3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Methyl-accepting/DNA response regulator
publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
2JNYA 5CBEE 5C4XI 2KVMA 2L9HA 5D65A 1CA5A 3GCFA 1WTWA 2JA7I 3I90A 1MGSA 1PFMA 5E4XA 1F9RA 2K05A 2YU9I 1X3PA 3M3YI 3F2UA 1QYPA 1Y1VS 4NB8A 5C3EI 3I4NI 4A3EI 3I07A 1DOKA 1BO0A 2HF1A 2DY7A 4NBEA 4ZKBB 4NBGA 1NAPA 1HFNA 1GUWA 2L4NA 1MSHA 3S17I 5EPJA 3GV3A 5EPKA 3GTPI 3QO2A 3PO2I 1PDQA 4A93I 1TVXA 3IL8A 1AP0A 1U4PA 5CMDA 1WD0A 2FFKB 1Y1VI 1SDFA 1WW9A 5C4JI 5T1GA 3MTSA 4XDXA 2KOLA 2B2WA 1WTVA 2B2TA 4A3GI 4A3FI 3N52A 1CM9A 2JYOA 1DOLA 1WTOA 1HA6A 2M2LA 4LMQD 4OIJA 4ZAIA 4BBSI 1KNAA 3HOVI 3RZDI 3GTOI 2R93I 4CJ1B 5CBAE 2NVXI 1MSGA 1L1OC 2K03A 2B2YC 3LUSA 1HHVA 2DE6A 1NR2A 4A3BI 2L11A 2EPBA 1BNZA 1MI2A 3K7AI 5CM2M 1PFNA 1EOTA 5CORA 4NBHA 1ZXTA 4ZK9B 4XX2A 1WCMI 1M8AA 2MP1A 2X6GA 1R9TI 1Q3LA 2X6LA 3LWEA 4A3II 3TZDA 1EL0A 3FKII 4MH4A 3S1QI 1C8CA 2K04A 1X3WA 2Q8RE 2NVTI 4A3LI 2JA8I 1TWGI 2B2VC 1B3AA 2SDFA 1O7YA 1LV9A 2NZ1D 1DONA 4NBBA 1NCVA 4QTUA 4X3UA 3GTKI 3DEPA 1EQTA 2B2UA 3S1MI 3D6WA 1USPB 4X3TA 1N2FA 4BY1I 4NBDA 3ESWA 2E2HI 1B50A 2FJ2A 1TWAI 1YUAA 1F9QA 2NYZD 4NBAA 4MHEA 5COYA 2BJOA 2R3ZA 2Q8TA 2F4OA 2JP1A 3DM1A 4CJ0B 1TWCI 3G7LA 1BBXC 4QUFA 1DZ1A 2E2II 1QNKA 2HCCA 2RSOA 1BF4A 2JA6I 1JE4A 1G6ZA 4Y52I 3RZOI 3PO3I 3I91A 4RA8A 3S1NI 3IFDA 4CJ2C 3S2HI 1WTXA 4RWSC 1CA6A 5EKIA 1WVLA 5EQ0A 2F4MA 4A3KI 3Q6SA 3MWYW 2MPMA 1TWHI 4XT3B 4IUVA 1WD1A 1B4OA 4QTTA 2JS4A 2D9UA 1ILPA 2FINB 2FMMA 2L1BA 3H0GI 1RLYA 3KUPA 4HAEA 1WTPA 1QE6A 1VMPA 3KBXA 4HEDA 2X69A 2R92I 1USPA 4BXXI 1VMCA 3P7JA 2J7ZA 1RJTA 2MGSA 1RHPA 3M4OI 2K01A 4XT1B 4HCSA 1HFGA 4NW2A 1ZB8A 3I8ZA 1SAPA 4NOZA 3DEOA 1O7ZA 2VUMI 3GKQA 3FDTA 2E2JI 1X3QA 1G2SA 3I4MI 3S15I 5T1IA 2P3YA 2RA4A 3S16I 1HRJA 1F9SA 2J6AA 1B53A 3FPUB 1F9PA 3UI2A 1S4ZA 1EIHA 2CVRA 2FHTA 4RAUC 3HOXI 1G91A 1HUNA 4X3KA 1G2TA 1AZQA 3EERA 1QG7A 2HUGA 1RODA 4X6AI 1HUMA 5C44I 1U4LA 2B2WC 1KNEA 1ML8A 3GTMI 4ZKCB 4R8IA 1U4RA 1IKMA 5D14A 5E4WC 2RVLA 1AZPA 4O42A 2IL8A 3VB9A 4ZLTF 2DE5A 2XIWA 5DNFA 3PO3S 4NBCA 1ZB9A 3GTJI 2MJ8A 1ICWA 3U50C 2K5RA 1XX8A 1RTOA 4Y7NI 2KEDA 2B2YA 3H91A 1J8IA 2JA5I 3HOUI 4IUTA 2KECA 1ML0D 1SSOA 4NB9A 3S2DI 1VLAA 3GTLI 5IP9I 2JR6A 3GV6A 4UAIA 1EIGA 2RSNA 1Y1WI 1PFBA 1RTNA 3HOZI 1WTQA 3VMGA 1LQLA 4DN4M 3H3VJ 1E0BA 4IUPA 1A15A 4A3CI 5IP7I 2H1EA 4A3JI 3ONAB 2NVQI 1K83I 2PK7A 2EE1A 1NR4A 3S14I 2KUMA 1U4MA 2B2VA 2NWGA 3R93A 2R7ZI 1DL6A 4IUUA 1J9OA 2EOTA 1NUIA 4OIKA 1DOMA 2B2UC 2N88A 1SFOI 3S1RI 4BBRI 1O80A 4U68A 1XYIA 5AFWA 1I6HI 5FLMI 4IURA 1PLFA 2NVYI 1ILQA 1TFIA 2RBLA 3CQZI 3GTMS 1X3ZA 1X32A 4BY7I 2BDNA 3GTGI 3HOWI 2B63I 5EJWA 2DY8A 2HDMA 1IL8A 1JICA 1RO4A 2N55A 3TN2A 1PFTA 2K1BA 1F2LA 2KEEA 1TWFI 5JJZA 4QUCA 2DE7A 3I3CA 1I3QI 2AKLA 3SVMA 3GTQI 4MN3A 2B2TC 1IKLA 2K28A 1I50I 3Q87A 3HOYI 5EPLA 3VMHA 2L12A 4A3MI 4A3DI 2VXWA 1B2TA 1ESRA 3HP3A 4NBFA 3VMIA 2HCIA 2KPIA 4R9WA 1WTRA 4HSVA 4X3SA 4IUQA 2HDLA
chains in the Genus database with same CATH superfamily
