1VQ51 5FJ8G 2JA5H 1VQNZ 1D5ZC 3NBHA 1CT1D 1GUOA 4BBRH 1YHAA 3TMEA 3CC2A 4A3LH 1CFMA 1DL6A 4YHHQ 3VYSA 1DYQA 1JOKA 1CI3M 1CK1A 3D8GA 1TS4A 2HF1A 4YCUA 1YNNC 1Q81C 2OWOA 1D5XC 4E6IA 1VS0A 3HRZC 1HA5A 3VMGA 1IXRA 2F0JA 4HMJA 4QIWE 3C1EA 5C3XA 3Q22A 1SSOA 1IBML 3T1YL 3G4SZ 2ENBA 3D6CA 1LT5D 4ZKBB 3S16H 4K8JA 3J80f 3B6YA 2XRSD 1RHPA 4IPGA 3PO2H 3MONA 1MHWC 3TZUA 2YV5A 4DV0L 3G6EZ 4ZLTF 2FXQA 3E9IA 4FYDA 1BDOA 1DOLA 4PZ7A 4JBWA 3NQTA 1SNQA 3BDCA 4FO2A 2IW3A 1Q46A 2AQ3B 2MHVA 4DUYL 4DR3L 1P9NA 1UWVA 4X62Q 3P1HA 4MTNA 1I4PA 1X0TA 1EY5A 1N8R1 1AE3A 3CQZI 4HH4A 1I3QH 4E2YA 1I94L 4RH6A 1UEAB 1VQ9A 1XPOA 5FLXE 3S1NH 1ZB9A 1TWCI 1PFMA 1HNZQ 3UDIA 2O53A 2VY3A 4RVHA 3I91A 5M3FG 3H91A 1YJW1 1O78A 4OXPA 3I8ZA 1T5EA 4GN5A 3HOXH 2G9HD 3U50C 2E2JI 3D4WA 4QTTA 5L37A 1BNZA 4MN3A 5C4XG 3CHBD 5EBDA 3CC7A 1EQVA 1QZGA 2JA8H 4R9WA 4YWMA 5CORA 4MNOA 1YITA 4DV7Q 4RCOA 4RGOS 1JICA 3ZYYX 3KF6B 2Q8RE 1E2WA 3VR2A 1L0WA 1D8LA 1GUSA 2H4OA 4B9WA 1G91A 1ET6A 2HHHL 2QEXA 2ICIA 3SK6A 4GOPC 2PM9A 2F1MA 4E2ZA 4P72A 2IHEA 1G6PA 3MC0B 3CCRA 4JI7L 5ELDA 1AZQA 2IWHA 1XMOQ 4ZKCB 1R9TI 1FDOA 4X3SA 1PTOH 2AHOB 3QIAA 1HJPA 3QO2A 4DR7Q 2E8GA 2JP1A 3MFYA 4TQUS 1LM0A 2B2VC 1G2TA 2KA7A 2KEDA 1K3RA 3NH8A 5M5YB 1C48A 3TBIB 3CD6A 3G48A 2EJGC 4GKKQ 3QG1A 2RHSB 5D3DA 4LMQD 1B53A 1EY7A 4K0KQ 1NUCA 3HKZE 5HGQA 3DWAA 5KGUA 2F4VQ 1HFGA 2Q2TA 4A93I 1QJOA 1JB7A 1ESFA 2PO4A 2AUJD 1SN8A 5M5XH 3I2ZA 2EDGA 2K5WA 1N36L 5ELNA 2CWAA 4A3GI 1B44D 3KFUA 3SXHA 2B2YC 2GTHA 2F0SA 2CH4W 4O42A 1FYCA 1LT4D 3OPOA 1KIXA 3AQQA 1JQYD 1MI2A 2WINB 2XIWA 3RMHA 4HJAA 1T9HA 4BY1B 4XXEA 4YHHL 2E7ZA 1SE3A 5G3LF 1K732 2IY5B 3ERQA 4PG3A 4BBSB 4X65Q 2EPBA 2GU2A 1PZKD 1PYWD 1BCPD 4A3JG 1MKHA 2UUBL 4HMIA 3MHBA 5CV9A 2NYZD 4Q5VA 1VCIA 2KI7B 3VDYA 4Y7NI 5FLXL 1OXXK 3KK7A 4O1NA 2LY7A 3Q6SA 1FL0A 1GHJA 5IP9I 3GTKB 4K8IA 2ID0A 4KY5A 2E2HI 4ZK9B 5M3FH 4IUVA 1Q861 3UI2A 1MBYA 4QIWB 2JA6H 3TS0A 2L0CA 1TVXA 4DA2A 1FNWA 5CYUA 1RIPA 1W6KA 1S3OA 1PYBA 4X62L 3AMUA 1HQRD 4WJWA 5C4XH 3S2HH 3I4NG 1NR2A 4TSSA 3MZLB 4NPSA 2K5NA 5T67A 1SYBA 4P2CB 1K83I 4B3SL 3E0EA 4DGLA 1C4QA 3QJYA 3T1HL 3ZJYC 4MXUA 1SXTA 4PZ6A 2PNHA 2QF7A 4B3ML 3TE5B 1M902 2A6EC 2O5IC 1VQ4Z 2EIFA 1KC8C 3D9XA 1HCZA 4DNRB 5CGKA 2NBFA 1KQSA 5C3EI 3GD7A 2Y0SA 2DGYA 1O7IA 4A3EH 1EZ6A 3LX0A 4DV7L 2UUAQ 3J80b 2J6AA 2QA41 3ULLA 1JORA 4ME3A 2RBLA 3NH4A 3A55A 1VQL1 3MXPA 1KABA 3Q24A 1RTOA 5AJ3Q 3MA2B 2XTIA 3BYYB 4IUQA 4GNXA 2R7ZB 5M3FB 4F87A 1NCVA 2NZOA 3L9AX 3CC4Z 2VPWA 2W04A 1HXYD 3S1MB 1DONA 1YVCA 2NN6I 1QB5D 1K731 3OMCA 2OT2A 4YY3Q 5C4XB 3CMAA 1YJ91 2KHSA 5IT9c 2BH8A 1ENFA 4DK0A 3NFZA 3S1QI 3R2IA 3H0GB 2F0GA 4DV6Q 5IIFA 1WCMH 1ESRA 1J5EL 3GV3A 2CFMA 3NENA 1A15A 1H95A 3EBEA 3O13A 4DR7L 5KNDA 3BVMA 4J1MA 1GM5A 2LMCB 1F2LA 5CV5A 3NTKA 3TP8A 4NBDA 2M2LA 2F0TA 4KY7A 3GDEA 2F4MA 1Z02A 1EY0A 1H9SB 1VQDA 5JVH3 4GLXA 1LUZA 4GKKL 2ZT9C 2NVTI 1PZJD 4CJ1B 1X55A 4JI1Q 4DNIA 4JV5Q 4K0KL 2UXDQ 2F4VL 4IUTA 1MSGA 1RQFA 1LTSD 5HGTA 2NVYH 3KBXA 1EU3A 4DFAA 2A19A 1LABA 1M8AA 1HA6A 1PXUA 3I7FA 2QA4A 3HGBA 2ZJPA 4BBRI 4XQQA 1B7YB 1VQLA 3UE0A 1V1PB 1EYCA 1V8QA 2CWPA 2JK8A 2OQKA 5IGGA 4A3JH 3I07A 3K58A 3BYTB 2DE6A 4XYOA 4CDFC 3HKZB 1K0RA 3F3PC 2C9OA 3AB9A 4R8IA 1U4MA 1PA6A 4CJ2C 4DV1Q 1M901 4B08A 4A93G 2DE7A 4MD8A 3S16I 4X65L 2A73B 3I4LA 4MONA 2A6HD 2VS1A 2OCEA 2EOTA 3ULPA 5IGFA 1VMCA 1CA6A 1TFIA 2I5HA 4A3GG 2B8GA 3WDNA 3HG9A 3OIPA 3MAQA 5IT9L 3J80E 1RCVD 1OO9B 1L1OC 2A69C 3ESWA 4XX2A 1YHQZ 5IY0A 3F2UA 1LTGD 1VQOZ 1RD9D 4O0AA 2V8IA 3W1GA 2PZTA 3GTGI 5CV7A 4KY6A 3QWNA 1LTTD 5T1IA 1F9QA 2HQEA 3V05A 1K8OA 3BZKA 3S1RI 1DXMA 2RDGA 3PO3B 3CCUA 2V8JA 1VQAA 1Q1EA 2M6NA 5GROA 3KF8A 4A3JB 3IFUA 1BBUA 1X3GA 3S1NI 1USPA 2WKDA 5FLXf 2L9HA 1L0YB 1H9JA 1VQBA 2F0FA 3FHWA 1SFOI 1YJNZ 4RKLA 4FXKC 3HOXI 2QILA 1S72A 5C44H 3NBHB 1TS5A 3K5LA 4GN3B 1TWCH 1Y1VB 3KOJA 1WJ2A 1Q7YC 2KCTA 4K2LA 5IP9G 3IAYA 3K8AA 4FF2A 2MO1A 3N6RA 2JA8I 1NMFA 4R8NA 3VR5A 3MXNA 2V4DA 3CCE1 2VQEQ 2E2JH 2MO0A 1G2SA 1RDPD 3I4NB 4JI6Q 1PLFA 4LUOA 2VL6A 3NWSA 1HZBA 1YJN1 2UUAL 2AWOA 1K8A2 5M9OA 4JYAQ 1HZCA 5EPKA 2RKSA 1SNCA 3K81C 5EPJA 3J7YW 1G51A 1YNJC 3TP5A 2VPZA 2PQAA 1EEID 1ZKOA 3G711 2HIVA 2DJFC 3CCQ1 2Z6KA 3SVMA 1HRJA 3T16A 1B50A 4YY3L 1Q821 2KCMA 3HOZH 1QNKA 3G7LA 3STBD 5C3EG 5D1OA 3CQZB 3UDXA 3JAMb 3AFQA 1LTBD 1R9TH 1AN8A 4WFN3 1YUAA 1VQ81 4KMUC 4DV4Q 2M9VA 2Y0SG 2UUCL 1M1K1 1XXGA 1C7YA 1S5FD 1CHQD 3EERA 5C6AA 1D1KA 1QUQA 2NN6G 1PH4A 4QY7A 3KYHC 2JIOA 4X3KA 2UXDL 5KRUA 5IYDG 3NSWA 3GV6A 5I4DA 2I46A 3CCEA 1WYDA 3F2DA 3K80C 3FEWX 5EKKA 5C5LA 2QR1B 1HUMA 3GCFA 5KNBA 3IFTA 2QLVB 4JCVE 5LL6S 1U9RA 3J80L 3RLNA 1PTOD 1YUKA 1CKOA 5LMNQ 1KNAA 4DK1A 3CCS1 1STEA 3GTOB 2OTLZ 3CCQA 1JJ2A 1AZPA 1E1TA 4JPBW 2K32A 3VB9A 1SJHD 4JI3Q 1ILQA 1LACA 1PFBA 3T1YQ 3I551 2A68C 5FO9B 2JA5G 2EY1A 3CCV1 4RV9A 4BBRG 4A3KI 1YI21 2KCNA 4C3IG 2B39A 5CBAE 4O2DA 1OXSC 4A3LG 4NBBA 2OTJZ 1BCPB 2FJ2A 1XX8A 3C46A 4CJ0B 4RCNA 4QUCA 1SBBB 2AKLA 1UUPA 2PW5A 4L5SA 2RCFA 4H7BA 4Y7NH 2JA6I 4K6LA 2PPBC 1NBWA 2UXCQ 4A93B 2DN8A 4QL5A 3T13A 1JE4A 1G291 2E2HH 4A3II 4FF1A 3AFPA 3PO2G 5IT9f 4A3GB 3CCLZ 3K0YA 2Q2UA 1A2UA 3JAME 1K8AC 4ULLA 3JAMi 3BU2A 1VF5C 3CCSA 1PH1A 1W2BY 5ELBA 3A5UA 2MGSA 1ICFB 5HURA 1N34Q 1X65A 2H1EA 2P28A 2BDOA 5ELOA 3LWUA 2H85A 4GLVB 1T5XD 4L63B 3K6OA 1KHIA 5IYCG 3I55A 2BH2A 4A3EI 2PW7A 1FNVA 4LF9Q 2VQEL 2LSSA 4XTCS 3AEVA 4JI6L 1CKNB 3OW2A 1ZEQX 4A3MB 2J7ZA 2F0HA 5C3EH 4JYAL 3V96A 1WOCA 1TWFI 3FRPB 3TEHB 5EKLA 4FDBA 3MZKB 1S5BD 4L5QA 4R4OA 3HOXG 4NBGA 4IUPA 2OOXB 1NJIC 4NDXA 3CCJ1 1D7QA 3CC21 1GUWA 2ZJRA 2CHBD 1SNDA 2SOBA 4LFAL 4LJZC 2JA8G 1R4PB 1WCMI 1X3FA 3DHQA 3L2PA 1MIUA 3JAMc 5M5WH 1FGUA 2K52A 4C3HB 3GQBA 2EYOA 1N8R2 4KI0A 4IJHA 1IKMA 1WFQA 2LIYA 3FKII 4CGYB 1EWCA 2PI2A 1N32Q 4HIKA 2H5XA 1CKMA 3KDFA 1K83B 1E24A 1II3A 2J0TD 4DAYA 4DV4L 2DE5A 1X6OA 2Q4ZA 3DM1A 1GUGA 4IALA 1JT8A 4RGMA 1ZB8A 1VQ9Z 4A76A 4JBKA 4E30A 1HQMC 2K5HA 3BZCA 1EY6A 2R92I 5BN5A 1BR9A 1BF4A 5IP7I 1A2TA 1PH6A 4WRDA 2NVQI 3PCOB 1EY9A 4OX9L 2G2KA 3M4QA 3PIP3 2QDBA 1WI5A 3VR4A 3CU7A 4EQNA 2BOSA 1HFNA 3H09A 3CAMA 4M1UB 4C56C 3NELA 3ND9A 2GTIA 1VQ91 4C3IH 5C3WA 2VUMI 3IFDA 3CCJA 1CUKA 2B2WC 4QB4A 5LMNL 2JUBA 1QVGY 3TDQA 2K33A 4UDUC 1VQ7A 1DJRD 1WZNA 3CXCY 1X3PA 3DM3A 1VQM1 3GKQA 3S1QB 3OWEB 5LMNW 4JI3L 1TT2A 4KTAA 4NH1C 5D65A 2R6GA 1VQCA 2RDFA 1NNXA 5JOBA 4RA8A 3CC71 2B2UA 4JBMA 3D3RA 2UUBQ 1K9MC 2EY6A 1SYFA 2F0UA 3TREA 3PF5A 4TNUA 1YIT1 2BJOA 5IODA 5C4HA 2YADA 3JAML 3CKIB 4MD9A 4A3FI 4RVFA 4MD7A 5E1FA 2GN5A 1NE3A 5KEEA 2NVTB 1WD1A 1CHPD 4LF4L 3L7ZC 5C0XJ 2WB1A 1QF8A 1IBLQ 2QEX1 3EFXD 3ERSX 3J7ZC 3GTGH 4Z9CB 1YJWZ 2UXCL 4OWXB 3KJPA 1SE2A 2K28A 2CQOA 3CCR1 1VQP1 2CQAA 4IZ8A 3TP7A 2FFKB 2JA5B 3S1RH 4BBRB 5D14A 2KHJA 4C3IB 1OXUA 3PGZA 4EX5A 1I6VC 5IYCH 1I6HI 5I9OA 2QDLA 5IOCA 4NOZA 4AYBA 1A3VA 3H15A 5C44I 4DAVA 5M3MH 1QVFA 2F0NA 2SNSA 3BG3A 1VLAA 1HNWQ 1O7YA 4B3SQ 1PMRA 2L11A 4UPAA 3T1HQ 3CD61 1SFOH 2JA6G 3SK5A 3A7AB 1N34L 1PVOA 1VQMA 4B3MQ 4LF5L 3S16B 1E7ZA 3TDHB 4IPHA 3QB3A 1RF2D 3PO2B 4A3IG 3FQMA 1NY4A 4LF9L 1LV9A 3CXCA 1N8RC 1MD2D 4MHEA 4FVMA 3CME1 1BCPC 4K5XA 3VA5A 2F03A 2MQHA 4RVGA 1Q16A 1F9RA 4YCWA 2Q8IB 1FNUA 3GTGB 2GVBA 2WACA 5JJZA 2HDLA 1ICWA 1WTHA 1QNUA 3HOZI 4NBAA 1Q862 1VQPA 3CF5A 1I3QB 4NBCA 4A3EG 3J81j 3ICEA 3VYTA 3VMHA 4KHVA 3ITPA 2QRDB 1J5EQ 3S1NB 5IT9b 2A74C 3H3VC 2WV6D 1KLUD 4JI0L 3KLSA 1SYGA 1VQK1 2OZKA 4OWTB 5DEHA 1SFOB 1N32L 1MGSA 2KUMA 3KF8B 2B3GA 4POGA 3J7AF 2O5JC 1USPB 5C0XH 4KV6A 3HOXB 3D4DA 2Z9HA 4RWSC 5K36G 3G4SA 2PCFB 3J7AV 2EY5A 3DWQA 3DUZA 1P16A 1B8AA 2QCPX 2JA8B 3J81b 1RTNA 3S14I 1O7LA 1WCMG 1EIYB 1ENAA 2AYDA 4HIOA 2EYPA 2R93H 3WOFA 2F0PA 2PYKA 4DN4M 3CMEA 2B2TC 2JNYA 1KNEA 1VQIA 3FKIG 3GTMI 3MXNB 4FXGC 5C4ZA 3HOUH 1B3QA 4P74A 4GOPA 1V1OA 2O2LD 2VXWA 5IGCA 2JIMA 1H9RA 4I7AA 2ICEC 1QVCA 1TS2A 3FVQA 1PTOB 2JS4A 4IFDJ 1D1IA 1F77A 2R92G 5CC4A 4U68A 5IP7G 1HNXQ 3K5NA 2B2VA 2PQAB 4H13C 3ND8A 4TRDA 3HP3A 3W3AA 3S17H 5J39A 2LXJA 4RGTA 4J6HA 3CRKC 1VQKA 2BE5D 2EVBA 1JE5A 3CMAZ
chains in the Genus database with same CATH topology