3G711 2JNYA 1LM0A 1TS3A 1JC7A 3GCFA 1XXGA 1EQQA 2RCNA 3NENA 4Y52H 2K05A 3NDJA 1VQNA 2K5VA 2QDLA 1X3PA 4O1NA 2QEX1 1UAPA 4QY7A 5ELOA 4M8AA 2V45A 4NB8A 2D2CC 3GTLB 3S2HH 3KOJA 2ZAEB 5FO7B 3I07A 3DXJC 3DMUA 1P8LA 1JB7A 1VQBA 4HIMA 4KN7C 3K57A 4K2KA 1PTOC 4NBGA 4A4IA 4YIJA 3OPOA 1MJCA 1GUWA 3NHHA 1VQM1 1G51A 4JI1L 1MSHA 1TIID 5EPJA 2E75C 4X66L 1I4PA 3CXCA 2O5IC 3GTPI 3CCQZ 1BQQT 1FYCA 1PDQA 3E9IA 4A93I 1GUOA 1D8LA 2A6HD 4A3JB 5FO9B 1B9NA 3KF6A 3P20A 5KYIA 1U4PA 2V1CC 4L63B 2VW9A 2A5HA 1K9M2 5C4JI 3SK8A 2BOSA 2LKVA 4RFBA 4XDXA 2AQ3B 4KD3A 4ZCKA 1MJEA 4A3GI 2HHHL 1K3BC 2O4XA 1YJWZ 1K8A1 2JYOA 2N3SA 3RLOA 4B3TQ 3PO2G 1HA6A 3K6OA 4I65A 4LMQD 1SFOB 1I94Q 5CV9A 3OHXC 5ELFA 1SE2A 3KDFB 3Q8DA 4R4CA 1KNAA 2VQEL 4DV4L 1YIJA 3GTOI 4DV3Q 1I4RA 1WYDA 5CBAE 2Z0SA 2ZXRA 5IYCG 1BUVT 3H3VI 4A3FG 1VQHA 5LMNQ 3QOLA 2NAPA 4IFDG 2NUCA 3I4MH 4A3BI 3CD61 2RBMA 2ZM6L 5LMUL 3FKIH 1OXTA 3CHBD 5CV7A 3K7AI 1HZAA 3EBEA 5C4HA 1PFNA 4JOIC 2GA4B 4NBHA 4ZK9B 4X65L 3NWTA 1CFMA 1H9MA 2JQOA 2MP1A 1R9TI 5IYBH 1HPCA 1YNXA 2M48A 3C1EA 5M3FH 2D62A 3T1HQ 3SEBA 5C44H 3HGBA 5FJ8H 2HT1A 4OWWB 3RN2A 3KLSA 3TZDA 2UUCL 1B8AA 4LWCA 1JWHC 1H9JA 4HSPA 4FXGC 1TS5A 1D1IA 1ZYRD 2YADA 2K04A 2VPZA 1WCMG 3OOCA 4DAPA 3T4AC 4TQUS 4BA1I 1VQO1 1KHIA 1IXRA 4DV2L 1CKOA 1YITA 1XPUA 1BVSA 3PUZA 4NH1C 1LV9A 2NZ1D 4UHVA 1KRLA 4NBBA 1NCVA 2XSCA 3NQTA 5IT9c 1KLGD 2M00A 3GTKI 4JI1Q 4HGYA 2EXDA 3IAYA 2G2KA 3D31A 2JA5H 3S1MI 3D6WA 1PXUA 4KTAA 3SE0A 1YHQA 1GKHA 1KAWA 1VQ61 3VR2A 5C4ZA 1TWCH 4BY1I 2I5LX 3WWVA 4LJZC 4H13C 1F77A 2OEOA 4LFCL 1YVCA 4WORA 1YUAA 4QMGA 1STEA 2E2HB 3KIFA 1EIFA 1F9QA 2HQEA 3TS2A 5G3LF 5COYA 3M3YB 4A75A 2BJOA 1D1KA 1NBWA 3C3LA 1SXTA 2G9DA 2Q8TA 4XQJA 4HMIA 3D0FA 3NWSA 4DK6C 2W04A 3CRKC 3I561 4GLXA 2F0LA 4DV4Q 3TP5A 2LXKA 4RHRA 2JP1A 1ESFA 4A3CH 2GN5A 2ICIA 4MTKA 1BBXC 4NFRA 1A2UA 1BCPC 2E2II 2H5XA 3PGZA 4IFDJ 1CKMA 1SEBD 2RSOA 1IBLL 2JA6I 1N34L 5IGFA 4GNXC 2R7ZH 2IPKD 4YY3L 3RZOI 3PO3I 3I91A 2JMOA 4MNOA 2XGTA 4B3ML 3TMEA 2ZM6Q 1M1KC 5LMUQ 3R3OA 1YI21 1LYLA 4RWSC 1B7YB 1QVFA 5EKIA 2PMZB 2K5DA 1GJXA 4X65Q 1Z01A 2F4MA 4JI5L 4BXXH 4C3IB 4MZ9A 1LTTD 4N8FA 3I72A 2R6MA 1NP6A 2K75A 3AFQA 4A3KB 2M9VA 1I6HH 5IYDG 2UUAL 1Q8IA 5FLMH 3M4OH 1KD1C 2A68C 2BE5D 4X62L 4XT3B 2OOXB 2AWOA 2UUCQ 4JYAQ 5T67A 1B4OA 3CMEZ 2JS4A 1YNND 2PQAA 1TWHB 5C0XG 4C3IG 3HOVB 3RZDB 2UU9L 3CQZH 3F2BA 3U4ZA 4HAEA 4A3KG 2XN9C 4YCVA 2E2JH 1D6EC 2R7FA 4PQXA 3CCEZ 3L7ZC 4J1MA 3GTGH 4DV2Q 2Q51A 4S3SA 1VQ41 1J6QA 4E2WA 2JIRA 1YJ9Z 5IT9L 1I5FA 1H95A 2MGSA 3V05A 3HOVG 2IHFA 2HQLA 2K01A 4HCSA 3GO5A 2CFMA 1VQP1 1YJNZ 2AMCB 1SAPA 2F3VA 3J80f 1HR0L 4HJ9A 4X6AH 2VUMI 5A35A 1E2WA 2NZOA 1QNUA 1TY2A 2RHSB 4QF4A 4A3IB 1G6PA 1I50H 5I6WA 4LUVA 2QEXA 4NXNQ 5J22A 4S1TA 3J81b 1JB3A 3VA5A 2AUJD 4LFCQ 2IX1A 3S15B 2QCPX 5IT9E 3OMGA 3L9AX 1B53A 2LEXA 1DXMA 3FPUB 3S1QB 5JVH3 1QVGA 3S16B 2E9HA 2QF7A 1EU3A 1SNQA 5IGEA 3EROA 4A3IG 1FGBD 2VB2X 4JVZA 4X3KA 3EIVA 3KIHA 1B9MA 1HTLD 1VQMA 2EYOA 3ND9A 1QG7A 2HUGA 2PQAB 1C7YA 3CC41 4GOPA 2NN6I 1U4LA 4IO9A 3QR8A 1KNEA 2CWAA 4HJAA 1D2BA 1KQSA 1U4RA 1CQVA 1VQ8A 1IBLQ 4PMWA 1N34Q 4A3LG 1C0AA 4OGQC 1YNJC 3VYUA 4DV5L 2IL8A 2KQ3A 2GTIA 1UUPA 4LFAL 1ASYA 3CCSZ 3HG9A 3PO3S 5DAUA 5M9OA 1ZB9A 4P75A 3GTJI 3PIP3 1OXSC 3MXGA 4PV1C 2HIVA 3AQQA 1XX8A 4NB3A 1II3A 1L1OA 4Y7NI 1TWAB 4BA2I 3NBHA 4IOCA 2C9OA 3JAML 2UUAQ 2KHIA 3QWUA 4FXKC 3TP6A 5IY0A 2B8GA 3STBC 5JOBA 2K3RA 3HOUI 3SHLA 3GP7A 1S5FD 4DR5L 2KECA 4X62Q 1ML0D 3CCU1 3HS0C 3X3MA 5C0XJ 4XYQA 4OHJA 3GTPH 4HJ8A 2KCTA 3CD6A 3GTLI 3IKJA 3PF4A 3S14H 1FVIA 4RV9A 3JAMi 2JR6A 3I73A 3AYHB 1GOZA 3OWFA 1FDOA 3NSWA 4F88A 2O4HA 2BCOA 3D4DA 5C4JH 4HMJA 