4NFRA 5D1OB 2E2II 1UAPA 4KKTA 3SE0A 2F0VA 5M5XB 3VYRA 2NVXI 2F0OA 2F0QA 2RSNA 1NSNS 2B2YA 3CMA1 1EZ8A 3JAMf 1SMYC 5IT9E 3EEDA 4ZUJA 2IX1A 3T4AC 4ODGA 1O7ZA 2K5DA 5J22A 2QA4Z 2EXZA 1NAPA 4V0BA 1VQLZ 4LK1C 2K05A 3M7GA 5JPMC 4A3BI 2KEEA 4XT1B 3J81E 2JEAI 2NWGA 1A3UA 2XWJB 4PV1C 3SHLA 2A6HC 1YJ9Z 4HGZA 3DEPA 1CTMA 2OF1A 4NW2A 1U4LA 1TY2A 4G7HC 1DCZA 2E2DC 1ILPA 4K5VA 2G9DA 2LFNA 1I4GA 2JA6B 1Z01A 3GO5A 1Z6HA 5D3IB 1KRLA 4QCLA 5K36H 3NP8A 4BS9A 3S2HB 2NUCA 3SK4A 1LTID 5BN3A 3RZDI 2KECA 4X6AI 1EOTA 2VUGA 1AEXA 2YYZA 4BA2I 1LO5D 1H9KA 1Q3LA 1X3QA 2D62A 2CVRA 4E32A 1OXVA 4A3EB 2FMMA 2NTSA 3MZ5A 3CCU1 3A56A 4KKUA 1S4ZA 1VQ61 3EROA 3NUCA 1OXTA 1JCKB 1JWSD 1TWFB 2IL8A 3I3CA 1Z47A 2EYHA 3OMGA 1S721 2F0KA 1B3AA 3A8IE 1WCMB 3NK9A 2Z4IA 4E31A 5FKAC 3S15I 3SEBA 1Q822 1EIGA 1STHA 3FPPA 1KD12 4G4KA 4XYQA 1STNA 1LT3D 1CM9A 4M8AA 5FOBB 1XYIA 5JEAJ 1GUTA 1TKWB 2C5CA 5KIXA 1M1K2 4IQZA 5EKIA 1PRTD 2NVYB 2QKIC 3BDLA 4E2XA 2EYMA 3CPWZ 1JB3A 4U673 3R8BA 3GTJI 3J81L 3TN2A 2XWBB 1EY4A 3I561 4OO1H 2HCCA 3CCEZ 3HOVI 3PUYA 1B9MA 1S5ED 1X32A 2VUMB 4ZYSA 1QYPA 5I2XA 4L6TB 5LHY1 1PZID 3ONAB 1PTOC 2L4NA 4ID6A 2PMZA 3VMIA 1TIID 3AU7A 1IW7C 3CPWY 2WKCA 3G71Z 1TWAI 2GA4B 3CCQZ 1JJ2Z 1JWUD 2XRQD 3OWFA 3DWPA 3G6JB 4QTUA 1I4QA 2P3YA 2N88A 3P20A 1VQ8Z 1QG7A 1IL8A 3X3MA 3H3VJ 4GZYC 1CA5A 2LS01 3LWEA 1F9SA 1GXDC 2PZWA 4K5WA 1AFPA 2RIQA 5J1ZA 2WB1B 3DEOA 2W03A 2DNEA 3EQLC 3DXJC 4FXDA 4CL1A 1KD11 1I6HB 4QF4A 4HN7A 3TZDA 3I4MI 5C0XI 5C44B 2I07B 1WTRA 2Q51A 1TWCB 5CBEE 2RPRA 3LUSA 4AYBB 3GTPI 1SJED 2RVLA 3U9OA 1YIJ1 2EYFA 2E2JB 2CW0C 4BBSI 2K04A 2R93I 3SDZA 3VA7A 3CCSZ 2BA1A 1DM0B 5EBCA 2M00A 1BO0A 2KQ3A 1WTXA 1F2ZA 2A69D 3HOUI 4OGQC 2JE6I 3FQQA 3I55Z 1UNSA 1CZGA 3CCVZ 2NZ1D 1YI2Z 5D1PA 1KAAA 3OW2Z 1PFNA 3KLRA 3OOCA 5A35A 1ONLA 2NTTA 3PUXA 5AFWA 3HOZB 3GTKI 3K59A 3MEHA 1WTQA 3S17I 4F8MA 4HSPA 1X3WA 4K6DA 1R9TB 2QEJC 4CKCA 3RLFA 3GTMS 1SNMA 1E2ZA 4QUFA 3BS1A 5CV8A 4X3TA 5E3FA 1AW7A 3VTNA 5A2Qb 1WD0A 2VB3X 3S14B 4N9PA 2L5TA 4EVOA 1I50I 4EQPA 5FLMI 3MXUA 1YNJD 2R7ZI 1W6JA 3OW7A 3DMUA 2RHBA 4RHSA 2MJ8A 2JR6A 1Q812 2KOLA 1I4XA 1BCPF 4NMZA 4DNTB 3J81f 3CCM1 3KIHA 3CCJZ 3CC2Z 2N55A 3EJIA 3H0GI 4IUNA 2F4OA 2PQEA 1TWGI 2Z1CA 4CKBA 3HEJA 4KD3A 3I73A 4IFDI 4Y7NB 1TS3A 1JOOA 3S9WA 4OIJA 5T64A 5CV6A 4A3DI 2AQ1B 2YU9I 1FD7D 2E2HB 1S5DD 1LLRD 1VQ71 1GJXA 4PQXA 1DOMA 2E76C 4C2MB 2AWNA 1RKNA 3NH5A 4BWGB 1RLYA 2IX3A 3E0JA 4S1TA 1ZXTA 3BZDB 5IGEA 3M3YI 3HKZA 4HCEA 3X3NA 5C4JI 4FF3A 2KCCA 3T4NB 3SK8A 4HEDA 1B2TA 5A2QE 1D2BA 2A68D 3BDOA 4DXGA 3OIQA 3GTQI 5C3EB 1Y8PB 3V2TA 1VQMZ 1L0XB 5C0XG 2MUYA 3TSSA 1HHVA 2Y0SB 3P75A 1J8IA 5LL6f 3CC7Z 1RODA 4BXXI 4CBVA 1H9MA 1Q12A 1YITZ 1RO2A 1Y8OB 4YIJA 4PMWA 1CQVA 2VNUD 1Q811 2MPMA 5M5WB 2JSOA 5I2YA 2QKDA 3PO3I 3CRLC 2QEXZ 1JOQA 4RVDA 3CCRZ 1VQPZ 2BCOA 1U4RA 1Q1BA 3R3OA 2O4HA 1TWHI 1ZYRD 3D31A 5FO8B 3C2PA 4RAUC 1BXTA 3MTSA 4FF4A 3T51B 1Y1VI 5JVG3 4BY7I 4DQYB 3M4YA 4I7ZC 3LNNA 2WAQA 1PRTB 3CD6Z 1VQN1 2X6GA 3QOJA 1XTCD 3I4NI 2E74C 2F0EA 1IYUA 4OO1I 4KKSA 3IL8A 3H94A 4C1NK 2TSSA 3Q23A 3I70A 4IN3A 2B2WA 2BDNA 1IKLA 3HOYI 1GUNA 4XT3B 3CMEZ 1WTOA 1ML0D 3D4RA 3G4S1 3A7LA 3RZOI 1EQTA 3S15B 3NXWA 2BA0A 3PMFA 3IF8A 5ELEA 2K3RA 1CZWA 1HTPA 3IX0A 1K8MA 3G6E1 4XDXA 5DM63 5IGBA 1PRTF 3VYUA 4QMGA 3U9SA 1WW9A 2BE5C 3C1FA 3NQIA 1NR4A 1VQKZ 1RO0A 3F3FC 3HOWI 4K14A 3I72A 4RGNA 5I6YA 2EYLA 1GHKA 1WIIA 2OXPA 4C1NI 3S1RB 5A2QL 3GTJB 1Y8NB 4E2WA 3KIFA 4KD4A 3QOLA 1I4RA 3HZXA 4BA1I 3RD4A 5M3MB 4DGZA 1ML8A 3HOVB 4F7XA 4IFDG 4HCSA 5T6BA 2E9HA 1BUVT 2A5HA 1YNND 3GTOI 1QWYA 5KYLA 1HPCA 2FINB 5CM2M 1QILA 1KC82 1HUNA 1EY8A 5CR3A 1EWHA 2EY2A 2IZ4A 1TWAB 5DAUA 2PMZB 1S7MA 4DAPA 2D5DA 5LL6X 3KLSX 1F2MA 2IX0A 2K5RA 4HSVA 4FNFA 4HGYA 1KQSZ 1STGA 5EQ0A 5JPNC 4RFBA 2K5QA 3Q87A 3S2DI 2HDMA 2SNMA 3D6WA 4DF7A 5FO7B 4NBHA 4ZAIA 2OEOA 4N9TA 1JWMD 2B63I 1RJTA 5EPLA 3I4MB 1ZH1A 2EYJA 3GTPB 1KTKA 4PMBA 2EZVA 1KQSY 1V43A 5ELCA 4UAIA 2R93B 2B8FA 2B2TA 3URYA 1SYCA 4KJOA 5JAVA 1M4VA 3HOUB 1Z7TA 2PZUA 1PTOF 2SDFA 3K7AI 1HTLD 4MH4A 4A3MI 1EL0A 3OSOA 2JA7I 2O4XA 1NUIA 3E6ZX 3TP6A 4ZRZA 4XQJA 3PV0A 4ABNA 2F0WA 3M4OI 1Z03A 1LQLA 4MRIA 4KK7A 3H6MA 1BBXC 4ME5A 2F3VA 1QCBD 4A3CI 3NPPA 3S17B 1KC81 4WORA 1Y1WI 3N52A 3T53B 2KJXA 5T1GA 3K57A 1ET9A 4OO1G 1DOKA 4A3KB 3HS0C 3GTLI 2PK7A 3BVGA 4HAEA 1BOSA 3NDJA 2IJ0A 3P5JB 4HR7B 4RHRA 4RKBA 4IFDH 3NWTA 3NBIA 3K5OA 2WP8J 4ZQ3A 2K6AA 3Q0AA 1PRTC 2L55A 2K1BA 4A3IB 3KUPA 4NKLA 1FR3A 1VDZA 3KBGA 1WVLA 1I50B 3EA6A 5TSSA 2IZ3A 3CCUZ 1O80A 3PUWA 1SYEA 4OIKA 1VQ6Z 2DY8A 1Q7Y2 3P7JA 1RNIA 1VQ41 2ZXOA 5A2Qf 1JC7A 3QWUA 4JK1C 3VR6A 2HU9A 5JEAG 4OHJA 1S72Z 4EWCA 4H44C 4G7OC 1TWGB 2JEBI 1F9PA 3CC41 3FMCA 4PNYA 2L12A 1EIHA 1SE4A 2EJFC 2EJMA 1NP6A 2F0LA 4CKEA 4A3DB 1Q8IA 3L3OC 3BG1B 2YU9B 4I65A 2RDHA 1SMYD 2JA5I 1PFTA 3PUZA 4TKOB 3M3YB 5EGTA 3FKIB 4A3LI 3MXGA 1KDAA 1B4OA 2RSOA 5C4JB 2EE1A 3BG0B 1E2VA 1JR0D 4KJNA 3I56Z 1DD2A 4PMCA 4NB8A 2A6ED 1D6EC 1STBA 3PO3S 3GTQB 1SEBD 3MVVA 2R92B 1S5CD 3PO2I 3M7NA 2JMOA 5CMDA 2NVQB 1IHZA 2RBMA 2ZXPA 4X3UA 5IGDA 3BVZA 1VF7A 1Y1VS 2F4IA 1JWHC 1Q7Y1 4KN7C 1SNOA 5DM73 2V8KA 2R61A 5COYA 3FPUB 2LFUA 1A3TA 3A8KE 1MSHA 1I3QI 4S3SA 1YHQ1 3M85A 2MP1A 2K03A 1VQO1 2JYOA 2XVSA 1XWEA 1TQOA 2K7VA 5C5MA 4NBFA 1TWHB 3A8JE 4A3FB 3E5SA 5KNCA 2OOYB 3C3LA 1CQFA 2F0IA 3RUZA 3SR1A 1TR5A 4BY7B 4Y52I 2SEBD 2ZAEB 3VR3A 3I90A 2Z4HA 3GP7A 3NE5B 1YIJZ 2DY7A 4C3HG 4FP5D 1LTAD 5JEAH 4J8QA 2WAQB 4E33A 5AN9F 1JJ2Y 3HOYB 4L8JA 4C3JG 3WOEA 1KDBA 1LTRD 3OHXC 1DZ1A 1A6XA 4BY1I 1AP0A 3RZOB 3R2TA 4RS4A 4F88A 1C8CA 2VF1A 4KN4C 5G3LD 1EU4A 4B9XA 4IUUA 5E4XA 1NJI2 4LAAA 3PIO3 1PDQA 2KPIA 2M48A 2Z8LA 3HOWB 2FHTA 4CHTB 1STYA 1E0BA 4G57A 2HUGA 1I4HA 2Q8TA 2E75C 2FMCA 4EGVA 5BN4A 2HCIA 2X6LA 1SNPA 2R3ZA 1B9NA 2IPKD 2NB0A 4DU9A 1WTVA 2EGTA 5ISRA 1U4PA 1IW7D 2RT9A 3OW2Y 2J4XA 1SAPA 2ZXRA 2F0MA 2D9UA 4H0LC 4NB9A 1EYDA 2D2CC 1TU2B 3CCMZ 5KYIA 2RQXA 1K8A1 1KLGD 3GTMB 4V190 2DNCA 2OTL1 1W2BZ 4EQOA 1Y69U 1G6ZA 2X69A 5EJWA 3S2DB 3S1MI 1X3ZA 2VB2X 2XNAC 5F2DA 2XN9C 2F3WA 5C4XI 3S2HI 1D5MC 1SDFA 2JXMB 4HTHA 1Q90A 4MIUA 1BQQT 2B63B 4NBEA 2OTJ1 4Q0FA 1K9M2 1N2FA 1VQ7Z 2WIIB 1H9SA 1RO4A 2XSCA 2PNRC 3R93A 1SYDA 2E2IB 1NJI1 1B1ZA 4XIGS 4IURA 2IT1A 3NTHA 4OL7A 1F2YA 2CW0D 2AQ2B 1ZYRC 3EVQA 3MWYW 2R6MA 2KVMA 3CCL1 1VMPA 2NVXB 1QOHA 2TMPA 2L1BA 1V1PA 1STAA 3K7AB 2QRCB 1ENCA 2JA7B 3PUVA 1EFID 1WTWA 3K5MA 2QREB 4KHZA 1KDCA 5NUCA 4DXFA 1G8ZD 4ILWA 3M4OB 4G7ZC 2F0DA 4A3BB 3MFGA 1WTPA 1Y1WB 2NN6H 1QVFZ 3NDIA 5E4WC 2I3CA 5I9PA 3IKJA 5DNFA 1J9OA 1EEFD 2K01A 1FGBD 3GTLB 2RA4A 5FLXb 2AUKA 2B2UC 5CV4A 4C3JB 5I6WA 1QVGZ 1VQ5Z 5K5PA 5ELFA 3W2DA 1QE6A 3CXCZ 3NTIA 5FK9C 4XQNA 2NVYI 3J7A4 1R4QB 3NHHA 3T56B 1EYAA 2LKVA 4NP5A 3FDTA 1TY0A 3A54A 1QVFY 1IYVA 1GOZA 4ZUIA 1K9M1 1LT6D 3RZDB 4A3JI 4K2KA 1VQ51 1VQNZ 1D5ZC 3NBHA 1CT1D 1GUOA 3TMEA 1CFMA 1DL6A 3VYSA 1DYQA 1JOKA 1CI3M 1CK1A 3D8GA 1TS4A 2HF1A 1YNNC 1D5XC 4E6IA 3HRZC 1HA5A 3VMGA 2F0JA 4HMJA 5C3XA 3Q22A 3C1EA 1SSOA 3G4SZ 2ENBA 3D6CA 1LT5D 4ZKBB 4K8JA 3J80f 2XRSD 1RHPA 3MONA 3TZUA 3G6EZ 4ZLTF 4FYDA 1BDOA 1DOLA 4JBWA 3NQTA 1SNQA 3BDCA 4FO2A 2IW3A 2AQ3B 2MHVA 1P9NA 3P1HA 1I4PA 1X0TA 1EY5A 1N8R1 3CQZI 4HH4A 4E2YA 4RH6A 1UEAB 5FLXE 1ZB9A 1TWCI 1PFMA 2O53A 4RVHA 3I91A 3H91A 1YJW1 1O78A 3I8ZA 1T5EA 2G9HD 3U50C 2E2JI 3D4WA 4QTTA 1BNZA 4MN3A 3CHBD 5EBDA 1EQVA 4R9WA 5CORA 4RCOA 4RGOS 1JICA 3ZYYX 2Q8RE 1E2WA 3VR2A 1GUSA 2H4OA 4B9WA 1G91A 1ET6A 2ICIA 3SK6A 2PM9A 2F1MA 4E2ZA 3MC0B 5ELDA 1AZQA 2IWHA 4ZKCB 1R9TI 4X3SA 1PTOH 3QIAA 3QO2A 2JP1A 3MFYA 4TQUS 2B2VC 1G2TA 2KA7A 2KEDA 3NH8A 5M5YB 1C48A 3TBIB 2EJGC 3QG1A 5D3DA 4LMQD 1B53A 1EY7A 1NUCA 3DWAA 5KGUA 1HFGA 4A93I 1QJOA 1ESFA 2PO4A 2AUJD 2EDGA 2K5WA 4A3GI 1B44D 3SXHA 2B2YC 2GTHA 2F0SA 4O42A 1FYCA 1LT4D 3OPOA 1JQYD 1MI2A 2WINB 2XIWA 3RMHA 4BY1B 4XXEA 1SE3A 5G3LF 1K732 3ERQA 4BBSB 2EPBA 2GU2A 1PZKD 1PYWD 1BCPD 4HMIA 3MHBA 5CV9A 2NYZD 4Q5VA 1VCIA 2KI7B 4Y7NI 5FLXL 1OXXK 3KK7A 4O1NA 2LY7A 3Q6SA 1GHJA 5IP9I 3GTKB 4K8IA 2ID0A 4KY5A 2E2HI 4ZK9B 4IUVA 1Q861 3UI2A 1MBYA 4QIWB 2L0CA 1TVXA 4DA2A 1FNWA 5CYUA 1W6KA 3AMUA 1HQRD 4WJWA 1NR2A 4TSSA 3MZLB 5T67A 1SYBA 4P2CB 1K83I 4DGLA 1C4QA 3QJYA 4MXUA 1SXTA 2QF7A 3TE5B 1M902 2A6EC 2O5IC 1VQ4Z 3D9XA 1HCZA 4DNRB 5CGKA 2NBFA 5C3EI 3GD7A 2Y0SA 1EZ6A 3LX0A 3J80b 2J6AA 2QA41 1JORA 3MXPA 3A55A 2RBLA 3NH4A 1VQL1 1KABA 3Q24A 1RTOA 3MA2B 3BYYB 4IUQA 2R7ZB 5M3FB 4F87A 1NCVA 3L9AX 3CC4Z 2W04A 1HXYD 3S1MB 1DONA 2NN6I 1QB5D 1K731 3OMCA 2OT2A 5C4XB 1YJ91 2KHSA 1ENFA 4DK0A 3NFZA 3S1QI 3R2IA 3H0GB 2F0GA 5IIFA 1ESRA 3GV3A 1A15A 3O13A 5KNDA 3BVMA 4J1MA 2LMCB 1F2LA 5CV5A 3NTKA 3TP8A 4NBDA 2M2LA 2F0TA 4KY7A 2F4MA 1Z02A 1EY0A 1H9SB 5JVH3 2ZT9C 2NVTI 1PZJD 4CJ1B 4IUTA 1MSGA 1RQFA 1LTSD 5HGTA 3KBXA 1EU3A 4DFAA 1LABA 1M8AA 1HA6A 1PXUA 3HGBA 4BBRI 4XQQA 1V1PB 1EYCA 1V8QA 5IGGA 3I07A 3K58A 3BYTB 2DE6A 4XYOA 3HKZB 3F3PC 2C9OA 3AB9A 4R8IA 1U4MA 4CJ2C 1M901 4B08A 2DE7A 4MD8A 3S16I 2A73B 3I4LA 4MONA 2A6HD 2EOTA 5IGFA 1VMCA 1CA6A 1TFIA 2B8GA 3WDNA 3HG9A 3OIPA 3MAQA 5IT9L 3J80E 1RCVD 1OO9B 1L1OC 2A69C 3ESWA 4XX2A 1YHQZ 3F2UA 1LTGD 1VQOZ 1RD9D 2V8IA 2PZTA 3GTGI 5CV7A 4KY6A 3QWNA 1LTTD 5T1IA 1F9QA 2HQEA 3V05A 1K8OA 3S1RI 1DXMA 2RDGA 3PO3B 2V8JA 1Q1EA 2M6NA 4A3JB 3KF8A 3IFUA 3S1NI 1USPA 2WKDA 5FLXf 2L9HA 1L0YB 1H9JA 2F0FA 1SFOI 1YJNZ 4RKLA 4FXKC 3HOXI 2QILA 1TS5A 3K5LA 1Y1VB 4K2LA 3IAYA 4FF2A 3N6RA 2JA8I 4R8NA 3VR5A 3MXNA 2V4DA 3CCE1 1G2SA 1RDPD 3I4NB 1PLFA 3NWSA 1YJN1 2AWOA 1K8A2 5M9OA 5EPKA 2RKSA 1SNCA 5EPJA 3J7YW 1YNJC 3TP5A 1EEID 1ZKOA 3G711 3CCQ1 3SVMA 1HRJA 3T16A 1B50A 1Q821 1QNKA 3G7LA 5D1OA 3CQZB 3JAMb 1LTBD 1AN8A 4WFN3 1YUAA 1VQ81 4KMUC 2M9VA 1M1K1 