2OT2A 1RTNA 2BA0A 4A3GH 1ZKOA 1JJGA 3VMGA 1Y1WB 3VA7A 1T5EA 1S721 1Y8CA 4C3HB 4PMCA 4IUPA 1Q82C 2F03A 3BYTB 1K731 5IP7I 2H1EA 4A3JI 5BN3A 1K83I 2G9HD 4P74A 1VQJA 1NR4A 3CC2Z 2KUMA 1KC8C 2B2VA 3ER0A 3FVQA 3GTOH 2WACA 1GHKA 1CHPD 5ELBA 1Q46A 1Y1WG 3HOZG 2QRDB 1J9OA 2EOTA 1NUIA 3KF8A 4C3HG 3ULPA 2Q4ZA 1T5XD 3FQMA 3NBHB 4H44C 4A3BH 2B2UC 4C1NK 3H0GB 1E2VA 1HCZA 4DA2A 1EWHA 1X55A 3DM3A 1LT6D 4IFDI 2ALYB 2N88A 4YWLA 1SFOI 5HURA 3K7AH 3Q23A 3A0JA 1XYIA 2R92B 5J1ZA 1VQ7Z 2RKSA 2EJGC 3MEFA 2IV2X 2PI2E 2F3IA 4KK7A 1R9TH 3H0GG 2NVYI 2JIOA 2EYJA 4DXGA 1VQ6A 4JI3Q 3QB3A 1TFIA 1Z6HA 4OO1H 2TSSA 2RBLA 2QR1B 4DV5Q 2R92G 1N8R2 5A2QL 3GTQH 1XPRA 2E2DC 5E1FA 4TRDA 5M5WH 2OQKA 5JEAH 2MHVA 1Q90A 1MBYA 1UE5A 1RO4A 4A3MH 3CC71 5BR8L 4FF4A 3K5OA 3V2TA 2JN4A 1VQ91 1PZJD 3PCOB 1SMYC 4QUCA 4HTHA 4DK0A 4DR5Q 4RGTA 3GTKH 3NTKA 3ICEA 5A2QE 2B2TC 3BG0B 2K28A 3S1MH 1ICFB 5KEEA 4XXEA 3AFPA 3U9OA 2F0SA 2PYKA 2B8FA 3CPWY 1PTOF 1TXYA 3T1YQ 1IYUA 4FYDA 5EPLA 2EYPA 3VMHA 5C4XH 4BY1H 2OCEA 3D6CA 3J7AF 4RH6A 4CDDC 2YU9H 5FLXf 2OTJ1 4PNYA 1RKNA 1TR5A 1C4QA 4RCOA 2EJFC 2K5NA 4CBVA 1IYVA 4A3EH 4JPBW 1QUQA 1LTGD 3CCMA 3SK6A 4KY6A 2EY6A 2F0FA 3IX0A 4IUQA 2HDLA 3CCRA 4HJ5A 2WB1A 2EGTA 1EY6A 4TSSA 3S17H 5LL6f 1HXYD 2E2IH 1WTWA 4LF5L 1F9RA 1STNA 3CF5A 3RZOH 2VPWA 3PO3H 3A5ZB 3M3YI 4JI2L 2E76C 3CPWZ 2ZTCA 1A62A 1PHJA 4KY7A 1DOKA 2HF1A 2F0GA 2DY7A 1JT8A 3G6JB 4ZKBB 3EQLC 3CAMA 3J7A4 4XQQA 2L4NA 4N9TA 5K36G 2BDOA 1AW7A 2EQSA 1DJRD 1KLUD 4BBSH 3QO2A 1RIPA 1SYFA 4CKEA 2NVQB 2R93H 1WD0A 2FFKB 1N8R1 1WJ2A 4TNUA 2NVXH 1WW9A 4CDCC 2L55A 5D3DA 4DKAC 2B2WA 4HN7A 1Y1VB 1QUQB 5C0XI 1V1PA 3FQQA 1VQFA 1FL0A 1KABA 3R8BA 5GQOA 4R4TA 4OONA 3N52A 5BR8Q 1CM9A 2DGYA 1DOLA 1WTOA 3Q0AA 1QOHA 3RMHA 2WB1B 2PI2A 5JAVA 3CC4A 2I07B 4G7HC 4LF8Q 1LTAD 1E2ZA 3TRZA 1SNPA 1Y1VG 3EVQA 3HOVI 3RZDI 4YWKA 1K3RA 2JXMB 1EWCA 2E5LL 1H9KA 1Q7Y1 3CU7A 1JE5A 3NH8A 3RUZA 4KMUC 2K03A 1VQKZ 2VUMH 2B2YC 2IZ3A 1Q822 2HU9A 4OELB 2DE6A 5F2DA 1NR2A 5D3IB 4IPGA 2VB3X 5KNCA 1SYDA 1H9RA 2LXJA 1BNZA 1A8VA 1EY8A 4HR7B 1PH3A 4DAVA 2A73B 2SEBD 2VZAA 5GAEC 5CORA 2B63B 1OXXK 1NE3A 1IW7D 2M6NA 1M8AA 4ALPA 1Q3LA 4DR6L 3LWEA 4GKKL 3CCUA 5HGQA 1YHBA 5JJLA 4A3II 1I94L 1YBYA 2NN6H 2DJGC 1BOSA 2VPYA 4R4IA 3SDZA 3TEHB 3TBIB 2B63G 1TWFB 3ERQA 1UNSA 3S1QI 2V8IA 3I55Z 5ELCA 2O5JC 4JI2Q 5LMNL 1BBWA 2NVTI 4A3LI 5HY6A 3HOYB 2JA8I 1UE1A 3H94A 4P2CB 4JBMA 3D8GA 1TWGB 2EIFA 4A3DB 4QTUA 1PH8A 5K5PA 3L0OA 1S5ED 4X3UA 2YYZA 4Y7NH 1Q1EA 4MIUA 2WP8J 3NQIA 4LUOA 3DEPA 1M90C 5FK9C 3MA2B 3G71Z 1SMXA 3HOUH 1LACA 2PMZE 1CKNB 4KD4A 1VQGA 3A56A 4A3DG 4JV5L 1F2ZA 1S3OA 2GU2A 3KDFA 2OOYB 3BZDB 3HEJA 3G4S1 3GTLH 3GDEA 3ESWA 3EA6A 1A0IA 4K5WA 4B9WA 1TWAI 3DWPA 4L8JA 1V9PA 2JA7B 1MD2D 3OSOA 2NYZD 5IWAQ 4NBAA 4MHEA 2QRCB 3URYA 1N32L 1YHAA 3LNNA 5C3EB 3RNUA 4KLKA 2IWHA 1QILA 1PTOB 3VYSA 2KBNA 5NUCA 5I4DA 4DPGA 2E5LQ 4JOIA 2JA7G 4CJ0B 5IP7H 4A3JH 2Q2UA 1CK1A 4POGA 4G57A 1DZ1A 1K83H 2JEBI 2VPXA 2CW0C 1XNRL 1R4PB 4KHPL 1FNWA 1JE4A 1NJI2 1G6ZA 5C3EG 5I2XA 2F1MA 3CMAZ 2LS01 3K80C 4RA8A 1VQ81 3PO2B 2RHQB 1V43A 1Q81C 1SLJA 1DD2A 3K81C 3K8AA 4H0LC 1SIWA 3J7YW 2RCFA 5EQ0A 1WZNA 4ZUIA 3CC7A 3OW2A 1SFOH 3UDFA 2RDHA 1VQ9A 2DNCA 2F0NA 4DR6Q 1STGA 1F2MA 2FMCA 3OMCA 4A3FB 4GKKQ 3MWYW 2YTYA 4LNQA 2QREB 4PZ6A 4ME5A 1EEID 3PF5A 1EY7A 3CCQ1 2NVYH 4IUVA 4HIDA 3BJUA 4QTTA 1WD1A 