1XXGA 1S5FD 1CHQD 3EERA 5C6AA 1D1KA 2NN6G 4X3KA 5KRUA 3NSWA 3GV6A 5I4DA 2I46A 3FEWX 5EKKA 5C5LA 2QR1B 1HUMA 3GCFA 5KNBA 3IFTA 2QLVB 5LL6S 1U9RA 3J80L 1PTOD 1YUKA 1KNAA 4DK1A 3CCS1 1STEA 3GTOB 2OTLZ 1AZPA 2K32A 3VB9A 1SJHD 1ILQA 1LACA 1PFBA 3I551 2A68C 5FO9B 2EY1A 3CCV1 4RV9A 4A3KI 1YI21 2KCNA 4C3IG 2B39A 5CBAE 1OXSC 4NBBA 2OTJZ 1BCPB 2FJ2A 1XX8A 3C46A 4CJ0B 4RCNA 4QUCA 1SBBB 2AKLA 1UUPA 2PW5A 4H7BA 2JA6I 4K6LA 2PPBC 4A93B 2DN8A 3T13A 1JE4A 1G291 4FF1A 4A3II 5IT9f 4A3GB 3CCLZ 3K0YA 1A2UA 3JAME 4ULLA 1VF5C 1W2BY 5ELBA 2MGSA 5HURA 2H1EA 2P28A 2BDOA 3LWUA 2H85A 1T5XD 4L63B 3K6OA 4A3EI 2PW7A 1FNVA 4XTCS 1ZEQX 4A3MB 2J7ZA 2F0HA 3V96A 1TWFI 3FRPB 5EKLA 3MZKB 1S5BD 4NBGA 4IUPA 2OOXB 4NDXA 3CCJ1 3CC21 1GUWA 2CHBD 1SNDA 2SOBA 4LJZC 1R4PB 1WCMI 3DHQA 4C3HB 3GQBA 2EYOA 1N8R2 4KI0A 1IKMA 2LIYA 3FKII 4CGYB 1EWCA 1K83B 1II3A 2J0TD 4DAYA 2DE5A 2Q4ZA 3DM1A 1GUGA 4IALA 4RGMA 1ZB8A 1VQ9Z 4E30A 1HQMC 1EY6A 2R92I 5BN5A 1BR9A 1BF4A 5IP7I 1A2TA 4WRDA 2NVQI 1EY9A 2G2KA 3PIP3 2QDBA 3VR4A 3CU7A 4EQNA 2BOSA 1HFNA 3H09A 4M1UB 4C56C 3ND9A 2GTIA 1VQ91 5C3WA 2VUMI 3IFDA 2B2WC 4QB4A 2JUBA 1QVGY 3TDQA 2K33A 4UDUC 1DJRD 3CXCY 1X3PA 1VQM1 3GKQA 3S1QB 3OWEB 1TT2A 4KTAA 4NH1C 5D65A 2R6GA 2RDFA 5JOBA 4RA8A 3CC71 2B2UA 3D3RA 2EY6A 1SYFA 2F0UA 4TNUA 1YIT1 2BJOA 5IODA 5C4HA 2YADA 3JAML 3CKIB 4MD9A 4A3FI 4RVFA 4MD7A 5E1FA 5KEEA 2NVTB 1WD1A 1CHPD 3L7ZC 5C0XJ 2WB1A 1QF8A 2QEX1 3EFXD 4Z9CB 1YJWZ 1SE2A 2K28A 3CCR1 1VQP1 2CQAA 4IZ8A 3TP7A 2FFKB 2JA5B 4BBRB 5D14A 4C3IB 1OXUA 1I6VC 1I6HI 5I9OA 5IOCA 4NOZA 4AYBA 1A3VA 5C44I 4DAVA 2F0NA 2SNSA 3BG3A 1VLAA 1O7YA 1PMRA 2L11A 3CD61 3SK5A 3A7AB 3S16B 3TDHB 3QB3A 1RF2D 3PO2B 3FQMA 1LV9A 1MD2D 4MHEA 4FVMA 3CME1 1BCPC 4K5XA 3VA5A 2F03A 4RVGA 1F9RA 2Q8IB 1FNUA 3GTGB 2WACA 5JJZA 2HDLA 1ICWA 1QNUA 3HOZI 4NBAA 1Q862 1I3QB 4NBCA 3VYTA 3VMHA 4KHVA 3ITPA 2QRDB 3S1NB 5IT9b 2A74C 3H3VC 2WV6D 1KLUD 3KLSA 1SYGA 1VQK1 2OZKA 5DEHA 1SFOB 1MGSA 2KUMA 3J7AF 2O5JC 1USPB 5C0XH 4KV6A 3HOXB 3D4DA 4RWSC 5K36G 2PCFB 3J7AV 2EY5A 3DWQA 3DUZA 2QCPX 2JA8B 3J81b 1RTNA 3S14I 1O7LA 1ENAA 2EYPA 3WOFA 2F0PA 2PYKA 4DN4M 2B2TC 2JNYA 1KNEA 3GTMI 4FXGC 5C4ZA 1V1OA 2O2LD 2VXWA 5IGCA 1H9RA 2ICEC 1TS2A 3FVQA 1PTOB 2JS4A 4IFDJ 1D1IA 1F77A 5CC4A 4U68A 3K5NA 2B2VA 4H13C 3ND8A 4TRDA 3HP3A 3W3AA 5J39A 4RGTA 4J6HA 3CRKC 2BE5D 2EVBA 3CMAZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOT A;  1SAP A;  2E2I I;  1VMC A;  4RAU C;  1CA6 A;  3MTS A;  1TFI A;  1Y1V I;  4BY7 I;  2D9U A;  4NB9 A;  1L1O C;  3ESW A;  4XX2 A;  3F2U A;  2X6G A;  3GTG I;  2NVX I;  3I4N I;  2RSN A;  3IL8 A;  5T1I A;  1F9Q A;  2B2Y A;  1G6Z A;  2X69 A;  2B2W A;  3S1R I;  2BDN A;  5EJW A;  1IKL A;  3S1M I;  1X3Z A;  3HOY I;  4XT3 B;  1WTO A;  1ML0 D;  5C4X I;  3S2H I;  1O7Z A;  3S1N I;  1USP A;  1SDF A;  4NBE A;  1NAP A;  2L9H A;  3RZO I;  1EQT A;  1N2F A;  2K05 A;  1SFO I;  1RO4 A;  4A3B I;  3HOX I;  2KEE A;  3R93 A;  4XDX A;  4XT1 B;  2NWG A;  4IUR A;  1WW9 A;  2JA8 I;  3DEP A;  3MWY W;  1NR4 A;  2KVM A;  4NW2 A;  1VMP A;  1G2S A;  1PLF A;  3HOW I;  1U4L A;  2L1B A;  1ILP A;  5EPK A;  5EPJ A;  1WTW A;  1ML8 A;  3SVM A;  1HRJ A;  3RZD I;  1B50 A;  2KEC A;  4HCS A;  1QNK A;  4X6A I;  3G7L A;  1WTP A;  1EOT A;  3GTO I;  5E4W C;  1YUA A;  2FIN B;  5CM2 M;  5DNF A;  1Q3L A;  1HUN A;  1J9O A;  2K01 A;  1X3Q A;  2RA4 A;  2CVR A;  3EER A;  2B2U C;  2FMM A;  4X3K A;  1QE6 A;  2K5R A;  1S4Z A;  3GV6 A;  4HSV A;  2NVY I;  5EQ0 A;  2IL8 A;  3FDT A;  3Q87 A;  1HUM A;  3S2D I;  2HDM A;  3I3C A;  3D6W A;  3GCF A;  4NBH A;  4ZAI A;  4A3J I;  2B63 I;  1KNA A;  1B3A A;  1RJT A;  3S15 I;  1EIG A;  5EPL A;  1AZP A;  3VB9 A;  1DL6 A;  1ILQ A;  2HF1 A;  1CM9 A;  1PFB A;  1XYI A;  3VMG A;  4A3K I;  1SSO A;  5CBA E;  4UAI A;  4NBB A;  4ZKB B;  2FJ2 A;  5EKI A;  1XX8 A;  2B2T A;  1RHP A;  4CJ0 B;  4QUC A;  2AKL A;  2SDF A;  4ZLT F;  3K7A I;  3GTJ I;  4MH4 A;  2JA6 I;  4A3M I;  1EL0 A;  2JA7 I;  1DOL A;  1NUI A;  1JE4 A;  3TN2 A;  3M4O I;  4A3I I;  1LQL A;  2HCC A;  3HOV I;  1BBX C;  1X32 A;  1QYP A;  4A3C I;  1Y1W I;  3ONA B;  3N52 A;  3CQZ I;  2L4N A;  3VMI A;  5T1G A;  1ZB9 A;  1TWC I;  1PFM A;  2MGS A;  1DOK A;  2H1E A;  3I91 A;  3GTL I;  3H91 A;  1TWA I;  2PK7 A;  4HAE A;  3I8Z A;  4A3E I;  3U50 C;  2E2J I;  4QTU A;  2P3Y A;  4QTT A;  1BNZ A;  4MN3 A;  2N88 A;  2J7Z A;  4R9W A;  1QG7 A;  1IL8 A;  5COR A;  2K1B A;  3H3V J;  1TWF I;  1JIC A;  1CA5 A;  3LWE A;  3KUP A;  4NBG A;  4IUP A;  2Q8R E;  1F9S A;  1WVL A;  1GUW A;  3DEO A;  1G91 A;  1WCM I;  1O80 A;  4OIK A;  3TZD A;  3I4M I;  2DY8 A;  3P7J A;  1WTR A;  1AZQ A;  4ZKC B;  1R9T I;  1IKM A;  5CBE E;  3FKI I;  4X3S A;  3LUS A;  3GTP I;  3QO2 A;  2JP1 A;  2RVL A;  2DE5 A;  2B2V C;  3DM1 A;  1G2T A;  4BBS I;  2K04 A;  2R93 I;  2KED A;  1ZB8 A;  1F9P A;  1BO0 A;  1WTX A;  4LMQ D;  1B53 A;  2R92 I;  3HOU I;  1BF4 A;  5IP7 I;  2L12 A;  1EIH A;  2NVQ I;  1HFG A;  4A93 I;  2NZ1 D;  1HFN A;  1PFN A;  4A3G I;  5AFW A;  3GTK I;  2B2Y C;  2VUM I;  3IFD A;  2JA5 I;  1PFT A;  4O42 A;  1WTQ A;  2B2W C;  3S17 I;  1X3W A;  1MI2 A;  4A3L I;  2XIW A;  1X3P A;  1B4O A;  2RSO A;  2EE1 A;  4QUF A;  3GTM S;  3GKQ A;  4X3T A;  5D65 A;  4NB8 A;  2EPB A;  2B2U A;  4RA8 A;  2BJO A;  3PO3 S;  4A3F I;  1WD0 A;  3PO2 I;  5CMD A;  2NYZ D;  1WD1 A;  4Y7N I;  4X3U A;  3Q6S A;  2K28 A;  5IP9 I;  1I50 I;  2E2H I;  4ZK9 B;  2FFK B;  4IUV A;  1Y1V S;  5FLM I;  3UI2 A;  5D14 A;  1TVX A;  2R7Z I;  1I6H I;  4NOZ A;  5COY A;  3FPU B;  2MJ8 A;  5C44 I;  1MSH A;  2KOL A;  2JR6 A;  1I3Q I;  1NR2 A;  1VLA A;  1O7Y A;  2L11 A;  2MP1 A;  2K03 A;  2JYO A;  2N55 A;  1K83 I;  3H0G I;  2F4O A;  4NBF A;  1TWG I;  1LV9 A;  4Y52 I;  4MHE A;  5C3E I;  4OIJ A;  1F9R A;  4A3D I;  2J6A A;  3I90 A;  2YU9 I;  2RBL A;  5JJZ A;  2HDL A;  1ICW A;  2DY7 A;  1RTO A;  4IUQ A;  1DOM A;  3HOZ I;  1RLY A;  1NCV A;  4NBA A;  1DON A;  4NBC A;  1ZXT A;  3M3Y I;  3VMH A;  1DZ1 A;  5C4J I;  4BY1 I;  1AP0 A;  3S1Q I;  1ESR A;  1MGS A;  2KUM A;  3GV3 A;  1A15 A;  1USP B;  4HED A;  1B2T A;  4RWS C;  1C8C A;  1F2L A;  4NBD A;  2M2L A;  3GTQ I;  2F4M A;  4IUU A;  5E4X A;  1RTN A;  3S14 I;  2NVT I;  4CJ1 B;  1PDQ A;  2KPI A;  1HHV A;  4IUT A;  1MSG A;  2FHT A;  4DN4 M;  2B2T C;  1J8I A;  2JNY A;  1KNE A;  1ROD A;  4BXX I;  3GTM I;  3KBX A;  1E0B A;  1M8A A;  1HA6 A;  4BBR I;  2HUG A;  2MPM A;  2VXW A;  2Q8T A;  2HCI A;  3PO3 I;  3I07 A;  2X6L A;  2DE6 A;  2JS4 A;  2R3Z A;  4U68 A;  1WTV A;  2B2V A;  4R8I A;  3HP3 A;  1U4M A;  1U4R A;  4CJ2 C;  1U4P A;  2DE7 A;  3S16 I;  1TWH I; 
#chains in the Genus database with same CATH topology
 2HD3 A;  4NFR A;  5D1O B;  2E2I I;  3L0O A;  1IZ6 A;  2JIP A;  4A3K H;  1UAP A;  4KKT A;  2VUM G;  1U5K A;  3K0X A;  3SE0 A;  2F0V A;  4LF7 L;  4R1J A;  5M5X B;  4DK6 C;  1IBL L;  3VYR A;  2NVX I;  2F0O A;  2F0Q A;  2RSN A;  1NSN S;  1QUQ B;  4L5R C;  2B2Y A;  3CMA 1;  2EXD A;  1EZ8 A;  3JAM f;  1SMY C;  5IT9 E;  3ULJ A;  3EED A;  2LXK A;  4ZUJ A;  4A3I H;  2IX1 A;  3T4A C;  4ODG A;  1O7Z A;  4A3F G;  2K5D A;  5J22 A;  1I50 H;  2HQL A;  2QA4 Z;  1SMX A;  3NEM A;  1C9O A;  2EXZ A;  1NAP A;  4J15 A;  1SR3 A;  2QW7 A;  4A75 A;  1HNW L;  4V0B A;  1VQL Z;  4LK1 C;  2CCZ A;  2K05 A;  3M7G A;  5JPM C;  4A3B I;  2KEE A;  4XT1 B;  3J81 E;  1Q86 C;  2JEA I;  2NWG A;  1A3U A;  1IBK Q;  2WB1 G;  2XWJ B;  4PV1 C;  3SHL A;  1UEB A;  3J81 i;  2A6H C;  1YJ9 Z;  4HGZ A;  3DEP A;  3RLO A;  1CTM A;  2OF1 A;  1A63 A;  2KBN A;  4NW2 A;  4ALP A;  1U4L A;  1TY2 A;  5C44 G;  4G7H C;  1DCZ A;  2YTY A;  2E2D C;  1ILP A;  4K5V A;  2G9D A;  2LFN A;  1I4G A;  4AYB G;  5JJL A;  2JA6 B;  1FDI A;  1Z01 A;  2DUD A;  1TWF H;  3GO5 A;  1Z6H A;  5D3I B;  1KRL A;  4LWC A;  4MZ9 A;  4QCL A;  5K36 H;  1SRU A;  3NP8 A;  4A3D H;  4BS9 A;  3S2H B;  2NUC A;  3SK4 A;  1LTI D;  1UE5 A;  5BN3 A;  1XPR A;  3RZD I;  2VPX A;  2KEC A;  2F3I A;  4X6A I;  1QZH A;  1EOT A;  4YWK A;  2VUG A;  1AEX A;  2UUC Q;  2NZH A;  2YYZ A;  3FKI H;  4BA2 I;  1LO5 D;  1H9K A;  1Q3L A;  4UY8 C;  4JI2 Q;  3J81 c;  1X3Q A;  3HOZ G;  2D62 A;  2CVR A;  1K73 C;  3QR8 A;  3RNU A;  4E32 A;  1OXV A;  4OEM B;  4A3E B;  4JOI C;  2FMM A;  2NTS A;  3MZ5 A;  3TS2 A;  3CCU 1;  3A56 A;  4KKU A;  3GTQ H;  2R92 H;  1S4Z A;  5IP7 H;  4DR5 L;  1VQ6 1;  3ERO A;  4OEL B;  3NUC A;  1OXT A;  1BBW A;  1JCK B;  2NVQ H;  1JWS D;  1TWF B;  2IL8 A;  1KAW A;  3I3C A;  1Z47 A;  1NTG A;  4LUZ A;  1EWI A;  2EYH A;  3OMG A;  3EIV A;  1S72 1;  3EN2 A;  5E7N A;  2VUM H;  2F0K A;  1B3A A;  1WCM B;  3A8I E;  3NK9 A;  2Z4I A;  4E31 A;  4UP7 A;  5FKA C;  3S15 I;  3SEB A;  1Q82 2;  1EIG A;  1HNX L;  1K0S A;  1STH A;  4B3R Q;  2LEX A;  3FPP A;  1KD1 2;  4G4K A;  4H02 A;  1UE6 A;  4XYQ A;  1STN A;  1LT3 D;  1CM9 A;  4M8A A;  5FOB B;  1XYI A;  5JJK A;  4CDD C;  2JIQ A;  1JMC A;  5JEA J;  1GUT A;  1TKW B;  1VQ4 A;  2C5C A;  5KIX A;  1M1K 2;  1K28 A;  4IQZ A;  3KDF B;  5EKI A;  4A3F H;  1PRT D;  2NVY B;  2QKI C;  4DAY B;  3BDL A;  4E2X A;  2EYM A;  3CPW Z;  2I5M X;  1Y8C A;  4P75 A;  1JB3 A;  4LF6 Q;  4U67 3;  3R8B A;  3GTJ I;  3PSI A;  1M90 C;  4OWW B;  4JC0 A;  3J81 L;  1VQ6 A;  3OTO L;  5IYB H;  3TN2 A;  2XWB B;  1QXF A;  1EY4 A;  3I56 1;  4OO1 H;  1GKH A;  2HCC A;  3CCE Z;  3HOV I;  3PUY A;  1B9M A;  1S5E D;  1X32 A;  2VUM B;  4ZYS A;  1I6H H;  1QYP A;  5I2X A;  2JN4 A;  4L6T B;  5LHY 1;  1PZI D;  4IO9 A;  3ONA B;  1PTO C;  2L4N A;  4ID6 A;  2PMZ A;  3VMI A;  1TII D;  4IOA A;  1EQR A;  1DGS A;  3AU7 A;  1BKB A;  1IW7 C;  1X54 A;  3CPW Y;  1XJV A;  1KXL A;  2WKC A;  3G71 Z;  1TWA I;  2VW9 A;  1L1O A;  1IBK L;  2GA4 B;  3CCQ Z;  1JJ2 Z;  1JWU D;  2XRQ D;  3OWF A;  3PF4 A;  1ASY A;  2XGT A;  3DWP A;  1FVI A;  3G6J B;  4QTU A;  1I4Q A;  2P3Y A;  5GAH C;  2N88 A;  2R7F A;  4X64 Q;  3P20 A;  1VQ8 Z;  1QG7 A;  2ZTD A;  1IL8 A;  3X3M A;  3H3V J;  4CDC C;  4GZY C;  1CA5 A;  2LS0 1;  3LWE A;  4LFA Q;  1F9S A;  4UP8 A;  1GXD C;  2PZW A;  4K5W A;  1AFP A;  2RIQ A;  5J1Z A;  1K8G A;  2WB1 B;  3DEO A;  2W03 A;  2DNE A;  3EQL C;  3DXJ C;  4FXD A;  4CL1 A;  1KD1 1;  1I6H B;  1KRS A;  1LYL A;  4HN7 A;  4QF4 A;  3I56 A;  3TZD A;  3I4M I;  5C0X I;  4HJ8 A;  5C44 B;  2I07 B;  1WTR A;  2VZA A;  4JBJ A;  2Q51 A;  4WJ4 A;  1TWC B;  3D2L A;  2Y0S E;  5CBE E;  2DJG C;  2RPR A;  3LUS A;  4AYB B;  3GTP I;  1SJE D;  4JI2 L;  2RVL A;  2ASB A;  3U9O A;  1YIJ 1;  2EYF A;  1XPU A;  2E2J B;  2CW0 C;  4BBS I;  2K04 A;  2R93 I;  3A74 A;  3SDZ A;  3VA7 A;  3CCS Z;  1YHQ A;  2BA1 A;  1DM0 B;  1Q82 C;  1VQO A;  5EBC A;  1CSQ A;  2M00 A;  1BO0 A;  2KQ3 A;  4OX9 Q;  1WTX A;  1F2Z A;  2A69 D;  3HOU I;  3S14 H;  4OGQ C;  2JE6 I;  3FQQ A;  3I55 Z;  2HIX A;  2CH4 A;  1UNS A;  1CZG A;  3CCV Z;  2NZ1 D;  3PIO A;  3GTM H;  1YI2 Z;  5D1P A;  2ZM6 L;  1KAA A;  1M1K C;  4DR2 Q;  3OW2 Z;  4IPC A;  1PFN A;  3KLR A;  3OOC A;  5A35 A;  1ONL A;  2NTT A;  3PUX A;  5AFW A;  3HOZ B;  3GTK I;  3K59 A;  1XMQ Q;  2MFI A;  3MEH A;  4GN4 B;  1WTQ A;  3S17 I;  4N8F A;  4HSP A;  1X3W A;  4F8M A;  4K6D A;  1R9T B;  2QEJ C;  4CKC A;  3RLF A;  3GTM S;  1SNM A;  1E2Z A;  4QUF A;  3BS1 A;  4B3R L;  5CV8 A;  4X3T A;  5E3F A;  1AW7 A;  3VTN A;  2E2I H;  5A2Q b;  1YIJ A;  4LF4 Q;  1WD0 A;  2VB3 X;  3IRB A;  4LF8 Q;  4RMF A;  3S14 B;  1VQE A;  2MNA A;  4N9P A;  4LF6 L;  4ZCK A;  2L5T A;  2NVX H;  1UE1 A;  4EVO A;  1I50 I;  4C2M H;  4EQP A;  1PHJ A;  5FLM I;  2C35 B;  3MXU A;  1YNJ D;  2R7Z I;  1W6J A;  3OW7 A;  3DMU A;  2RHB A;  2JA7 H;  4RHS A;  5HY6 A;  2MJ8 A;  1KRT A;  2JR6 A;  1Q81 2;  2KOL A;  4GOP B;  1I4X A;  1BCP F;  4NMZ A;  2YTV A;  4DNT B;  4LF5 Q;  3J81 f;  3CCM 1;  3KIH A;  4DUZ Q;  3CCJ Z;  3CC2 Z;  2N55 A;  3EJI A;  4A3B H;  4A3C H;  3H0G I;  2CKZ B;  1Y1W H;  4IUN A;  1OTC A;  2F4O A;  1K3B C;  2PQE A;  1TWG I;  2Z1C A;  4HJ9 A;  4HID A;  5M3M G;  4CKB A;  3HEJ A;  2ZTC A;  4KD3 A;  3HOV G;  3I73 A;  4IFD I;  4Y7N B;  1TS3 A;  1JOO A;  3S9W A;  4X64 L;  1RL2 A;  4OIJ A;  5T64 A;  5CV6 A;  4A3D I;  2AQ1 B;  4C3J H;  2R7D A;  2YU9 I;  1FD7 D;  2E2H B;  1S5D D;  1LLR D;  1VQ7 1;  3RN5 A;  2K14 A;  1GJX A;  4PQX A;  1DOM A;  2E76 C;  2V45 A;  4C2M B;  2AWN A;  1RKN A;  3NH5 A;  1MJC A;  1RLY A;  4BWG B;  2IX3 A;  3E0J A;  2PMZ E;  4S1T A;  4JI0 Q;  3KJO A;  1ZXT A;  3BZD B;  5IGE A;  3M3Y I;  3F2C A;  3HKZ A;  3ER0 A;  4HCE A;  3X3N A;  3RZD H;  5C4J I;  4FF3 A;  5H1S E;  1FJG L;  4X6A H;  2KCC A;  1HR0 Q;  1YEZ A;  3T4N B;  3SK8 A;  4HED A;  1B2T A;  5A2Q E;  3CCM A;  2A1A A;  1GD7 A;  1D2B A;  2A68 D;  2OTJ A;  3BDO A;  4DXG A;  3OIQ A;  3GTQ I;  1HH2 P;  5LMU Q;  1W2B A;  4YWL A;  5C3E B;  2N8N A;  1Y8P B;  3V2T A;  1VQM Z;  1L0X B;  5C0X G;  3I4M G;  2MUY A;  3TSS A;  1HHV A;  2Y0S B;  3P75 A;  1J8I A;  5LL6 f;  3CC7 Z;  1ROD A;  4BXX I;  4CBV A;  1H9M A;  1Q12 A;  1YIT Z;  1RO2 A;  1Y8O B;  4YIJ A;  1A8V A;  4PMW A;  4DR2 L;  1CQV A;  2VNU D;  1Q81 1;  4GNX B;  2MPM A;  5M5W B;  1AA6 A;  1XMQ L;  3RR5 A;  1EFW A;  2F52 A;  3HKS A;  4BBS G;  2JSO A;  5I2Y A;  2R93 G;  2JA9 A;  2QKD A;  3PO3 I;  3CRL C;  1EYG A;  1Z9F A;  2QEX Z;  3HOU G;  3S15 H;  5BR8 Q;  1JOQ A;  4RVD A;  3CCR Z;  1XTD A;  1VQP Z;  2BCO A;  1U4R A;  4JI8 L;  4AQY L;  4PZ8 A;  1Q1B A;  3R3O A;  2O4H A;  1TWH I;  1ZYR D;  3D31 A;  5FO8 B;  3C2P A;  4RAU C;  1BXT A;  3MTS A;  4FF4 A;  3T51 B;  1Y1V I;  5JVG 3;  4LF7 Q;  4BY7 I;  4DQY B;  4LF8 L;  4APV A;  3M4Y A;  4I7Z C;  2RHQ B;  2WAQ A;  1PRT B;  3LNN A;  3CD6 Z;  1J6Q A;  1VQN 1;  2X6G A;  3QOJ A;  1XTC D;  3I4N I;  2AKW B;  2E74 C;  2F0E A;  1IYU A;  4OO1 I;  5IWA Q;  4KKS A;  3IL8 A;  3H94 A;  4JI5 L;  4C1N K;  2TSS A;  3GTJ H;  3F2B A;  3Q23 A;  3I70 A;  4IN3 A;  4A3K G;  2B2W A;  2D0O A;  2BDN A;  1IKL A;  1E1O A;  3HOY I;  4YCV A;  1P8L A;  1GUN A;  1VQH A;  4XT3 B;  3CME Z;  1EIF A;  3HOV H;  1WTO A;  1ML0 D;  3D4R A;  3G4S 1;  3A7L A;  2ZTE A;  3RZO I;  1EQT A;  3S15 B;  3NXW A;  2BA0 A;  3PMF A;  3IF8 A;  5ELE A;  2K3R A;  1CZW A;  4DUZ L;  2JQO A;  1HTP A;  3IX0 A;  1QVG A;  1VQ5 A;  1K8M A;  3G6E 1;  4XDX A;  1CSP A;  5GQO A;  5DM6 3;  1E22 A;  1UE7 A;  5IGB A;  1PRT F;  3VYU A;  1TWA H;  3JC6 6;  4QMG A;  1WW9 A;  3U9S A;  2BE5 C;  3C1F A;  5FLM G;  1KL9 A;  3NQI A;  2R7Z G;  1EQQ A;  1NR4 A;  1VQK Z;  3CPF A;  1RO0 A;  3F3F C;  3HOW I;  4K14 A;  3I72 A;  4RGN A;  5I6Y A;  1N33 L;  5M5Y H;  2EYL A;  3D0F A;  1YNX A;  4LUV A;  4JI4 Q;  1GHK A;  1WII A;  2OXP A;  4C1N I;  3S1R B;  4Y52 H;  5A2Q L;  3GTJ B;  1Y8N B;  1VQN A;  4E2W A;  3KIF A;  4KD4 A;  3QOL A;  1I4R A;  3HZX A;  2YTX A;  3H0G G;  1SLJ A;  4BA1 I;  1JJC B;  3RD4 A;  5M3M B;  4LFC Q;  4DR4 Q;  4DGZ A;  1ML8 A;  3HOV B;  3OYY A;  4F7X A;  4CDE C;  4IFD G;  4QGU A;  4HCS A;  5T6B A;  2E9H A;  1Q8K A;  1BUV T;  3I4M H;  4B3T Q;  2A5H A;  3WWV A;  1YNN D;  3GTO I;  3F8T A;  4OON A;  1QWY A;  4A3D G;  5KYL A;  1HR0 L;  1HPC A;  3S24 A;  2FIN B;  5CM2 M;  1QIL A;  3GTP H;  1KC8 2;  4BY1 H;  1HUN A;  1EY8 A;  5CR3 A;  1YHB A;  3PQI A;  4AH6 A;  1EWH A;  2EY2 A;  1S40 A;  2IZ4 A;  5DLQ E;  1TWA B;  5DAU A;  5FLX c;  2PMZ B;  1S7M A;  2Q2I A;  3G6E A;  5LMU L;  1PH5 A;  4DAP A;  4BBS H;  1HR0 W;  2D5D A;  5LL6 X;  3KLS X;  3LGJ A;  4DV2 Q;  4DR5 Q;  1W3S A;  1F2M A;  3I4O A;  2IX0 A;  2K5R A;  1L1O B;  1YJW A;  4HSV A;  5FJ8 H;  4FNF A;  4HGY A;  1KQS Z;  1STG A;  5EQ0 A;  5JPN C;  4RFB A;  2K5Q A;  2PI2 E;  3Q87 A;  3HKZ G;  3S2D I;  2HDM A;  2N49 A;  3D6W A;  1PFS A;  2SNM A;  4DF7 A;  1PV4 A;  3BJU A;  5FO7 B;  4NBH A;  4ZAI A;  2OEO A;  4N9T A;  1JWM D;  3GTK H;  2B63 I;  2K5V A;  1RJT A;  4QQB X;  2NAP A;  2GVA A;  5EPL A;  3I4M B;  3H3V I;  1ZH1 A;  5BR8 L;  2UXB Q;  2EYJ A;  3E3X A;  3GTP B;  1KTK A;  4BXX G;  4PMB A;  2EZV A;  1KQS Y;  1V43 A;  5ELC A;  5GAG C;  4UAI A;  2R93 B;  1VQJ A;  1CKN A;  2B8F A;  2B2T A;  3PO3 G;  3URY A;  1SYC A;  4KJO A;  4R4C A;  5JAV A;  1M4V A;  3HOU B;  1Z7T A;  2PZU A;  1PTO F;  2SDF A;  3OTO Q;  3K7A I;  1HTL D;  4MH4 A;  3TQY A;  5IWA L;  4DR6 Q;  4A3M I;  1EL0 A;  3OSO A;  2JA7 I;  2O4X A;  1NUI A;  3E6Z X;  3TP6 A;  4DV5 Q;  4ZRZ A;  4XQJ A;  3PV0 A;  4ABN A;  2F0W A;  3M4O I;  1Z03 A;  1LQL A;  4MRI A;  4KK7 A;  5FLM H;  3H6M A;  4GNX C;  1Y1V G;  1BBX C;  2R7Z H;  4ME5 A;  2F3V A;  3W5O A;  1QCB D;  4BY7 G;  4A3C I;  3NPP A;  3S17 B;  1KC8 1;  4WOR A;  3IR7 A;  1Y1W I;  3S1M H;  3N52 A;  5IYB G;  2E5L Q;  3T53 B;  1XNQ Q;  2KJX A;  5T1G A;  1IL2 A;  3K57 A;  1ET9 A;  2WB1 E;  4OO1 G;  1DOK A;  4A3K B;  2WAQ E;  3HS0 C;  4EQ5 A;  3GTL I;  2WAQ G;  3H0G H;  2PK7 A;  3BVG A;  3U4Z A;  4HAE A;  1BOS A;  4DAM A;  3NDJ A;  1PH2 A;  4P73 A;  1HNZ L;  2ALY B;  1TWG H;  2IJ0 A;  3P5J B;  4HR7 B;  2ZJQ A;  3HOY G;  2VPY A;  4RHR A;  4RKB A;  4AYB E;  4IFD H;  3NWT A;  3NBI A;  3K5O A;  2WP8 J;  4ZQ3 A;  2K6A A;  4JI4 L;  3Q0A A;  1PRT C;  2L55 A;  1C0A A;  2K1B A;  1A62 A;  1SE8 A;  2YU9 H;  4A3I B;  3KUP A;  3A0J A;  1FR3 A;  4NKL A;  1VDZ A;  3KBG A;  1WVL A;  2N3S A;  4KLK A;  1I50 B;  3Q8D A;  1JJG A;  4LFC L;  4DR4 L;  3EA6 A;  5TSS A;  3CP0 A;  2IZ3 A;  3CCU Z;  1O80 A;  3PUW A;  1SYE A;  4OIK A;  3M3Y H;  4WJ3 M;  1VQ6 Z;  2G5D A;  3A5Z B;  2DY8 A;  1Q7Y 2;  3P7J A;  1RNI A;  1VQ4 1;  2ZXO A;  4B3T L;  5C4J H;  3HOW G;  5A2Q f;  1JC7 A;  3QWU A;  4JK1 C;  1AE2 A;  1GVP A;  3VR6 A;  1PH8 A;  1XMO L;  2HU9 A;  5JEA G;  1LTL A;  4OHJ A;  2I5L X;  1S72 Z;  4EWC A;  4H44 C;  4G7O C;  1TWG B;  4DPG A;  2K75 A;  2JEB I;  4GLA C;  4DV2 L;  