4QL5A 3PSIA 2FINB 2FMMA 1PFSA 3H0GI 2ZJQA 1EYCA 1RLYA 5BN5A 3M85A 5IGGA 1QF8A 2DUDA 1EY5A 1QE6A 1VMPA 4HCEA 4HEDA 5HGTA 2X69A 3TE5B 2R92I 3D4WA 2OTJA 2N78A 3J81L 1Y8NB 3T51B 3HRZC 1YJW1 4NMZA 5E7NA 2I5HA 2MFIA 4NDXA 4LW1A 1RO0A 4XT1B 4NW2A 4QCLA 4DR1L 2VS1A 5FLXb 3HOXH 3J81i 1WCMB 5IOCA 1O7ZA 3FDTA 1DGSA 4JV5Q 4R1JA 3CRLC 4RGMA 4K5VA 5ELNA 4JYAL 3TP7A 2XVSA 1UWVA 2RA4A 4OWXB 1XJVA 1TS4A 1VQOZ 2J6AA 4O2DA 2OTLA 3FKIB 3H09A 3UI2A 3WDNA 1I4GA 2EYFA 4BS9A 1N32Q 2EY1A 2SOBA 1X3GA 1VQLZ 2A6ED 3K5NA 2CVRA 1J5EL 3ERSX 2UXDL 4RAUC 1LTLA 1HUNA 2I3CA 4FF2A 4B9XA 2IZ4A 5KNDA 1HUMA 1RDPD 3G6EZ 1A2TA 3F2CA 5M3FB 3E9HA 2PMZA 1SNCA 3FKIG 1KRTA 2Z1CA 3EEDA 3GTMI 2O53A 5C44B 1XNRQ 4ODGA 2Z6KA 3RLFA 4KHPQ 2JA9A 4CL1A 3FHWA 1XNQQ 4PZ7A 4DAMA 1NJI1 1IBKQ 4OEMB 5IYBG 3MVVA 3VB9A 1KL9A 4ZLTF 1FNUA 5M3FG 3S2DH 3SK5A 3I4OA 3W5OA 3BU2A 3SGIA 4NXNL 2QILA 3DLLA 4KN4C 1K9M1 1LT5D 2KCCA 5CYUA 5IP9H 5C44G 5FJ8G 2W03A 3NDIA 3IR7A 2MJ8A 2N49A 5C5MA 1ICWA 4CDFC 3U50C 3E0JA 1SE4A 3DWQA 2IHEA 4R4OA 1MKHA 3K0YA 3NTHA 3I56Z 1YEZA 1AA6A 4JG2A 4C3JH 3KBGA 2YTXA 5IE8A 5IT9f 1NMFA 5LHY1 2V8JA 3PIO3 4XYOA 5EGTA 1SSOA 1TS2A 3WOEA 2I0QA 2JSOA 4NB9A 4FF1A 4FF3A 1IL2A 4E2ZA 1BCPB 3CW2C 3BVMA 4RVHA 1VQ5Z 1TWCB 2B39A 5IYDH 4GNXB 3M4QA 1YI2Z 1EYDA 1EIGA 1M902 4UY8C 1SYBA 4EVOA 1AE3A 2RSNA 1WJJA 4GLVB 4DAYB 4NKLA 3VR3A 5C0XH 1WTQA 2Q8IB 5CC4A 3S1NB 3A8KE 4JBJA 4DN4M 2UXBL 4AYBB 2CQOA 5CGKA 3NTIA 3MFGA 2PO4A 4BBRH 2P28A 4DR1Q 2WKCA 1STAA 4DK3C 5C6AA 2NVQI 2KCNA 4E31A 2LY7A 4GZYC 2PK7A 2EE1A 2VY3A 1U4MA 3CCM1 2NWGA 4RGOS 3R93A 3RZDH 3JAMc 3IFTA 1VF5C 2L0CA 4HJ7A 2F0OA 1I4QA 4AYBG 3F3FC 3T13A 1Z02A 1XTCD 3CCR1 4V190 5I9PA 4OIKA 4PMBA 1WIIA 5KGUA 1CHQD 3A55A 5T6BA 1E24A 1VQ4Z 4A3CG 2PM9A 1JOKA 4BY7H 3CCJZ 2J4XA 3S1RI 3HOWH 1J5EQ 2UXDQ 1SNOA 2QA4Z 1JCKB 1PRTC 5AFWA 3FPPA 3TZUA 1VQPZ 1Q812 4K6LA 2A69C 1S5CD 4LF6Q 3A8JE 4JBKA 1W2BY 3M4OB 4OL7A 5DEHA 1CSQA 3S24A 3CME1 5GAGC 1PTOD 4WRDA 4BXXG 3GTMS 3G4SA 1SJED 1TT2A 2JIMA 1OTCA 3CQZB 3FP9A 1JJ2Y 1Y14B 3CCE1 2B63I 5JJKA 3BDLA 2E2JB 5EJWA 1RF2D 5FLMG 2R7DA 2JK8A 3K5LA 4C2MH 4JK1C 4EGVA 4FO2A 2NVTH 1JICA 1YJ91 3DWAA 5M5YH 2JA8H 3M7GA 2JE6I 4DV0L 1Q86C 1PFTA 4AH6A 3CCLZ 3ZJYC 2DN8A 3CCVZ 2NZHA 1F2LA 2LSSA 4J15A 1LO5D 1YJN1 1TWFI 2DNEA 5D1OB 2OXPA 5M3MH 2DE7A 3J7AV 1B44D 2EYMA 1CQFA 2ZJPA 2PQEA 3U58A 1BDOA 4K0KQ 1IKLA 5ELDA 2GVBA 2OWOA 3HOYI 2XRQD 1CZGA 4JI3L 5DLQE 2L15A 1W2BZ 1AN8A 4U673 1PYWD 3NPPA 2F4VL 4A3DI 3J7A5 3FRPB 1JJ2Z 1PH1A 2AQ2B 2HCIA 2UXBQ 4GN5A 1GUTA 1EOVA 1WTRA 3NH4A 3CCQA 4CKCA 4KKTA 4L5RC 1S5BD 2H4OA 3D9XA 2WKDA 5CBEE 4LF4L 2Z8LA 4J8QA 2JA7I 3I90A 1MGSA 1PFMA 5E4XA 2WB1E 4A93H 3L3OC 1QYPA 3T1YL 1Y1VS 5C3EI 4LK1C 4UP8A 2F0VA 1YJWA 3J80L 5ELEA 1U9RA 2UXCL 1S72Z 1S40A 4NBEA 2WV6D 3JAME 2Z4IA 1ASZA 1KTKA 3HOZB 1HFNA 2F52A 1E7ZA 2ZXPA 3CXCY 3HZXA 3GV3A 4L6TB 4QQBX 5EPKA 3J80i 2MNAA 3FEWX 3PO2I 4DV7L 4ZRZA 2Q2HA 3F2DA 3T56B 3IL8A 1Y69U 3SXHA 3OTOL 5CMDA 3S14B 4GKJL 1SBBB 3H3VH 4GOPC 2IY5B 4EX5A 2JJQA 2LIYA 1STBA 4UP7A 1WTVA 3PV0A 2B2TA 2BH8A 4RG1A 1VQNZ 1P9NA 5C4JB 4DV0Q 4A3FI 2Y0SB 1W6KA 3VYRA 5C3WA 4DF7A 4XQNA 5FO8B 1FR3A 5CR3A 4B3RQ 4JI7Q 2IJ0A 3QJYA 4OIJA 4ZAIA 2CH4A 2F0KA 4FDBA 1M1K2 3PMFA 4H7BA 1KIXA 1X9NA 2E74C 2EYHA 4GLAC 3CC21 1K8AC 4CJ1B 2Y0SG 4RMFA 1PVOA 1MSGA 3GTOB 1L1OC 1EZ6A 3CXCZ 4E30A 4AIMA 3H3VC 2WINB 2E8GA 2L11A 2F4VQ 3I7FA 4HIKA 2LFUA 1BCPD 1LTID 2HIXA 2MO0A 4QB4A 5CM2M 5JPNC 1KD12 1EOTA 1JORA 3K7AB 4KKUA 4FNFA 4IOAA 2LFNA 1CUKA 1EEFD 1QB5D 4XX2A 1VQ71 1WCMI 1QJOA 2X6GA 3MXNA 2CQAA 1ENAA 5IGDA 1R9TB 4E6IA 4A3BG 4EWCA 4ABNA 1YUKA 4LF8L 2GTHA 4ZQ3A 4RKLA 3D3RA 4LF4Q 2QDBA 1GO3E 1PYSB 1YIJZ 3GTMH 1HNWL 5IIFA 5EAYA 1WOCA 1I3QB 3FKII 3GTQB 1NUCA 1PH6A 5IT9b 1X3WA 5M5WB 5KNBA 2Q8RE 4OWTB 3P75A 2F0PA 2A68D 3PUXA 1RD9D 4MD8A 2B2VC 3NBIA 2UXCQ 3SR1A 1O7YA 4OO1G 4DGZA 1SR3A 3NUCA 3H15A 3W3AA 1DONA 2B3GA 4A3MB 1HNZL 4JC0A 2A6HC 1KDBA 5JEAG 1JMCA 2MQHA 3QOJA 3ZYYX 5ISRA 4HH4A 4POFA 1EQTA 3GTKB 4DV7Q 1USPB 1Q862 1EU4A 4P73A 2RHBA 4A3MG 3OTOQ 1HR0W 4IPDA 4GKJQ 3MZLB 4NXMQ 3E6ZX 3NFZA 4NBDA 2E2HI 4DV6Q 2JA6H 5C4XB 2FJ2A 1Z9FA 1V1OA 4NP5A 3MXNB 4IN3A 3NK9A 4GN3B 2IX0A 2YU9B 3S9WA 2OTL1 3M7NA 1YITZ 5EKLA 3C2PA 3I4NB 4A3EB 5C4XG 1X3EA 2CWPA 3CMEA 1TWCI 2I5MX 4QUFA 4YWMA 1QNKA 2LMCB 2HCCA 4O0AA 4YHHQ 3T16A 4KY5A 2IW3A 3J81j 3S17B 2QEJC 1YHQZ 3I4NG 3CCEA 4A3EG 1EY4A 4DV1Q 3S1NI 4DXFA 1QVFY 1LUZA 1YJ9A 1WTXA 1I4HA 1ZEQX 3KLRA 2SNMA 1K28A 3JAMb 3P1HA 4RVDA 3T4NB 1L2FA 1YNJD 4J6HA 4MXUA 3LGJA 3S1RH 4A3KI 3KYHC 4A76A 1YJNA 1KDAA 3RN5A 5IWAL 2V3VA 1ZYRC 1EYGA 3T53B 2EY2A 3R2IA 4TVAB 4WJ3M 3MZKB 1TWHI 2VUGA 1HNWQ 1EQVA 3DHQA 4BBSB 1ILPA 5CV5A 2L1BA 1WI5A 4EQNA 2R93B 4FP5D 3PUWA 3STBD 3KUPA 2XTIA 3M9BA 1WTPA 1ENFA 1R4QB 5AN9F 5EBCA 4LF7L 2NVXB 5AJ3Q 2PNRC 1FD7D 3TP8A 3U4VA 4BXXI 4EQPA 1CKNA 1VMCA 2KCMA 4BBSG 1JWMD 1KC82 1I6VC 1L0YB 3I2ZA 1QVFZ 1HNZQ 1RJTA 5JEAJ 2V4DA 2JIQA 1LLRD 3NEMA 2R93G 3M4OI 3W2DA 1Q12A 4R8NA 1QVCA 2Z4HA 4DR3L 1S7MA 1ZB8A 3I8ZA 1LTSD 1TKWB 1TWFH 4P71A 2H85A 3HKSA 3DEOA 1B70B 3V96A 4KV6A 2VQFL 4XIGS 1VQK1 4APVA 2E2JI 1A6XA 1RNIA 1G8ZD 3S15I 1N36Q 4EQOA 3CCSA 2KA7A 3HOYH 2P3YA 4AQYL 3S16I 5M5XB 2Z9HA 2K33A 3H6MA 5I9OA 4B08A 2ES2A 3K58A 1K8A2 5KIXA 4E33A 2FXQA 4A3DH 1S4ZA 1EIHA 5G3LD 4KJNA 2F0UA 2VUMG 1G91A 4IPCA 5DM73 3GTJH 2XNAC 1G2TA 3TDQA 3J81c 1RODA 2GVAA 3VR6A 4X6AI 2B2WC 5A2Qb 3HKZB 1KQSY 2RDFA 5LL6S 1RQFA 4DR4L 4R8IA 1GUNA 1XMQL 1IKMA 2A74C 3C1FA 2F0WA 2RVLA 4QIWB 4UP9A 1JQYD 2WAQB 4AYBE 2YTVA 3X3NA 2JA7H 4I7AA 1W6JA 3HKZG 3I4LA 2QEXZ 1UEBA 1SYGA 4LF9L 2NN6G 2AHOB 3KFUA 2AQ1B 2F0TA 3OWEB 1SE3A 2K5RA 2BE5C 1QVGZ 1RTOA 2WAQG 1YNNC 2KEDA 1V1QA 3H91A 1H9SB 3KK7A 1J8IA 1O78A 4JI8L 3CC2A 2C35B 5C5LA 1VQMZ 1CSPA 1QWYA 3Q24A 2K4KA 3KJPA 2BA1A 5CV8A 3PIPA 3HOUB 2HD3A 4JI0Q 3R2TA 4R4QA 3BVGA 2QKIC 1KQSZ 1PRTF 3PO2H 1VLAA 2RT9A 1VQ8Z 1SMYD 3UE1A 3GV6A 4UAIA 4LF7Q 1XNQL 4CDEC 1IBKL 4JI4L 3UDGA 1Q821 1Y1WI 1PFBA 3HOUG 2QLVB 1VQCA 1I4XA 1QZGA 1K8OA 3HOZI 5IYCH 1VQ7A 4IPHA 4RCNA 2WIIB 3UE0A 4F8MA 2PCFB 4A3FH 3S2HB 1LQLA 1KC81 1EYAA 4IFDH 4ILWA 1E0BA 4CHTB 2NB0A 5GADC 4DR3Q 1BR9A 1A15A 5CV4A 4XTCS 3CP0A 2ID0A 1N33L 3S14I 1X3FA 2VQFQ 2RIQA 1K83B 1DL6A 3QWNA 1Q1BA 3CMA1 1K73C 2EDGA 2PZTA 3QG1A 4AQYQ 1Z03A 3B6YA 3CD6Z 1A3VA 3K7UC 1VQEA 5IP7G 3AU7A 4A3JG 4IZ8A 4GN4B 1X0TA 1O80A 3A74A 4DR7L 4ZYSA 1PLFA 1WCMH 1MHWC 2AWNA 1EZ8A 2RF4A 1HNXL 4DR4Q 1XMQQ 3VR4A 1D5MC 4OX9L 1VQAA 3NE5B 1SRUA 4V0BA 2NVYB 4K8IA 1TQOA 1HJPA 3OW7A 4KI0A 1GM5A 1OO9B 3VDYA 2BDNA 1EIYB 3J81E 4LF9Q 3I4MB 2HDMA 1SROA 3Q22A 1O7LA 3TN2A 2EJMA 3M4PA 2KENA 4RVFA 5L37A 2K1BA 4GNXA 2DJFC 3F1ZA 4L5TA 3KF6B 4WJWA 4JI8Q 5J39A 5JJZA 1SJHD 4OO1I 1Z47A 3BDOA 3I3CA 