4IOC A;  2ATW A;  1PH3 A;  1F9P A;  3CC4 1;  3FMC A;  4PNY A;  1BVS A;  1U0L A;  2L12 A;  1EIH A;  1SE4 A;  2EJF C;  2EJM A;  2ZM6 Q;  1NP6 A;  2F0L A;  4CKE A;  4A3D B;  1Q8I A;  3L3O C;  3BG1 B;  1SRO A;  3K7U C;  2VQF Q;  2YU9 B;  1V1Q A;  4I65 A;  2RDH A;  4BXX H;  4JVZ A;  3AYH B;  1SMY D;  4TVA B;  2V3V A;  2JA5 I;  1PFT A;  3PUZ A;  4TKO B;  3PO3 H;  3M3Y B;  5EGT A;  3FKI B;  3STB C;  4A3L I;  3MXG A;  1KDA A;  1B4O A;  2RSO A;  5C4J B;  2EE1 A;  4X66 Q;  2UXB L;  3BG0 B;  1E2V A;  1JR0 D;  4N8X 1;  3M9B A;  4KHP Q;  4KJN A;  4R4I A;  3I56 Z;  1X56 A;  1DD2 A;  4PMC A;  4NB8 A;  2A6E D;  2ES2 A;  4JOI A;  1D6E C;  1TWH H;  1YJ9 A;  1STB A;  5JJI A;  3PO3 S;  1YZ6 A;  4JW0 A;  3GTQ B;  1SEB D;  3MVV A;  2R92 B;  1Y1V H;  1S5C D;  4BY7 H;  3KF6 A;  3PO2 I;  3M7N A;  2B63 G;  2JMO A;  5CMD A;  2NVQ B;  4NXM Q;  1IHZ A;  4DKA C;  3CC4 A;  2RBM A;  2ZXP A;  2RF4 A;  4X3U A;  4DR6 L;  1X3E A;  5IGD A;  1HZ9 A;  3I4N H;  3J80 i;  4DV5 L;  3BVZ A;  1VF7 A;  1Y1V S;  3U58 A;  2F4I A;  1JWH C;  1Q7Y 1;  4KN7 C;  1SNO A;  1AH9 A;  5DM7 3;  2I0Q A;  2V8K A;  3HOY H;  2R61 A;  5COY A;  1XNR Q;  3FPU B;  2LFU A;  1A3T A;  3A8K E;  1MSH A;  1I3Q I;  3W1B A;  3TRZ A;  1E3P A;  4S3S A;  2QGQ A;  4JG2 A;  4P71 A;  2E5L L;  2Z6K C;  1YHQ 1;  3M85 A;  2N78 A;  1XNQ L;  3RZO H;  2MP1 A;  2K03 A;  1VQO 1;  2JYO A;  2XVS A;  4A3M G;  1XWE A;  2JA7 G;  1TQO A;  1PYS B;  2K7V A;  5C5M A;  3CQZ H;  4NBF A;  1TWH B;  3A8J E;  4A3F B;  3E5S A;  5KNC A;  2HT1 A;  2V1C C;  2OOY B;  1PH9 A;  3C3L A;  1CQF A;  2F0I A;  3SGI A;  4LFB Q;  3RUZ A;  3SR1 A;  1TR5 A;  4BY7 B;  4Y52 I;  2SEB D;  1MJE A;  1YBY A;  2K4K A;  4A3B G;  4A3C G;  1SIW A;  1Y1W G;  2ZAE B;  3HOW H;  3VR3 A;  3J80 c;  3I90 A;  2Z4H A;  3GP7 A;  2AMC B;  3NE5 B;  1YIJ Z;  2DY7 A;  4LW1 A;  4C3H G;  4FP5 D;  1LTA D;  5JEA H;  4J8Q A;  2WAQ B;  4E33 A;  5AN9 F;  2A8V A;  1JJ2 Y;  4HJ5 A;  5AJ3 L;  5IE8 A;  3CW2 C;  4DV3 Q;  4GKJ Q;  3RN2 A;  2Z6B A;  1FJG Q;  3HOY B;  1ASZ A;  4L8J A;  4C3J G;  3WOE A;  1KDB A;  1LTR D;  3OHX C;  1DZ1 A;  4LNQ A;  2UU9 Q;  3U4V A;  4DK3 C;  1EUJ A;  4BY1 I;  2L15 A;  1A6X A;  1AP0 A;  3RZO B;  3R2T A;  1N9W A;  2KEN A;  4RS4 A;  3GTO H;  4AIM A;  5J3B A;  4F88 A;  4DR1 Q;  1C8C A;  3MEF A;  4R4T A;  4DV6 L;  2VF1 A;  3UDF A;  4KN4 C;  5G3L D;  1EU4 A;  1KD1 C;  4B9X A;  4IUU A;  4IJL A;  4L5T A;  5E4X A;  3CPW A;  4NXN Q;  1NJI 2;  4LAA A;  3PIO 3;  5GAD C;  2P5Z X;  2EQS A;  1I5F A;  1PDQ A;  2KPI A;  2M48 A;  2Z8L A;  3HOW B;  1X9N A;  2FHT A;  4CHT B;  4JI1 L;  4JV5 L;  1STY A;  2VQF L;  1E0B A;  2Q2H A;  1NMG A;  5EAY A;  4G57 A;  4UHV A;  3S2D H;  2HUG A;  1I4H A;  2Q8T A;  2E75 C;  4HIM A;  1YJN A;  4A93 H;  2FMC A;  4EGV A;  5BN4 A;  2HCI A;  3DLL A;  2X6L A;  1SNP A;  2B63 H;  2R3Z A;  1B9N A;  4JI8 Q;  4IPD A;  4HJ7 A;  4AQY Q;  2IPK D;  4A3G H;  2NB0 A;  4X66 L;  4DU9 A;  4MTK A;  1WTV A;  2WFW A;  2EGT A;  3H3V H;  1Y14 B;  4KHP L;  3G71 A;  5ISR A;  1U4P A;  1IW7 D;  2RT9 A;  3OW2 Y;  2J4X A;  4DV1 L;  1SAP A;  2ZXR A;  2F0M A;  1IBM Q;  2D9U A;  4H0L C;  4NB9 A;  1EYD A;  4A4I A;  2D2C C;  1TU2 B;  1VQ8 A;  3CCM Z;  4NXM L;  5KYI A;  2RQX A;  1K8A 1;  1KLG D;  4JI5 Q;  3GTM B;  2K50 A;  3UE1 A;  2DNC A;  4DV0 Q;  4V19 0;  2OTL 1;  1W2B Z;  2D0P A;  3K7A H;  4EQO A;  1Y69 U;  1G6Z A;  1B70 B;  4A3M H;  1A0I A;  2X69 A;  5EJW A;  3S2D B;  1GO3 E;  3S1M I;  1X3Z A;  2VB2 X;  2XNA C;  3M4O H;  4DUY Q;  5F2D A;  2XN9 C;  4DR3 Q;  2F3W A;  5C4X I;  3S2H I;  5IP9 H;  1XNR L;  1D5M C;  3KLW A;  1SDF A;  2JXM B;  4HTH A;  1Q90 A;  4MIU A;  1BQQ T;  2B63 B;  4NBE A;  2OTJ 1;  4Q0F A;  2JJQ A;  1K9M 2;  4R4Q A;  1N2F A;  1VQ7 Z;  2WII B;  1I94 Q;  2IHF A;  1H9S A;  1WJJ A;  1RO4 A;  2XSC A;  2PNR C;  3R93 A;  1SYD A;  4C3H H;  2E2I B;  1NJI 1;  4RG1 A;  1B1Z A;  4XIG S;  4IUR A;  1VQF A;  3GTL H;  2IT1 A;  3M4P A;  3NTH A;  4OL7 A;  1F2Y A;  2Z0S A;  2CW0 D;  2AQ2 B;  1PH7 A;  1EOV A;  1ZYR C;  1K83 H;  4LFB L;  3EVQ A;  3MWY W;  3F1Z A;  1N33 Q;  2OQ0 A;  2R6M A;  4QJF A;  2KVM A;  3CCL 1;  1VMP A;  2NVX B;  1QOH A;  2TMP A;  1TXY A;  2L1B A;  3CCV A;  1V1P A;  2JIR A;  1YI2 A;  1V9P A;  1STA A;  3K7A B;  2QRC B;  1ENC A;  2JA7 B;  3UDG A;  3PUV A;  1EFI D;  2OTL A;  4NB3 A;  1WTW A;  3K5M A;  3E9H A;  2QRE B;  4KHZ A;  1KDC A;  5NUC A;  4DXF A;  1G8Z D;  4ILW A;  3M4O B;  4GKJ L;  4DV3 L;  4G7Z C;  3HFZ B;  2HHH Q;  2F0D A;  1IYJ B;  4GS3 A;  2UU9 L;  4POF A;  4A3B B;  4JI7 Q;  3MFG A;  1WTP A;  1Y1W B;  2KHI A;  3J7A 5;  2NN6 H;  1QVF Z;  3FP9 A;  3NDI A;  5E4W C;  1L2F A;  2I3C A;  5I9P A;  4DR1 L;  5IYD H;  3IKJ A;  1HZA A;  5DNF A;  1VQG A;  1J9O A;  1EEF D;  2K01 A;  3S1Q H;  1FGB D;  3GTL B;  2RA4 A;  5FLX b;  2AUK A;  2B2U C;  5CV4 A;  4NXN L;  4C3J B;  5I6W A;  1QVG Z;  1VQ5 Z;  5K5P A;  2B29 A;  5ELF A;  3W2D A;  1QE6 A;  3CXC Z;  3NTI A;  4UP9 A;  5FK9 C;  4XQN A;  4BY1 G;  2NVY I;  3CCL A;  3J7A 4;  1R4Q B;  3NHH A;  3T56 B;  5GAE C;  1EYA A;  2LKV A;  2NVT H;  4NP5 A;  3FDT A;  1TY0 A;  2RCN A;  3A54 A;  1QVF Y;  1IYV A;  1N36 Q;  1GOZ A;  4ZUI A;  1K9M 1;  1LT6 D;  3RZD B;  4A3J I;  4K2K A;  2IV2 X;  3PIP A;  1VQ5 1;  5FJ8 G;  2JA5 H;  1VQN Z;  1D5Z C;  3NBH A;  1CT1 D;  1GUO A;  4BBR H;  1YHA A;  3TME A;  3CC2 A;  4A3L H;  1CFM A;  1DL6 A;  4YHH Q;  3VYS A;  1DYQ A;  1JOK A;  1CI3 M;  1CK1 A;  3D8G A;  1TS4 A;  2HF1 A;  4YCU A;  1YNN C;  1Q81 C;  2OWO A;  1D5X C;  4E6I A;  1VS0 A;  3HRZ C;  1HA5 A;  3VMG A;  1IXR A;  2F0J A;  4HMJ A;  4QIW E;  3C1E A;  5C3X A;  3Q22 A;  1SSO A;  1IBM L;  3T1Y L;  3G4S Z;  2ENB A;  3D6C A;  1LT5 D;  4ZKB B;  3S16 H;  4K8J A;  3J80 f;  3B6Y A;  2XRS D;  1RHP A;  4IPG A;  3PO2 H;  3MON A;  1MHW C;  3TZU A;  2YV5 A;  4DV0 L;  3G6E Z;  4ZLT F;  2FXQ A;  3E9I A;  4FYD A;  1BDO A;  1DOL A;  4PZ7 A;  4JBW A;  3NQT A;  1SNQ A;  3BDC A;  4FO2 A;  2IW3 A;  1Q46 A;  2AQ3 B;  2MHV A;  4DUY L;  4DR3 L;  1P9N A;  1UWV A;  4X62 Q;  3P1H A;  4MTN A;  1I4P A;  1X0T A;  1EY5 A;  1N8R 1;  1AE3 A;  3CQZ I;  4HH4 A;  1I3Q H;  4E2Y A;  1I94 L;  4RH6 A;  1UEA B;  1VQ9 A;  1XPO A;  5FLX E;  3S1N H;  1ZB9 A;  1TWC I;  1PFM A;  1HNZ Q;  3UDI A;  2O53 A;  2VY3 A;  4RVH A;  3I91 A;  5M3F G;  3H91 A;  1YJW 1;  1O78 A;  4OXP A;  3I8Z A;  1T5E A;  4GN5 A;  3HOX H;  2G9H D;  3U50 C;  2E2J I;  3D4W A;  4QTT A;  5L37 A;  1BNZ A;  4MN3 A;  5C4X G;  3CHB D;  5EBD A;  3CC7 A;  1EQV A;  1QZG A;  2JA8 H;  4R9W A;  4YWM A;  5COR A;  4MNO A;  1YIT A;  4DV7 Q;  4RCO A;  4RGO S;  1JIC A;  3ZYY X;  3KF6 B;  2Q8R E;  1E2W A;  3VR2 A;  1L0W A;  1D8L A;  1GUS A;  2H4O A;  4B9W A;  1G91 A;  1ET6 A;  2HHH L;  2QEX A;  2ICI A;  3SK6 A;  4GOP C;  2PM9 A;  2F1M A;  4E2Z A;  4P72 A;  2IHE A;  1G6P A;  3MC0 B;  3CCR A;  4JI7 L;  5ELD A;  1AZQ A;  2IWH A;  1XMO Q;  4ZKC B;  1R9T I;  1FDO A;  4X3S A;  1PTO H;  2AHO B;  3QIA A;  1HJP A;  3QO2 A;  4DR7 Q;  2E8G A;  2JP1 A;  3MFY A;  4TQU S;  1LM0 A;  2B2V C;  1G2T A;  2KA7 A;  2KED A;  1K3R A;  3NH8 A;  5M5Y B;  1C48 A;  3TBI B;  3CD6 A;  3G48 A;  2EJG C;  4GKK Q;  3QG1 A;  2RHS B;  5D3D A;  4LMQ D;  1B53 A;  1EY7 A;  4K0K Q;  1NUC A;  3HKZ E;  5HGQ A;  3DWA A;  5KGU A;  2F4V Q;  1HFG A;  2Q2T A;  4A93 I;  1QJO A;  1JB7 A;  1ESF A;  2PO4 A;  2AUJ D;  1SN8 A;  5M5X H;  3I2Z A;  2EDG A;  2K5W A;  1N36 L;  5ELN A;  2CWA A;  4A3G I;  1B44 D;  3KFU A;  3SXH A;  2B2Y C;  2GTH A;  2F0S A;  2CH4 W;  4O42 A;  1FYC A;  1LT4 D;  3OPO A;  1KIX A;  3AQQ A;  1JQY D;  1MI2 A;  2WIN B;  2XIW A;  3RMH A;  4HJA A;  1T9H A;  4BY1 B;  4XXE A;  4YHH L;  2E7Z A;  1SE3 A;  5G3L F;  1K73 2;  2IY5 B;  3ERQ A;  4PG3 A;  4BBS B;  4X65 Q;  2EPB A;  2GU2 A;  1PZK D;  1PYW D;  1BCP D;  4A3J G;  1MKH A;  2UUB L;  4HMI A;  3MHB A;  5CV9 A;  2NYZ D;  4Q5V A;  1VCI A;  2KI7 B;  3VDY A;  4Y7N I;  5FLX L;  1OXX K;  3KK7 A;  4O1N A;  2LY7 A;  3Q6S A;  1FL0 A;  1GHJ A;  5IP9 I;  3GTK B;  4K8I A;  2ID0 A;  4KY5 A;  2E2H I;  4ZK9 B;  5M3F H;  4IUV A;  1Q86 1;  3UI2 A;  1MBY A;  4QIW B;  2JA6 H;  3TS0 A;  2L0C A;  1TVX A;  4DA2 A;  1FNW A;  5CYU A;  1RIP A;  1W6K A;  1S3O A;  1PYB A;  4X62 L;  3AMU A;  1HQR D;  4WJW A;  5C4X H;  3S2H H;  3I4N G;  1NR2 A;  4TSS A;  3MZL B;  4NPS A;  2K5N A;  5T67 A;  1SYB A;  4P2C B;  1K83 I;  4B3S L;  3E0E A;  4DGL A;  1C4Q A;  3QJY A;  3T1H L;  3ZJY C;  4MXU A;  1SXT A;  4PZ6 A;  2PNH A;  2QF7 A;  4B3M L;  3TE5 B;  1M90 2;  2A6E C;  2O5I C;  1VQ4 Z;  2EIF A;  1KC8 C;  3D9X A;  1HCZ A;  4DNR B;  5CGK A;  2NBF A;  1KQS A;  5C3E I;  3GD7 A;  2Y0S A;  2DGY A;  1O7I A;  4A3E H;  1EZ6 A;  3LX0 A;  4DV7 L;  2UUA Q;  3J80 b;  2J6A A;  2QA4 1;  3ULL A;  1JOR A;  4ME3 A;  2RBL A;  3NH4 A;  3A55 A;  