3I4MG 1I3QI 4DAYA 3HOXB 3GTQI 1L0XB 4MN3A 3IRBA 2EZVA 1RL2A 4LF6L 4AYBA 4DNTB 1VQ6Z 1E22A 5JPMC 4LUZA 3LX0A 3CPWA 1TU2B 4JI4Q 4A3MI 5DM63 3HOXG 3OIQA 4RGNA 2VXWA 2E2HH 1B2TA 1ESRA 3BZKA 2F0JA 3HP3A 3M3YH 1VQL1 3VMIA 1Z7TA 4QJFA 1X6OA 2K5HA 1PH2A 3O13A 4R9WA 1DCZA 3TQYA 4YCUA 4X66Q 4G7OC 4KJOA 4HSVA 3G6E1 1STYA 3BYYB 1N33Q 4X3SA 4IJHA 1A3UA 4F7XA 2VL6A 1PV4A 5C4XI 1N9WA 2KVMA 2Y0SE 2L9HA 5D65A 2JA5B 1KRSA 3BDCA 1CA5A 4WJ4A 1HQRD 2VF1A 1JWUD 2ICEC 1K8MA 1GXDC 4K0KL 2KJXA 4MONA 2YU9I 4DR2L 2EVBA 3F2UA 1L0WA 2HHHQ 3UDIA 3S2DB 4Q5VA 3S1NH 3I4NI 5LMNW 2V8KA 4A3EI 1Y8OB 2ZXOA 1BO0A 2JA5G 4C3IH 4DR7Q 2VQEQ 3F3PC 1BKBA 1OXUA 1XWEA 1NAPA 4A3KH 2F4IA 3RLNA 1HNXQ 4C3JB 5C3XA 1WTHA 2TMPA 2A8VA 3S17I 4OX9Q 3CCMZ 2AYDA 1VQKA 5IP9G 2B29A 4F87A 1TVXA 1TWHH 1T9HA 1VQ51 3HOVH 3CCRZ 4JI6L 1AP0A 3VTNA 1Y1VI 5D1OA 1GUSA 1SDFA 4C3JG 2R7ZB 1JWSD 1NSNS 2K52A 4PZ8A 3MTSA 5T1GA 2KOLA 4DUZL 1EY0A 5FKAC 1Q16A 3EN2A 5J3BA 2Z6KC 4ID6A 1SE8A 1U5KA 4NPSA 1X65A 1N8RC 1U0LA 3N6RA 2M2LA 3A5UA 3AEVA 5IODA 2R7ZG 1PRTB 1SNMA 4QGUA 3J80c 3K5MA 4BBSI 4BBRB 1PYBA 3ND8A 3F8TA 1XMOL 2R93I 1B3QA 1I6HB 2EYLA 3FMCA 3I55A 2NVXI 1VF7A 2WFWA 4A3IH 1VS0A 1VQIA 4JW0A 2UUBL 2XWJB 3LUSA 3JAMf 2L5TA 1HHVA 3MC0B 2JUBA 3S15H 4BBRG 1D7QA 4N9PA 2K32A 2EPBA 1Y8PB 1Q7YC 1MI2A 3S1QH 3S16H 1AH9A 3CCJ1 2CW0D 2K7VA 4BY7B 3GTGB 4RVGA 2QA41 1UEAB 1ZXTA 1PZID 2F0HA 3SK4A 3HOWB 4A3LH 1K732 2OF1A 4CGYB 3QIAA 4N8X1 3MEHA 2IX3A 2MO1A 5BN4A 3EJIA 2X6LA 3G71A 1JOOA 4B3RL 3CC4Z 4JI7L 3IFUA 3TDHB 1D5ZC 3NP8A 4BY7G 2F0IA 3HOWG 5TSSA 4EQ5A 4BWGB 1JJCB 1HZCA 2ZT9C 1M4VA 1EL0A 1VCIA 4MH4A 2XRSD 1C8CA 4E2XA 4DR2Q 1HZBA 4IJLA 3UDXA 2ZTEA 1I50B 1SYEA 2Q2TA 4WFN3 1ET6A 3RR5A 2R6GA 1TWGI 1CI3M 4C2MB 1P16A 2NVTB 3PUVA 4TKOB 1M901 1B3AA 1ET9A 2PW5A 2SDFA 5M5YB 2N8NA 2JA8B 3CCL1 1TWAH 1HQMC 3CCV1 3D2LA 2MUYA 4UDUC 3PUYA 3KJOA 2EXZA 1QXFA 3GQBA 2G5DA 5M3MB 2B2UA 4JBWA 2Y0SA 4LAAA 4YY3Q 3CMAA 3CCUZ 1EFID 2K50A 4X3TA 5FOBB 1CTMA 2JA8G 1CZWA 4B3MQ 4JI6Q 1N2FA 1AE2A 3ULLA 3NELA 2OQ0A 1HH2P 1XPOA 1DYQA 4K8JA 4X64L 3MZ5A 2F0QA 4DUZQ 1B50A 5M3MG 4KHVA 4DFAA 2F3WA 4Q0FA 3LWUA 4ME3A 2NTTA 3CCS1 4JI5Q 3BVZA 2QGQA 1IZ6A 1Y1WH 4DU9A 5T64A 5A2Qf 4K2LA 3HOZH 2R3ZA 1C9OA 4C3HH 2AKWB 4L5SA 1AFPA 4B3SL 2F4OA 1VDZA 1XMOQ 2VNUD 3DM1A 3PQIA 5EKKA 1W3SA 3G7LA 2EY5A 1Q811 3MXUA 1QCBD 2CKZB 2UU9Q 2P5ZX 3KLWA 1BF4A 2UUBQ 4Y52I 3HFZB 3J7ZC 4DQYB 3A8IE 1IW7C 3GTPB 3AB9A 1PH7A 4A93B 3IFDA 4K14A 3H0GH 3S2HI 3U9SA 4CJ2C 4NXML 1IBML 4GOPB 3J80E 5H1SE 1CA6A 1B1ZA 4IQZA 1WVLA 4Z9CB 2KHSA 4DV6L 2PZWA 2BH2A 3OW2Y 2C5CA 2ZTDA 3RD4A 2SNSA 2R92H 4DGLA 3CKIB 1NY4A 4A3GB 4ULLA 3Q6SA 4DUYL 4A93G 1HR0Q 4KKSA 2O2LD 1SNDA 2MPMA 1C48A 1EWIA 2D0OA 1ENCA 2JEAI 3P5JB 2PNHA 2D9UA 2RPRA 1V8QA 4YHHL 4A3GG 2RQXA 1VQOA 1L1OB 3BS1A 2XWBB 3BZCA 3WOFA 1JOQA 3KBXA 1VQN1 3HKZE 1AEXA 1VQLA 1USPA 5IGBA 4DV1L 2QW7A 1VQDA 1ZH1A 1K0RA 3MHBA 4A3BB 3IF8A 3MXPA 1D5XC 3P7JA 2IT1A 2OZKA 2J7ZA 1NTGA 1RHPA 3CC7Z 1X56A 2K14A 4QIWE 3G6EA 2WAQE 4H02A 3OW2Z 4GS3A 1HFGA 1VQ9Z 1GVPA 1EUJA 1LTBD 2JIPA 4NOZA 1HA5A 1I3QH 1DM0B 4OXPA 3GKQA 3MONA 1F2YA 1X3QA 4LFAQ 2PZUA 1G2SA 3I4MI 3BG3A 1O7IA 2RDGA 5T1IA 1JR0D 2CH4W 2AUKA 4X64Q 3W1BA 1SYCA 1HRJA 4HGZA 5FLXc 1F9SA 2D5DA 1F9PA 1FGUA 5AJ3L 2OTJZ 2NTSA 3ULJA 5GAHC 3I56A 2KHJA 3E0EA 2FHTA 3M4YA 1EQRA 3HOXI 1PH5A 4M1UB 1FJGL 2PW7A 