1VQL 1;  3MXP A;  1KAB A;  3Q24 A;  1RTO A;  5AJ3 Q;  3MA2 B;  2XTI A;  3BYY B;  4IUQ A;  4GNX A;  2R7Z B;  5M3F B;  4F87 A;  1NCV A;  2NZO A;  3L9A X;  3CC4 Z;  2VPW A;  2W04 A;  1HXY D;  3S1M B;  1DON A;  1YVC A;  2NN6 I;  1QB5 D;  1K73 1;  3OMC A;  2OT2 A;  4YY3 Q;  5C4X B;  3CMA A;  1YJ9 1;  2KHS A;  5IT9 c;  2BH8 A;  1ENF A;  4DK0 A;  3NFZ A;  3S1Q I;  3R2I A;  3H0G B;  2F0G A;  4DV6 Q;  5IIF A;  1WCM H;  1ESR A;  1J5E L;  3GV3 A;  2CFM A;  3NEN A;  1A15 A;  1H95 A;  3EBE A;  3O13 A;  4DR7 L;  5KND A;  3BVM A;  4J1M A;  1GM5 A;  2LMC B;  1F2L A;  5CV5 A;  3NTK A;  3TP8 A;  4NBD A;  2M2L A;  2F0T A;  4KY7 A;  3GDE A;  2F4M A;  1Z02 A;  1EY0 A;  1H9S B;  1VQD A;  5JVH 3;  4GLX A;  1LUZ A;  4GKK L;  2ZT9 C;  2NVT I;  1PZJ D;  4CJ1 B;  1X55 A;  4JI1 Q;  4DNI A;  4JV5 Q;  4K0K L;  2UXD Q;  2F4V L;  4IUT A;  1MSG A;  1RQF A;  1LTS D;  5HGT A;  2NVY H;  3KBX A;  1EU3 A;  4DFA A;  2A19 A;  1LAB A;  1M8A A;  1HA6 A;  1PXU A;  3I7F A;  2QA4 A;  3HGB A;  2ZJP A;  4BBR I;  4XQQ A;  1B7Y B;  1VQL A;  3UE0 A;  1V1P B;  1EYC A;  1V8Q A;  2CWP A;  2JK8 A;  2OQK A;  5IGG A;  4A3J H;  3I07 A;  3K58 A;  3BYT B;  2DE6 A;  4XYO A;  4CDF C;  3HKZ B;  1K0R A;  3F3P C;  2C9O A;  3AB9 A;  4R8I A;  1U4M A;  1PA6 A;  4CJ2 C;  4DV1 Q;  1M90 1;  4B08 A;  4A93 G;  2DE7 A;  4MD8 A;  3S16 I;  4X65 L;  2A73 B;  3I4L A;  4MON A;  2A6H D;  2VS1 A;  2OCE A;  2EOT A;  3ULP A;  5IGF A;  1VMC A;  1CA6 A;  1TFI A;  2I5H A;  4A3G G;  2B8G A;  3WDN A;  3HG9 A;  3OIP A;  3MAQ A;  5IT9 L;  3J80 E;  1RCV D;  1OO9 B;  1L1O C;  2A69 C;  3ESW A;  4XX2 A;  1YHQ Z;  5IY0 A;  3F2U A;  1LTG D;  1VQO Z;  1RD9 D;  4O0A A;  2V8I A;  3W1G A;  2PZT A;  3GTG I;  5CV7 A;  4KY6 A;  3QWN A;  1LTT D;  5T1I A;  1F9Q A;  2HQE A;  3V05 A;  1K8O A;  3BZK A;  3S1R I;  1DXM A;  2RDG A;  3PO3 B;  3CCU A;  2V8J A;  1VQA A;  1Q1E A;  2M6N A;  5GRO A;  3KF8 A;  4A3J B;  3IFU A;  1BBU A;  1X3G A;  3S1N I;  1USP A;  2WKD A;  5FLX f;  2L9H A;  1L0Y B;  1H9J A;  1VQB A;  2F0F A;  3FHW A;  1SFO I;  1YJN Z;  4RKL A;  4FXK C;  3HOX I;  2QIL A;  1S72 A;  5C44 H;  3NBH B;  1TS5 A;  3K5L A;  4GN3 B;  1TWC H;  1Y1V B;  3KOJ A;  1WJ2 A;  1Q7Y C;  2KCT A;  4K2L A;  5IP9 G;  3IAY A;  3K8A A;  4FF2 A;  2MO1 A;  3N6R A;  2JA8 I;  1NMF A;  4R8N A;  3VR5 A;  3MXN A;  2V4D A;  3CCE 1;  2VQE Q;  2E2J H;  2MO0 A;  1G2S A;  1RDP D;  3I4N B;  4JI6 Q;  1PLF A;  4LUO A;  2VL6 A;  3NWS A;  1HZB A;  1YJN 1;  2UUA L;  2AWO A;  1K8A 2;  5M9O A;  4JYA Q;  1HZC A;  5EPK A;  2RKS A;  1SNC A;  3K81 C;  5EPJ A;  3J7Y W;  1G51 A;  1YNJ C;  3TP5 A;  2VPZ A;  2PQA A;  1EEI D;  1ZKO A;  3G71 1;  2HIV A;  2DJF C;  3CCQ 1;  2Z6K A;  3SVM A;  1HRJ A;  3T16 A;  1B50 A;  4YY3 L;  1Q82 1;  2KCM A;  3HOZ H;  1QNK A;  3G7L A;  3STB D;  5C3E G;  5D1O A;  3CQZ B;  3UDX A;  3JAM b;  3AFQ A;  1LTB D;  1R9T H;  1AN8 A;  4WFN 3;  1YUA A;  1VQ8 1;  4KMU C;  4DV4 Q;  2M9V A;  2Y0S G;  2UUC L;  1M1K 1;  1XXG A;  1C7Y A;  1S5F D;  1CHQ D;  3EER A;  5C6A A;  1D1K A;  1QUQ A;  2NN6 G;  1PH4 A;  4QY7 A;  3KYH C;  2JIO A;  4X3K A;  2UXD L;  5KRU A;  5IYD G;  3NSW A;  3GV6 A;  5I4D A;  2I46 A;  3CCE A;  1WYD A;  3F2D A;  3K80 C;  3FEW X;  5EKK A;  5C5L A;  2QR1 B;  1HUM A;  3GCF A;  5KNB A;  3IFT A;  2QLV B;  4JCV E;  5LL6 S;  1U9R A;  3J80 L;  3RLN A;  1PTO D;  1YUK A;  1CKO A;  5LMN Q;  1KNA A;  4DK1 A;  3CCS 1;  1STE A;  3GTO B;  2OTL Z;  3CCQ A;  1JJ2 A;  1AZP A;  1E1T A;  4JPB W;  2K32 A;  3VB9 A;  1SJH D;  4JI3 Q;  1ILQ A;  1LAC A;  1PFB A;  3T1Y Q;  3I55 1;  2A68 C;  5FO9 B;  2JA5 G;  2EY1 A;  3CCV 1;  4RV9 A;  4BBR G;  4A3K I;  1YI2 1;  2KCN A;  4C3I G;  2B39 A;  5CBA E;  4O2D A;  1OXS C;  4A3L G;  4NBB A;  2OTJ Z;  1BCP B;  2FJ2 A;  1XX8 A;  3C46 A;  4CJ0 B;  4RCN A;  4QUC A;  1SBB B;  2AKL A;  1UUP A;  2PW5 A;  4L5S A;  2RCF A;  4H7B A;  4Y7N H;  2JA6 I;  4K6L A;  2PPB C;  1NBW A;  2UXC Q;  4A93 B;  2DN8 A;  4QL5 A;  3T13 A;  1JE4 A;  1G29 1;  2E2H H;  4A3I I;  4FF1 A;  3AFP A;  3PO2 G;  5IT9 f;  4A3G B;  3CCL Z;  3K0Y A;  2Q2U A;  1A2U A;  3JAM E;  1K8A C;  4ULL A;  3JAM i;  3BU2 A;  1VF5 C;  3CCS A;  1PH1 A;  1W2B Y;  5ELB A;  3A5U A;  2MGS A;  1ICF B;  5HUR A;  1N34 Q;  1X65 A;  2H1E A;  2P28 A;  2BDO A;  5ELO A;  3LWU A;  2H85 A;  4GLV B;  1T5X D;  4L63 B;  3K6O A;  1KHI A;  5IYC G;  3I55 A;  2BH2 A;  4A3E I;  2PW7 A;  1FNV A;  4LF9 Q;  2VQE L;  2LSS A;  4XTC S;  3AEV A;  4JI6 L;  1CKN B;  3OW2 A;  1ZEQ X;  4A3M B;  2J7Z A;  2F0H A;  5C3E H;  4JYA L;  3V96 A;  1WOC A;  1TWF I;  3FRP B;  3TEH B;  5EKL A;  4FDB A;  3MZK B;  1S5B D;  4L5Q A;  4R4O A;  3HOX G;  4NBG A;  4IUP A;  2OOX B;  1NJI C;  4NDX A;  3CCJ 1;  1D7Q A;  3CC2 1;  1GUW A;  2ZJR A;  2CHB D;  1SND A;  2SOB A;  4LFA L;  4LJZ C;  2JA8 G;  1R4P B;  1WCM I;  1X3F A;  3DHQ A;  3L2P A;  1MIU A;  3JAM c;  5M5W H;  1FGU A;  2K52 A;  4C3H B;  3GQB A;  2EYO A;  1N8R 2;  4KI0 A;  4IJH A;  1IKM A;  1WFQ A;  2LIY A;  3FKI I;  4CGY B;  1EWC A;  2PI2 A;  1N32 Q;  4HIK A;  2H5X A;  1CKM A;  3KDF A;  1K83 B;  1E24 A;  1II3 A;  2J0T D;  4DAY A;  4DV4 L;  2DE5 A;  1X6O A;  2Q4Z A;  3DM1 A;  1GUG A;  4IAL A;  1JT8 A;  4RGM A;  1ZB8 A;  1VQ9 Z;  4A76 A;  4JBK A;  4E30 A;  1HQM C;  2K5H A;  3BZC A;  1EY6 A;  2R92 I;  5BN5 A;  1BR9 A;  1BF4 A;  5IP7 I;  1A2T A;  1PH6 A;  4WRD A;  2NVQ I;  3PCO B;  1EY9 A;  4OX9 L;  2G2K A;  3M4Q A;  3PIP 3;  2QDB A;  1WI5 A;  3VR4 A;  3CU7 A;  4EQN A;  2BOS A;  1HFN A;  3H09 A;  3CAM A;  4M1U B;  4C56 C;  3NEL A;  3ND9 A;  2GTI A;  1VQ9 1;  4C3I H;  5C3W A;  2VUM I;  3IFD A;  3CCJ A;  1CUK A;  2B2W C;  4QB4 A;  5LMN L;  2JUB A;  1QVG Y;  3TDQ A;  2K33 A;  4UDU C;  1VQ7 A;  1DJR D;  1WZN A;  3CXC Y;  1X3P A;  3DM3 A;  1VQM 1;  3GKQ A;  3S1Q B;  3OWE B;  5LMN W;  4JI3 L;  1TT2 A;  4KTA A;  4NH1 C;  5D65 A;  2R6G A;  1VQC A;  2RDF A;  1NNX A;  5JOB A;  4RA8 A;  3CC7 1;  2B2U A;  4JBM A;  3D3R A;  2UUB Q;  1K9M C;  2EY6 A;  1SYF A;  2F0U A;  3TRE A;  3PF5 A;  4TNU A;  1YIT 1;  2BJO A;  5IOD A;  5C4H A;  2YAD A;  3JAM L;  3CKI B;  4MD9 A;  4A3F I;  4RVF A;  4MD7 A;  5E1F A;  2GN5 A;  1NE3 A;  5KEE A;  2NVT B;  1WD1 A;  1CHP D;  4LF4 L;  3L7Z C;  5C0X J;  2WB1 A;  1QF8 A;  1IBL Q;  2QEX 1;  3EFX D;  3ERS X;  3J7Z C;  3GTG H;  4Z9C B;  1YJW Z;  2UXC L;  4OWX B;  3KJP A;  1SE2 A;  2K28 A;  2CQO A;  3CCR 1;  1VQP 1;  2CQA A;  4IZ8 A;  3TP7 A;  2FFK B;  2JA5 B;  3S1R H;  4BBR B;  5D14 A;  2KHJ A;  4C3I B;  1OXU A;  3PGZ A;  4EX5 A;  1I6V C;  5IYC H;  1I6H I;  5I9O A;  2QDL A;  5IOC A;  4NOZ A;  4AYB A;  1A3V A;  3H15 A;  5C44 I;  4DAV A;  5M3M H;  1QVF A;  2F0N A;  2SNS A;  3BG3 A;  1VLA A;  1HNW Q;  1O7Y A;  4B3S Q;  1PMR A;  2L11 A;  4UPA A;  3T1H Q;  3CD6 1;  1SFO H;  2JA6 G;  3SK5 A;  3A7A B;  1N34 L;  1PVO A;  1VQM A;  4B3M Q;  4LF5 L;  3S16 B;  1E7Z A;  3TDH B;  4IPH A;  3QB3 A;  1RF2 D;  3PO2 B;  4A3I G;  3FQM A;  1NY4 A;  4LF9 L;  1LV9 A;  3CXC A;  1N8R C;  1MD2 D;  4MHE A;  4FVM A;  3CME 1;  1BCP C;  4K5X A;  3VA5 A;  2F03 A;  2MQH A;  4RVG A;  1Q16 A;  1F9R A;  4YCW A;  2Q8I B;  1FNU A;  3GTG B;  2GVB A;  2WAC A;  5JJZ A;  2HDL A;  1ICW A;  1WTH A;  1QNU A;  3HOZ I;  4NBA A;  1Q86 2;  1VQP A;  3CF5 A;  1I3Q B;  4NBC A;  4A3E G;  3J81 j;  3ICE A;  3VYT A;  3VMH A;  4KHV A;  3ITP A;  2QRD B;  1J5E Q;  3S1N B;  5IT9 b;  2A74 C;  3H3V C;  2WV6 D;  1KLU D;  4JI0 L;  3KLS A;  1SYG A;  1VQK 1;  2OZK A;  4OWT B;  5DEH A;  1SFO B;  1N32 L;  1MGS A;  2KUM A;  3KF8 B;  2B3G A;  4POG A;  3J7A F;  2O5J C;  1USP B;  5C0X H;  4KV6 A;  3HOX B;  3D4D A;  2Z9H A;  4RWS C;  5K36 G;  3G4S A;  2PCF B;  3J7A V;  2EY5 A;  3DWQ A;  3DUZ A;  1P16 A;  1B8A A;  2QCP X;  2JA8 B;  3J81 b;  1RTN A;  3S14 I;  1O7L A;  1WCM G;  1EIY B;  1ENA A;  2AYD A;  4HIO A;  2EYP A;  2R93 H;  3WOF A;  2F0P A;  2PYK A;  4DN4 M;  3CME A;  2B2T C;  2JNY A;  1KNE A;  1VQI A;  3FKI G;  3GTM I;  3MXN B;  4FXG C;  5C4Z A;  3HOU H;  1B3Q A;  4P74 A;  4GOP A;  1V1O A;  2O2L D;  2VXW A;  5IGC A;  2JIM A;  1H9R A;  4I7A A;  2ICE C;  1QVC A;  1TS2 A;  3FVQ A;  1PTO B;  2JS4 A;  4IFD J;  1D1I A;  1F77 A;  2R92 G;  5CC4 A;  4U68 A;  5IP7 G;  1HNX Q;  3K5N A;  2B2V A;  2PQA B;  4H13 C;  3ND8 A;  4TRD A;  3HP3 A;  3W3A A;  3S17 H;  5J39 A;  2LXJ A;  4RGT A;  4J6H A;  3CRK C;  1VQK A;  2BE5 D;  2EVB A;  1JE5 A;  3CMA Z; 
#chains in the Genus database with same CATH homology
 4NFR A;  5D1O B;  2E2I I;  1UAP A;  4KKT A;  3SE0 A;  2F0V A;  5M5X B;  3VYR A;  2NVX I;  2F0O A;  2F0Q A;  2RSN A;  1NSN S;  2B2Y A;  3CMA 1;  1EZ8 A;  3JAM f;  1SMY C;  5IT9 E;  3EED A;  4ZUJ A;  2IX1 A;  3T4A C;  4ODG A;  1O7Z A;  2K5D A;  5J22 A;  2QA4 Z;  2EXZ A;  1NAP A;  4V0B A;  1VQL Z;  4LK1 C;  2K05 A;  3M7G A;  5JPM C;  4A3B I;  2KEE A;  4XT1 B;  3J81 E;  2JEA I;  2NWG A;  1A3U A;  2XWJ B;  4PV1 C;  3SHL A;  2A6H C;  1YJ9 Z;  4HGZ A;  3DEP A;  1CTM A;  2OF1 A;  4NW2 A;  1U4L A;  1TY2 A;  4G7H C;  1DCZ A;  2E2D C;  1ILP A;  4K5V A;  2G9D A;  2LFN A;  1I4G A;  2JA6 B;  1Z01 A;  3GO5 A;  1Z6H A;  5D3I B;  1KRL A;  4QCL A;  5K36 H;  3NP8 A;  4BS9 A;  3S2H B;  2NUC A;  3SK4 A;  1LTI D;  5BN3 A;  3RZD I;  2KEC A;  4X6A I;  1EOT A;  2VUG A;  1AEX A;  2YYZ A;  4BA2 I;  1LO5 D;  1H9K A;  1Q3L A;  1X3Q A;  2D62 A;  2CVR A;  4E32 A;  1OXV A;  4A3E B;  2FMM A;  2NTS A;  3MZ5 A;  3CCU 1;  3A56 A;  4KKU A;  1S4Z A;  1VQ6 1;  3ERO A;  3NUC A;  1OXT A;  1JCK B;  1JWS D;  1TWF B;  2IL8 A;  3I3C A;  1Z47 A;  2EYH A;  3OMG A;  1S72 1;  2F0K A;  1B3A A;  3A8I E;  1WCM B;  3NK9 A;  2Z4I A;  4E31 A;  5FKA C;  3S15 I;  3SEB A;  1Q82 2;  1EIG A;  1STH A;  3FPP A;  1KD1 2;  4G4K A;  4XYQ A;  1STN A;  1LT3 D;  1CM9 A;  4M8A A;  5FOB B;  1XYI A;  5JEA J;  1GUT A;  1TKW B;  2C5C A;  5KIX A;  1M1K 2;  4IQZ A;  5EKI A;  1PRT D;  2NVY B;  2QKI C;  3BDL A;  4E2X A;  2EYM A;  3CPW Z;  1JB3 A;  4U67 3;  3R8B A;  3GTJ I;  3J81 L;  3TN2 A;  2XWB B;  1EY4 A;  3I56 1;  4OO1 H;  2HCC A;  3CCE Z;  3HOV I;  3PUY A;  1B9M A;  1S5E D;  1X32 A;  2VUM B;  4ZYS A;  1QYP A;  5I2X A;  4L6T B;  5LHY 1;  1PZI D;  3ONA B;  1PTO C;  2L4N A;  4ID6 A;  2PMZ A;  3VMI A;  1TII D;  3AU7 A;  1IW7 C;  3CPW Y;  2WKC A;  3G71 Z;  1TWA I;  2GA4 B;  3CCQ Z;  1JJ2 Z;  1JWU D;  2XRQ D;  3OWF A;  3DWP A;  3G6J B;  4QTU A;  1I4Q A;  2P3Y A;  2N88 A;  3P20 A;  1VQ8 Z;  1QG7 A;  1IL8 A;  3X3M A;  3H3V J;  4GZY C;  1CA5 A;  2LS0 1;  3LWE A;  1F9S A;  1GXD C;  2PZW A;  4K5W A;  1AFP A;  2RIQ A;  5J1Z A;  2WB1 B;  3DEO A;  2W03 A;  2DNE A;  3EQL C;  3DXJ C;  4FXD A;  4CL1 A;  1KD1 1;  1I6H B;  4QF4 A;  4HN7 A;  3TZD A;  3I4M I;  5C0X I;  5C44 B;  2I07 B;  1WTR A;  2Q51 A;  1TWC B;  5CBE E;  2RPR A;  3LUS A;  4AYB B;  3GTP I;  1SJE D;  2RVL A;  3U9O A;  1YIJ 1;  2EYF A;  2E2J B;  2CW0 C;  4BBS I;  2K04 A;  2R93 I;  3SDZ A;  3VA7 A;  3CCS Z;  2BA1 A;  1DM0 B;  5EBC A;  2M00 A;  1BO0 A;  2KQ3 A;  1WTX A;  1F2Z A;  2A69 D;  3HOU I;  4OGQ C;  2JE6 I;  3FQQ A;  3I55 Z;  1UNS A;  1CZG A;  3CCV Z;  2NZ1 D;  1YI2 Z;  5D1P A;  1KAA A;  3OW2 Z;  1PFN A;  3KLR A;  3OOC A;  5A35 A;  1ONL A;  2NTT A;  3PUX A;  5AFW A;  3HOZ B;  3GTK I;  3K59 A;  3MEH A;  1WTQ A;  3S17 I;  4F8M A;  4HSP A;  1X3W A;  4K6D A;  1R9T B;  2QEJ C;  4CKC A;  3RLF A;  3GTM S;  1SNM A;  1E2Z A;  4QUF A;  3BS1 A;  5CV8 A;  4X3T A;  5E3F A;  1AW7 A;  3VTN A;  5A2Q b;  1WD0 A;  2VB3 X;  3S14 B;  4N9P A;  2L5T A;  4EVO A;  1I50 I;  4EQP A;  5FLM I;  3MXU A;  1YNJ D;  2R7Z I;  1W6J A;  3OW7 A;  3DMU A;  2RHB A;  4RHS A;  2MJ8 A;  2JR6 A;  1Q81 2;  2KOL A;  1I4X A;  1BCP F;  4NMZ A;  4DNT B;  3J81 f;  3CCM 1;  3KIH A;  3CCJ Z;  3CC2 Z;  2N55 A;  3EJI A;  3H0G I;  4IUN A;  2F4O A;  2PQE A;  1TWG I;  2Z1C A;  4CKB A;  3HEJ A;  4KD3 A;  3I73 A;  4IFD I;  4Y7N B;  1TS3 A;  1JOO A;  3S9W A;  4OIJ A;  5T64 A;  5CV6 A;  4A3D I;  2AQ1 B;  2YU9 I;  1FD7 D;  2E2H B;  1S5D D;  1LLR D;  1VQ7 1;  1GJX A;  4PQX A;  1DOM A;  2E76 C;  4C2M B;  2AWN A;  1RKN A;  3NH5 A;  4BWG B;  1RLY A;  2IX3 A;  3E0J A;  4S1T A;  1ZXT A;  3BZD B;  5IGE A;  3M3Y I;  3HKZ A;  4HCE A;  3X3N A;  5C4J I;  4FF3 A;  2KCC A;  3T4N B;  3SK8 A;  4HED A;  1B2T A;  5A2Q E;  1D2B A;  2A68 D;  3BDO A;  4DXG A;  3OIQ A;  3GTQ I;  5C3E B;  1Y8P B;  3V2T A;  1VQM Z;  1L0X B;  5C0X G;  2MUY A;  3TSS A;  1HHV A;  2Y0S B;  3P75 A;  1J8I A;  5LL6 f;  3CC7 Z;  1ROD A;  4BXX I;  4CBV A;  1H9M A;  1Q12 A;  1YIT Z;  1RO2 A;  1Y8O B;  4YIJ A;  4PMW A;  1CQV A;  2VNU D;  1Q81 1;  2MPM A;  5M5W B;  2JSO A;  5I2Y A;  2QKD A;  3PO3 I;  3CRL C;  2QEX Z;  1JOQ A;  4RVD A;  3CCR Z;  1VQP Z;  2BCO A;  1U4R A;  1Q1B A;  3R3O A;  2O4H A;  1TWH I;  1ZYR D;  3D31 A;  5FO8 B;  3C2P A;  4RAU C;  1BXT A;  3MTS A;  4FF4 A;  3T51 B;  1Y1V I;  5JVG 3;  4BY7 I;  4DQY B;  3M4Y A;  4I7Z C;  3LNN A;  2WAQ A;  1PRT B;  3CD6 Z;  1VQN 1;  2X6G A;  3QOJ A;  1XTC D;  3I4N I;  2E74 C;  2F0E A;  1IYU A;  4OO1 I;  4KKS A;  3IL8 A;  3H94 A;  4C1N K;  2TSS A;  3Q23 A;  3I70 A;  4IN3 A;  2B2W A;  2BDN A;  1IKL A;  3HOY I;  1GUN A;  4XT3 B;  3CME Z;  1WTO A;  1ML0 D;  3D4R A;  3G4S 1;  3A7L A;  3RZO I;  1EQT A;  3S15 B;  3NXW A;  2BA0 A;  3PMF A;  3IF8 A;  5ELE A;  2K3R A;  1CZW A;  1HTP A;  3IX0 A;  1K8M A;  3G6E 1;  4XDX A;  5DM6 3;  5IGB A;  1PRT F;  3VYU A;  4QMG A;  3U9S A;  1WW9 A;  2BE5 C;  3C1F A;  3NQI A;  1NR4 A;  1VQK Z;  1RO0 A;  3F3F C;  3HOW I;  4K14 A;  3I72 A;  4RGN A;  5I6Y A;  2EYL A;  1GHK A;  1WII A;  2OXP A;  4C1N I;  3S1R B;  5A2Q L;  3GTJ B;  1Y8N B;  4E2W A;  3KIF A;  4KD4 A;  3QOL A;  1I4R A;  3HZX A;  4BA1 I;  3RD4 A;  5M3M B;  4DGZ A;  1ML8 A;  3HOV B;  4F7X A;  4IFD G;  4HCS A;  5T6B A;  2E9H A;  1BUV T;  2A5H A;  1YNN D;  3GTO I;  1QWY A;  5KYL A;  1HPC A;  2FIN B;  5CM2 M;  1QIL A;  1KC8 2;  1HUN A;  1EY8 A;  5CR3 A;  1EWH A;  2EY2 A;  2IZ4 A;  1TWA B;  5DAU A;  2PMZ B;  1S7M A;  4DAP A;  2D5D A;  5LL6 X;  3KLS X;  1F2M A;  2IX0 A;  2K5R A;  4HSV A;  4FNF A;  4HGY A;  1KQS Z;  1STG A;  5EQ0 A;  5JPN C;  4RFB A;  2K5Q A;  3Q87 A;  3S2D I;  2HDM A;  2SNM A;  3D6W A;  4DF7 A;  5FO7 B;  4NBH A;  4ZAI A;  2OEO A;  4N9T A;  1JWM D;  2B63 I;  1RJT A;  5EPL A;  3I4M B;  1ZH1 A;  2EYJ A;  3GTP B;  1KTK A;  4PMB A;  2EZV A;  1KQS Y;  1V43 A;  5ELC A;  4UAI A;  2R93 B;  2B8F A;  2B2T A;  3URY A;  1SYC A;  4KJO A;  5JAV A;  1M4V A;  3HOU B;  1Z7T A;  2PZU A;  1PTO F;  2SDF A;  3K7A I;  1HTL D;  4MH4 A;  4A3M I;  1EL0 A;  3OSO A;  2JA7 I;  2O4X A;  1NUI A;  3E6Z X;  3TP6 A;  4ZRZ A;  4XQJ A;  3PV0 A;  4ABN A;  2F0W A;  3M4O I;  1Z03 A;  1LQL A;  4MRI A;  4KK7 A;  3H6M A;  1BBX C;  4ME5 A;  2F3V A;  1QCB D;  4A3C I;  3NPP A;  3S17 B;  1KC8 1;  4WOR A;  1Y1W I;  3N52 A;  3T53 B;  2KJX A;  5T1G A;  3K57 A;  1ET9 A;  4OO1 G;  1DOK A;  4A3K B;  3HS0 C;  3GTL I;  2PK7 A;  3BVG A;  4HAE A;  1BOS A;  3NDJ A;  2IJ0 A;  3P5J B;  4HR7 B;  4RHR A;  4RKB A;  4IFD H;  3NWT A;  3NBI A;  3K5O A;  2WP8 J;  4ZQ3 A;  2K6A A;  3Q0A A;  1PRT C;  2L55 A;  2K1B A;  4A3I B;  3KUP A;  4NKL A;  1FR3 A;  1VDZ A;  3KBG A;  1WVL A;  1I50 B;  3EA6 A;  5TSS A;  2IZ3 A;  3CCU Z;  1O80 A;  3PUW A;  1SYE A;  4OIK A;  1VQ6 Z;  2DY8 A;  1Q7Y 2;  3P7J A;  1RNI A;  1VQ4 1;  2ZXO A;  5A2Q f;  1JC7 A;  3QWU A;  4JK1 C;  3VR6 A;  2HU9 A;  5JEA G;  4OHJ A;  1S72 Z;  4EWC A;  4H44 C;  4G7O C;  1TWG B;  2JEB I;  1F9P A;  3CC4 1;  3FMC A;  4PNY A;  2L12 A;  1EIH A;  1SE4 A;  2EJF C;  2EJM A;  1NP6 A;  2F0L A;  4CKE A;  4A3D B;  1Q8I A;  3L3O C;  3BG1 B;  2YU9 B;  4I65 A;  2RDH A;  1SMY D;  2JA5 I;  1PFT A;  3PUZ A;  4TKO B;  3M3Y B;  5EGT A;  3FKI B;  4A3L I;  3MXG A;  1KDA A;  1B4O A;  2RSO A;  5C4J B;  2EE1 A;  3BG0 B;  1E2V A;  1JR0 D;  4KJN A;  3I56 Z;  1DD2 A;  4PMC A;  4NB8 A;  2A6E D;  1D6E C;  1STB A;  3PO3 S;  3GTQ B;  1SEB D;  3MVV A;  2R92 B;  1S5C D;  3PO2 I;  3M7N A;  2JMO A;  5CMD A;  2NVQ B;  1IHZ A;  2RBM A;  2ZXP A;  4X3U A;  5IGD A;  3BVZ A;  1VF7 A;  1Y1V S;  2F4I A;  1JWH C;  1Q7Y 1;  4KN7 C;  1SNO A;  5DM7 3;  2V8K A;  2R61 A;  5COY A;  3FPU B;  2LFU A;  1A3T A;  3A8K E;  1MSH A;  1I3Q I;  4S3S A;  1YHQ 1;  3M85 A;  2MP1 A;  2K03 A;  1VQO 1;  2JYO A;  2XVS A;  1XWE A;  1TQO A;  2K7V A;  5C5M A;  4NBF A;  1TWH B;  3A8J E;  4A3F B;  3E5S A;  5KNC A;  2OOY B;  3C3L A;  1CQF A;  2F0I A;  3RUZ A;  3SR1 A;  1TR5 A;  4BY7 B;  4Y52 I;  2SEB D;  2ZAE B;  3VR3 A;  3I90 A;  2Z4H A;  3GP7 A;  3NE5 B;  1YIJ Z;  2DY7 A;  4C3H G;  4FP5 D;  1LTA D;  5JEA H;  4J8Q A;  2WAQ B;  4E33 A;  5AN9 F;  1JJ2 Y;  3HOY B;  4L8J A;  4C3J G;  3WOE A;  1KDB A;  1LTR D;  3OHX C;  1DZ1 A;  1A6X A;  4BY1 I;  1AP0 A;  3RZO B;  3R2T A;  4RS4 A;  4F88 A;  1C8C A;  2VF1 A;  4KN4 C;  5G3L D;  1EU4 A;  4B9X A;  4IUU A;  5E4X A;  1NJI 2;  4LAA A;  3PIO 3;  1PDQ A;  2KPI A;  2M48 A;  2Z8L A;  3HOW B;  2FHT A;  4CHT B;  1STY A;  1E0B A;  4G57 A;  2HUG A;  1I4H A;  2Q8T A;  2E75 C;  2FMC A;  4EGV A;  5BN4 A;  2HCI A;  2X6L A;  1SNP A;  2R3Z A;  1B9N A;  2IPK D;  2NB0 A;  4DU9 A;  1WTV A;  2EGT A;  5ISR A;  1U4P A;  1IW7 D;  2RT9 A;  3OW2 Y;  2J4X A;  1SAP A;  2ZXR A;  2F0M A;  2D9U A;  4H0L C;  4NB9 A;  1EYD A;  2D2C C;  1TU2 B;  3CCM Z;  5KYI A;  2RQX A;  1K8A 1;  1KLG D;  3GTM B;  4V19 0;  2DNC A;  2OTL 1;  1W2B Z;  4EQO A;  1Y69 U;  1G6Z A;  2X69 A;  5EJW A;  3S2D B;  3S1M I;  1X3Z A;  2VB2 X;  2XNA C;  5F2D A;  2XN9 C;  2F3W A;  5C4X I;  3S2H I;  1D5M C;  1SDF A;  2JXM B;  4HTH A;  1Q90 A;  4MIU A;  1BQQ T;  2B63 B;  4NBE A;  2OTJ 1;  4Q0F A;  1K9M 2;  1N2F A;  1VQ7 Z;  2WII