4B3SQ 1KDCA 3KF8B 3EERA 1AZQA 1Q7Y2 5C44I 3VR5A 3L2PA 4PG3A 4IUNA 2ZJRA 4FVMA 1ML8A 4ZKCB 1MIUA 1NNXA 1PH9A 1YIJ1 1CT1D 1VQ5A 5D14A 2F0MA 5E4WC 5KRUA 1PRTD 3GTMB 2A19A 1AZPA 4LFBL 1YI2A 4O42A 1GUGA 3S1MB 1X54A 2A69D 1A3TA 3TSSA 1K0SA 5IGCA 2DE5A 1IBMQ 1BXTA 1N36L 2XIWA 5DNFA 5K36H 1EFWA 1LT4D 4NBCA 4BY1B 1OXVA 2Z6BA 2ENBA 1Q8KA 1FNVA 2OTLZ 1NJIC 3K59A 3I4NH 3TS0A 3CPFA 2PPBC 3MFYA 4MD9A 1STHA 2B2YA 4E32A 4DUYQ 4I7ZC 1K9MC 2JA5I 1PMRA 3A7AB 3E5SA 4IUTA 4BY1G 1SN8A 4RHSA 4L5QA 4HIOA 1M1K1 4E2YA 3JC66 3D4RA 2NVQH 3S2DI 4MTNA 1QZHA 1VQ4A 5IP9I 2E2IB 5I6YA 1GHJA 3CCJA 1HZ9A 2NBFA 4IALA 1Y1VH 2JA6B 2K5WA 1HTPA 3PIOA 2QA4A 2F0DA 3PO3B 3RZOB 4C56C 3C46A 3NH5A 1VQPA 1YIT1 1ONLA 3H3VJ 1KD11 4FXDA 3BG1B 2J0TD 5GROA 1PH4A 3E3XA 4A3CI 2K5QA 2JA6G 2A1AA 2R61A 1NMGA 3K0XA 3ONAB 3PO3G 4RS4A 4K6DA 3NXWA 2Q2IA 2R7ZI 1S5DD 1PZKD 4UPAA 1YHQ1 5FLXL 4IUUA 2A6EC 5D1PA 3J80b 3A54A 4DNIA 1RCVD 4JI0L 4MRIA 1UE7A 3HKZA 1RO2A 1DOMA 1K8GA 5JVG3 4YCWA 3OIPA 2CHBD 3CCLA 4C1NI 2B63H 3CCVA 4BBRI 2F0EA 4U68A 2WAQA 1LT3D 2QKDA 3A7LA 2YV5A 1FJGQ 3DUZA 3S1RB 2ASBA 1XTDA 1I6HI 3W1GA 5FLMI 4IURA 1KAAA 3I70A 1G291 2ATWA 1ILQA 5FLXE 4RKBA 1GD7A 1TY0A 1W2BA 1YZ6A 2WB1G 4LFBQ 3CQZI 5CV6A 5M5XH 4DNRB 1X3ZA 1H9SA 1X32A 1Q861 4BY7I 1EY9A 3GTGI 2VUMB 3HOWI 4G4KA 1JJ2A 2DY8A 1E3PA 5E3FA 1IL8A 3EFXD 1QVGY 4P72A 3AMUA 2N55A 3OYYA 1TWGH 1FDIA 2D0PA 3TREA 2CCZA 1UE6A 4B3TL 5LL6X 2KEEA 2E7ZA 4KHZA 4CKBA 2AKLA 3SVMA 4DV3L 1V1PB 2K6AA 1PA6A 4LF5Q 1I50I 3Q87A 4G7ZC 2KI7B 5I2YA 5EBDA 1WFQA 3I551 3MAQA 3G4SZ 1E1TA 3KLSX 1BCPF 2L12A 4DK1A 1S72A 1IYJB 1KXLA 4NBFA 4K5XA 1A63A 2I46A 1LABA 5C3EH 2KPIA 4JCVE 3GD7A 1PTOH 3HOYG 3GTJB 5JJIA 3VYTA 3G48A 5KYLA 4MD7A 1E1OA 1LTRD 3J81f 4Y7NB 4ZUJA 3ITPA 1IHZA 3T1HL 1BBUA
chains in the Genus database with same CATH topology
3G711 2JNYA 1TS3A 1JC7A 3GCFA 1XXGA 2K05A 3NDJA 1X3PA 4O1NA 2QEX1 1UAPA 4M8AA 4NB8A 2D2CC 3GTLB 2ZAEB 5FO7B 3I07A 3DXJC 3DMUA 4KN7C 3K57A 4K2KA 1PTOC 4NBGA 4YIJA 3OPOA 1GUWA 3NHHA 1VQM1 1MSHA 1TIID 5EPJA 2E75C 1I4PA 2O5IC 3GTPI 3CCQZ 1BQQT 1FYCA 1PDQA 4A93I 1GUOA 2A6HD 4A3JB 5FO9B 1B9NA 3P20A 5KYIA 1U4PA 4L63B 2A5HA 1K9M2 5C4JI 3SK8A 2BOSA 2LKVA 4RFBA 4XDXA 2AQ3B 4KD3A 4A3GI 2O4XA 1YJWZ 1K8A1 2JYOA 1HA6A 3K6OA 4I65A 4LMQD 1SFOB 5CV9A 3OHXC 5ELFA 1SE2A 1KNAA 3GTOI 1I4RA 5CBAE 2ZXRA 1BUVT 3QOLA 4IFDG 2NUCA 4A3BI 3CD61 2RBMA 1OXTA 3CHBD 5CV7A 3K7AI 5C4HA 1PFNA 2GA4B 4NBHA 4ZK9B 3NWTA 1CFMA 1H9MA 2MP1A 1R9TI 1HPCA 2M48A 3C1EA 2D62A 3SEBA 3HGBA 3KLSA 3TZDA 1JWHC 1H9JA 4HSPA 4FXGC 1TS5A 1D1IA 1ZYRD 2YADA 2K04A 3OOCA 4DAPA 3T4AC 4TQUS 4BA1I 1VQO1 3PUZA 4NH1C 1LV9A 2NZ1D 1KRLA 4NBBA 1NCVA 2XSCA 3NQTA 1KLGD 2M00A 3GTKI 4HGYA 3IAYA 2G2KA 3D31A 3S1MI 3D6WA 1PXUA 4KTAA 3SE0A 1VQ61 3VR2A 5C4ZA 4BY1I 4LJZC 4H13C 1F77A 2OEOA 4WORA 1YUAA 4QMGA 1STEA 2E2HB 3KIFA 1F9QA 2HQEA 5G3LF 5COYA 3M3YB 2BJOA 1D1KA 3C3LA 1SXTA 2G9DA 2Q8TA 4XQJA 4HMIA 3NWSA 2W04A 3CRKC 3I561 2F0LA 3TP5A 4RHRA 2JP1A 1ESFA 2ICIA 1BBXC 4NFRA 1A2UA 1BCPC 2E2II 4IFDJ 2RSOA 1SEBD 2JA6I 5IGFA 2IPKD 3RZOI 3PO3I 3I91A 2JMOA 3TMEA 3R3OA 1YI21 4RWSC 5EKIA 2PMZB 2K5DA 1GJXA 1Z01A 2F4MA 4C3IB 1LTTD 3I72A 2R6MA 1NP6A 4A3KB 2M9VA 1Q8IA 2A68C 2BE5D 4XT3B 2OOXB 2AWOA 5T67A 1B4OA 3CMEZ 2JS4A 1YNND 1TWHB 5C0XG 4C3IG 3HOVB 3RZDB 4HAEA 2XN9C 1D6EC 4PQXA 3CCEZ 3L7ZC 4J1MA 2Q51A 