B;  1H9S A;  1RO4 A;  2XSC A;  2PNR C;  3R93 A;  1SYD A;  2E2I B;  1NJI 1;  1B1Z A;  4XIG S;  4IUR A;  2IT1 A;  3NTH A;  4OL7 A;  1F2Y A;  2CW0 D;  2AQ2 B;  1ZYR C;  3EVQ A;  3MWY W;  2R6M A;  2KVM A;  3CCL 1;  1VMP A;  2NVX B;  1QOH A;  2TMP A;  2L1B A;  1V1P A;  1STA A;  3K7A B;  2QRC B;  1ENC A;  2JA7 B;  3PUV A;  1EFI D;  1WTW A;  3K5M A;  2QRE B;  4KHZ A;  1KDC A;  5NUC A;  4DXF A;  1G8Z D;  4ILW A;  3M4O B;  4G7Z C;  2F0D A;  4A3B B;  3MFG A;  1WTP A;  1Y1W B;  2NN6 H;  1QVF Z;  3NDI A;  5E4W C;  2I3C A;  5I9P A;  3IKJ A;  5DNF A;  1J9O A;  1EEF D;  2K01 A;  1FGB D;  3GTL B;  2RA4 A;  5FLX b;  2AUK A;  2B2U C;  5CV4 A;  4C3J B;  5I6W A;  1QVG Z;  1VQ5 Z;  5K5P A;  5ELF A;  3W2D A;  1QE6 A;  3CXC Z;  3NTI A;  5FK9 C;  4XQN A;  2NVY I;  3J7A 4;  1R4Q B;  3NHH A;  3T56 B;  1EYA A;  2LKV A;  4NP5 A;  3FDT A;  1TY0 A;  3A54 A;  1QVF Y;  1IYV A;  1GOZ A;  4ZUI A;  1K9M 1;  1LT6 D;  3RZD B;  4A3J I;  4K2K A;  1VQ5 1;  1VQN Z;  1D5Z C;  3NBH A;  1CT1 D;  1GUO A;  3TME A;  1CFM A;  1DL6 A;  3VYS A;  1DYQ A;  1JOK A;  1CI3 M;  1CK1 A;  3D8G A;  1TS4 A;  2HF1 A;  1YNN C;  1D5X C;  4E6I A;  3HRZ C;  1HA5 A;  3VMG A;  2F0J A;  4HMJ A;  5C3X A;  3Q22 A;  3C1E A;  1SSO A;  3G4S Z;  2ENB A;  3D6C A;  1LT5 D;  4ZKB B;  4K8J A;  3J80 f;  2XRS D;  1RHP A;  3MON A;  3TZU A;  3G6E Z;  4ZLT F;  4FYD A;  1BDO A;  1DOL A;  4JBW A;  3NQT A;  1SNQ A;  3BDC A;  4FO2 A;  2IW3 A;  2AQ3 B;  2MHV A;  1P9N A;  3P1H A;  1I4P A;  1X0T A;  1EY5 A;  1N8R 1;  3CQZ I;  4HH4 A;  4E2Y A;  4RH6 A;  1UEA B;  5FLX E;  1ZB9 A;  1TWC I;  1PFM A;  2O53 A;  4RVH A;  3I91 A;  3H91 A;  1YJW 1;  1O78 A;  3I8Z A;  1T5E A;  2G9H D;  3U50 C;  2E2J I;  3D4W A;  4QTT A;  1BNZ A;  4MN3 A;  3CHB D;  5EBD A;  1EQV A;  4R9W A;  5COR A;  4RCO A;  4RGO S;  1JIC A;  3ZYY X;  2Q8R E;  1E2W A;  3VR2 A;  1GUS A;  2H4O A;  4B9W A;  1G91 A;  1ET6 A;  2ICI A;  3SK6 A;  2PM9 A;  2F1M A;  4E2Z A;  3MC0 B;  5ELD A;  1AZQ A;  2IWH A;  4ZKC B;  1R9T I;  4X3S A;  1PTO H;  3QIA A;  3QO2 A;  2JP1 A;  3MFY A;  4TQU S;  2B2V C;  1G2T A;  2KA7 A;  2KED A;  3NH8 A;  5M5Y B;  1C48 A;  3TBI B;  2EJG C;  3QG1 A;  5D3D A;  4LMQ D;  1B53 A;  1EY7 A;  1NUC A;  3DWA A;  5KGU A;  1HFG A;  4A93 I;  1QJO A;  1ESF A;  2PO4 A;  2AUJ D;  2EDG A;  2K5W A;  4A3G I;  1B44 D;  3SXH A;  2B2Y C;  2GTH A;  2F0S A;  4O42 A;  1FYC A;  1LT4 D;  3OPO A;  1JQY D;  1MI2 A;  2WIN B;  2XIW A;  3RMH A;  4BY1 B;  4XXE A;  1SE3 A;  5G3L F;  1K73 2;  3ERQ A;  4BBS B;  2EPB A;  2GU2 A;  1PZK D;  1PYW D;  1BCP D;  4HMI A;  3MHB A;  5CV9 A;  2NYZ D;  4Q5V A;  1VCI A;  2KI7 B;  4Y7N I;  5FLX L;  1OXX K;  3KK7 A;  4O1N A;  2LY7 A;  3Q6S A;  1GHJ A;  5IP9 I;  3GTK B;  4K8I A;  2ID0 A;  4KY5 A;  2E2H I;  4ZK9 B;  4IUV A;  1Q86 1;  3UI2 A;  1MBY A;  4QIW B;  2L0C A;  1TVX A;  4DA2 A;  1FNW A;  5CYU A;  1W6K A;  3AMU A;  1HQR D;  4WJW A;  1NR2 A;  4TSS A;  3MZL B;  5T67 A;  1SYB A;  4P2C B;  1K83 I;  4DGL A;  1C4Q A;  3QJY A;  4MXU A;  1SXT A;  2QF7 A;  3TE5 B;  1M90 2;  2A6E C;  2O5I C;  1VQ4 Z;  3D9X A;  1HCZ A;  4DNR B;  5CGK A;  2NBF A;  5C3E I;  3GD7 A;  2Y0S A;  1EZ6 A;  3LX0 A;  3J80 b;  2J6A A;  2QA4 1;  1JOR A;  3MXP A;  3A55 A;  2RBL A;  3NH4 A;  1VQL 1;  1KAB A;  3Q24 A;  1RTO A;  3MA2 B;  3BYY B;  4IUQ A;  2R7Z B;  5M3F B;  4F87 A;  1NCV A;  3L9A X;  3CC4 Z;  2W04 A;  1HXY D;  3S1M B;  1DON A;  2NN6 I;  1QB5 D;  1K73 1;  3OMC A;  2OT2 A;  5C4X B;  1YJ9 1;  2KHS A;  1ENF A;  4DK0 A;  3NFZ A;  3S1Q I;  3R2I A;  3H0G B;  2F0G A;  5IIF A;  1ESR A;  3GV3 A;  1A15 A;  3O13 A;  5KND A;  3BVM A;  4J1M A;  2LMC B;  1F2L A;  5CV5 A;  3NTK A;  3TP8 A;  4NBD A;  2M2L A;  2F0T A;  4KY7 A;  2F4M A;  1Z02 A;  1EY0 A;  1H9S B;  5JVH 3;  2ZT9 C;  2NVT I;  1PZJ D;  4CJ1 B;  4IUT A;  1MSG A;  1RQF A;  1LTS D;  5HGT A;  3KBX A;  1EU3 A;  4DFA A;  1LAB A;  1M8A A;  1HA6 A;  1PXU A;  3HGB A;  4BBR I;  4XQQ A;  1V1P B;  1EYC A;  1V8Q A;  5IGG A;  3I07 A;  3K58 A;  3BYT B;  2DE6 A;  4XYO A;  3HKZ B;  3F3P C;  2C9O A;  3AB9 A;  4R8I A;  1U4M A;  4CJ2 C;  1M90 1;  4B08 A;  2DE7 A;  4MD8 A;  3S16 I;  2A73 B;  3I4L A;  4MON A;  2A6H D;  2EOT A;  5IGF A;  1VMC A;  1CA6 A;  1TFI A;  2B8G A;  3WDN A;  3HG9 A;  3OIP A;  3MAQ A;  5IT9 L;  3J80 E;  1RCV D;  1OO9 B;  1L1O C;  2A69 C;  3ESW A;  4XX2 A;  1YHQ Z;  3F2U A;  1LTG D;  1VQO Z;  1RD9 D;  2V8I A;  2PZT A;  3GTG I;  5CV7 A;  4KY6 A;  3QWN A;  1LTT D;  5T1I A;  1F9Q A;  2HQE A;  3V05 A;  1K8O A;  3S1R I;  1DXM A;  2RDG A;  3PO3 B;  2V8J A;  1Q1E A;  2M6N A;  4A3J B;  3KF8 A;  3IFU A;  3S1N I;  1USP A;  2WKD A;  5FLX f;  2L9H A;  1L0Y B;  1H9J A;  2F0F A;  1SFO I;  1YJN Z;  4RKL A;  4FXK C;  3HOX I;  2QIL A;  1TS5 A;  3K5L A;  1Y1V B;  4K2L A;  3IAY A;  4FF2 A;  3N6R A;  2JA8 I;  4R8N A;  3VR5 A;  3MXN A;  2V4D A;  3CCE 1;  1G2S A;  1RDP D;  3I4N B;  1PLF A;  3NWS A;  1YJN 1;  2AWO A;  1K8A 2;  5M9O A;  5EPK A;  2RKS A;  1SNC A;  5EPJ A;  3J7Y W;  1YNJ C;  3TP5 A;  1EEI D;  1ZKO A;  3G71 1;  3CCQ 1;  3SVM A;  1HRJ A;  3T16 A;  1B50 A;  1Q82 1;  1QNK A;  3G7L A;  5D1O A;  3CQZ B;  3JAM b;  1LTB D;  1AN8 A;  4WFN 3;  1YUA A;  1VQ8 1;  4KMU C;  2M9V A;  1M1K 1;  1XXG A;  1S5F D;  1CHQ D;  3EER A;  5C6A A;  1D1K A;  2NN6 G;  4X3K A;  5KRU A;  3NSW A;  3GV6 A;  5I4D A;  2I46 A;  3FEW X;  5EKK A;  5C5L A;  2QR1 B;  1HUM A;  3GCF A;  5KNB A;  3IFT A;  2QLV B;  5LL6 S;  1U9R A;  3J80 L;  1PTO D;  1YUK A;  1KNA A;  4DK1 A;  3CCS 1;  1STE A;  3GTO B;  2OTL Z;  1AZP A;  2K32 A;  3VB9 A;  1SJH D;  1ILQ A;  1LAC A;  1PFB A;  3I55 1;  2A68 C;  5FO9 B;  2EY1 A;  3CCV 1;  4RV9 A;  4A3K I;  1YI2 1;  2KCN A;  4C3I G;  2B39 A;  5CBA E;  1OXS C;  4NBB A;  2OTJ Z;  1BCP B;  2FJ2 A;  1XX8 A;  3C46 A;  4CJ0 B;  4RCN A;  4QUC A;  1SBB B;  2AKL A;  1UUP A;  2PW5 A;  4H7B A;  2JA6 I;  4K6L A;  2PPB C;  4A93 B;  2DN8 A;  3T13 A;  1JE4 A;  1G29 1;  4FF1 A;  4A3I I;  5IT9 f;  4A3G B;  3CCL Z;  3K0Y A;  1A2U A;  3JAM E;  4ULL A;  1VF5 C;  1W2B Y;  5ELB A;  2MGS A;  5HUR A;  2H1E A;  2P28 A;  2BDO A;  3LWU A;  2H85 A;  1T5X D;  4L63 B;  3K6O A;  4A3E I;  2PW7 A;  1FNV A;  4XTC S;  1ZEQ X;  4A3M B;  2J7Z A;  2F0H A;  3V96 A;  1TWF I;  3FRP B;  5EKL A;  3MZK B;  1S5B D;  4NBG A;  4IUP A;  2OOX B;  4NDX A;  3CCJ 1;  3CC2 1;  1GUW A;  2CHB D;  1SND A;  2SOB A;  4LJZ C;  1R4P B;  1WCM I;  3DHQ A;  4C3H B;  3GQB A;  2EYO A;  1N8R 2;  4KI0 A;  1IKM A;  2LIY A;  3FKI I;  4CGY B;  1EWC A;  1K83 B;  1II3 A;  2J0T D;  4DAY A;  2DE5 A;  2Q4Z A;  3DM1 A;  1GUG A;  4IAL A;  4RGM A;  1ZB8 A;  1VQ9 Z;  4E30 A;  1HQM C;  1EY6 A;  2R92 I;  5BN5 A;  1BR9 A;  1BF4 A;  5IP7 I;  1A2T A;  4WRD A;  2NVQ I;  1EY9 A;  2G2K A;  3PIP 3;  2QDB A;  3VR4 A;  3CU7 A;  4EQN A;  2BOS A;  1HFN A;  3H09 A;  4M1U B;  4C56 C;  3ND9 A;  2GTI A;  1VQ9 1;  5C3W A;  2VUM I;  3IFD A;  2B2W C;  4QB4 A;  2JUB A;  1QVG Y;  3TDQ A;  2K33 A;  4UDU C;  1DJR D;  3CXC Y;  1X3P A;  1VQM 1;  3GKQ A;  3S1Q B;  3OWE B;  1TT2 A;  4KTA A;  4NH1 C;  5D65 A;  2R6G A;  2RDF A;  5JOB A;  4RA8 A;  3CC7 1;  2B2U A;  3D3R A;  2EY6 A;  1SYF A;  2F0U A;  4TNU A;  1YIT 1;  2BJO A;  5IOD A;  5C4H A;  2YAD A;  3JAM L;  3CKI B;  4MD9 A;  4A3F I;  4RVF A;  4MD7 A;  5E1F A;  5KEE A;  2NVT B;  1WD1 A;  1CHP D;  3L7Z C;  5C0X J;  2WB1 A;  1QF8 A;  2QEX 1;  3EFX D;  4Z9C B;  1YJW Z;  1SE2 A;  2K28 A;  3CCR 1;  1VQP 1;  2CQA A;  4IZ8 A;  3TP7 A;  2FFK B;  2JA5 B;  4BBR B;  5D14 A;  4C3I B;  1OXU A;  1I6V C;  1I6H I;  5I9O A;  5IOC A;  4NOZ A;  4AYB A;  1A3V A;  5C44 I;  4DAV A;  2F0N A;  2SNS A;  3BG3 A;  1VLA A;  1O7Y A;  1PMR A;  2L11 A;  3CD6 1;  3SK5 A;  3A7A B;  3S16 B;  3TDH B;  3QB3 A;  1RF2 D;  3PO2 B;  3FQM A;  1LV9 A;  1MD2 D;  4MHE A;  4FVM A;  3CME 1;  1BCP C;  4K5X A;  3VA5 A;  2F03 A;  4RVG A;  1F9R A;  2Q8I B;  1FNU A;  3GTG B;  2WAC A;  5JJZ A;  2HDL A;  1ICW A;  1QNU A;  3HOZ I;  4NBA A;  1Q86 2;  1I3Q B;  4NBC A;  3VYT A;  3VMH A;  4KHV A;  3ITP A;  2QRD B;  3S1N B;  5IT9 b;  2A74 C;  3H3V C;  2WV6 D;  1KLU D;  3KLS A;  1SYG A;  1VQK 1;  2OZK A;  5DEH A;  1SFO B;  1MGS A;  2KUM A;  3J7A F;  2O5J C;  1USP B;  5C0X H;  4KV6 A;  3HOX B;  3D4D A;  4RWS C;  5K36 G;  2PCF B;  3J7A V;  2EY5 A;  3DWQ A;  3DUZ A;  2QCP X;  2JA8 B;  3J81 b;  1RTN A;  3S14 I;  1O7L A;  1ENA A;  2EYP A;  3WOF A;  2F0P A;  2PYK A;  4DN4 M;  2B2T C;  2JNY A;  1KNE A;  3GTM I;  4FXG C;  5C4Z A;  1V1O A;  2O2L D;  2VXW A;  5IGC A;  1H9R A;  2ICE C;  1TS2 A;  3FVQ A;  1PTO B;  2JS4 A;  4IFD J;  1D1I A;  1F77 A;  5CC4 A;  4U68 A;  3K5N A;  2B2V A;  4H13 C;  3ND8 A;  4TRD A;  3HP3 A;  3W3A A;  5J39 A;  4RGT A;  4J6H A;  3CRK C;  2BE5 D;  2EVB A;  3CMA Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...