4S3SA 1VQ41 4E2WA 1YJ9Z 5IT9L 2MGSA 3V05A 2K01A 4HCSA 3GO5A 1VQP1 1YJNZ 1SAPA 2F3VA 3J80f 2VUMI 5A35A 1E2WA 1QNUA 1TY2A 4QF4A 4A3IB 5I6WA 5J22A 4S1TA 3J81b 1JB3A 3VA5A 2AUJD 2IX1A 3S15B 2QCPX 5IT9E 3OMGA 3L9AX 1B53A 1DXMA 3FPUB 3S1QB 5JVH3 3S16B 2E9HA 2QF7A 1EU3A 1SNQA 5IGEA 3EROA 1FGBD 2VB2X 4X3KA 3KIHA 1B9MA 1HTLD 2EYOA 3ND9A 1QG7A 2HUGA 3CC41 2NN6I 1U4LA 1KNEA 1D2BA 1U4RA 1CQVA 4PMWA 4OGQC 1YNJC 3VYUA 2IL8A 2KQ3A 2GTIA 1UUPA 3CCSZ 3HG9A 3PO3S 5DAUA 5M9OA 1ZB9A 3GTJI 3PIP3 1OXSC 3MXGA 4PV1C 1XX8A 1II3A 1TWAB 4Y7NI 4BA2I 3NBHA 2C9OA 3JAML 3QWUA 4FXKC 3TP6A 2B8GA 5JOBA 2K3RA 3HOUI 3SHLA 3GP7A 1S5FD 2KECA 1ML0D 3CCU1 3HS0C 3X3MA 5C0XJ 4XYQA 4OHJA 3GTLI 3IKJA 4RV9A 2JR6A 3I73A 1GOZA 3OWFA 3NSWA 4F88A 2O4HA 2BCOA 3D4DA 4HMJA 2OT2A 1RTNA 2BA0A 1ZKOA 3VMGA 1Y1WB 3VA7A 1T5EA 1S721 4C3HB 4PMCA 4IUPA 2F03A 3BYTB 1K731 5IP7I 2H1EA 4A3JI 5BN3A 1K83I 2G9HD 1NR4A 3CC2Z 2KUMA 2B2VA 3FVQA 1GHKA 2WACA 1CHPD 5ELBA 2QRDB 1J9OA 2EOTA 3KF8A 1NUIA 4C3HG 2Q4ZA 1T5XD 3FQMA 4H44C 2B2UC 4C1NK 3H0GB 1E2VA 1HCZA 4DA2A 1EWHA 1LT6D 4IFDI 2N88A 1SFOI 5HURA 3Q23A 1XYIA 2R92B 5J1ZA 1VQ7Z 2RKSA 2EJGC 4KK7A 2NVYI 2EYJA 4DXGA 3QB3A 1TFIA 1Z6HA 4OO1H 2TSSA 2RBLA 2QR1B 1N8R2 5A2QL 2E2DC 5E1FA 4TRDA 5JEAH 2MHVA 1Q90A 1MBYA 1RO4A 3CC71 4FF4A 3K5OA 3V2TA 1VQ91 1PZJD 1SMYC 4QUCA 4HTHA 4DK0A 4RGTA 3NTKA 5A2QE 2B2TC 3BG0B 2K28A 5KEEA 4XXEA 3U9OA 2F0SA 2PYKA 2B8FA 3CPWY 1PTOF 4FYDA 1IYUA 5EPLA 2EYPA 3VMHA 3D6CA 3J7AF 4RH6A 5FLXf 2OTJ1 4PNYA 1RKNA 1TR5A 1C4QA 4RCOA 2EJFC 4CBVA 1IYVA 1LTGD 3SK6A 4KY6A 2EY6A 2F0FA 3IX0A 4IUQA 2HDLA 2WB1A 2EGTA 1EY6A 4TSSA 5LL6f 1HXYD 1WTWA 1F9RA 1STNA 3M3YI 2E76C 3CPWZ 4KY7A 1DOKA 2HF1A 2F0GA 2DY7A 3G6JB 4ZKBB 3EQLC 3J7A4 4XQQA 2L4NA 4N9TA 5K36G 2BDOA 1AW7A 1DJRD 1KLUD 3QO2A 1SYFA 4CKEA 2NVQB 1WD0A 2FFKB 1N8R1 4TNUA 1WW9A 2L55A 5D3DA 2B2WA 4HN7A 1Y1VB 5C0XI 1V1PA 3FQQA 1KABA 3R8BA 3N52A 1CM9A 1DOLA 1WTOA 3Q0AA 1QOHA 3RMHA 2WB1B 5JAVA 2I07B 4G7HC 1LTAD 1E2ZA 1SNPA 3EVQA 3HOVI 3RZDI 2JXMB 1EWCA 1H9KA 1Q7Y1 3CU7A 3NH8A 3RUZA 4KMUC 2K03A 1VQKZ 2B2YC 2IZ3A 1Q822 2HU9A 2DE6A 5F2DA 1NR2A 5D3IB 2VB3X 5KNCA 1SYDA 1H9RA 1BNZA 1EY8A 4HR7B 4DAVA 2A73B 2SEBD 5CORA 2B63B 1OXXK 1IW7D 2M6NA 1M8AA 1Q3LA 3LWEA 4A3II 2NN6H 1BOSA 3SDZA 3TBIB 1TWFB 3ERQA 1UNSA 3S1QI 2V8IA 3I55Z 5ELCA 2O5JC 2NVTI 4A3LI 3HOYB 2JA8I 3H94A 4P2CB 3D8GA 1TWGB 4A3DB 4QTUA 5K5PA 1S5ED 4X3UA 2YYZA 1Q1EA 4MIUA 2WP8J 3NQIA 3DEPA 5FK9C 3MA2B 3G71Z 1LACA 4KD4A 3A56A 1F2ZA 2GU2A 2OOYB 3BZDB 3HEJA 3G4S1 3ESWA 3EA6A 4K5WA 4B9WA 1TWAI 3DWPA 4L8JA 2JA7B 1MD2D 3OSOA 2NYZD 4NBAA 4MHEA 2QRCB 3URYA 3LNNA 5C3EB 2IWHA 1QILA 1PTOB 3VYSA 5I4DA 4CJ0B 1CK1A 1DZ1A 4G57A 2JEBI 2CW0C 1R4PB 1FNWA 1JE4A 1NJI2 1G6ZA 5I2XA 2F1MA 3CMAZ 2LS01 4RA8A 1VQ81 3PO2B 1V43A 1DD2A 4H0LC 3J7YW 5EQ0A 4ZUIA 2RDHA 2DNCA 2F0NA 1STGA 1F2MA 2FMCA 3OMCA 4A3FB 3MWYW 2QREB 4ME5A 1EEID 1EY7A 3CCQ1 4IUVA 1WD1A 4QTTA 2FINB 2FMMA 3H0GI 1EYCA 1RLYA 5BN5A 3M85A 5IGGA 1QF8A 5HGTA 1EY5A 1QE6A 1VMPA 4HCEA 4HEDA 2X69A 3TE5B 2R92I 3D4WA 3J81L 1Y8NB 3T51B 3HRZC 1YJW1 4NMZA 4NDXA 4XT1B 1RO0A 4NW2A 4QCLA 5FLXb 1WCMB 5IOCA 1O7ZA 3FDTA 3CRLC 4RGMA 4K5VA 3TP7A 2XVSA 2RA4A 1TS4A 1VQOZ 2J6AA 3FKIB 3H09A 3UI2A 3WDNA 1I4GA 2EYFA 4BS9A 2EY1A 2SOBA 1VQLZ 2A6ED 3K5NA 2CVRA 4RAUC 1HUNA 2I3CA 4FF2A 4B9XA 2IZ4A 5KNDA 1HUMA 1RDPD 3G6EZ 1A2TA 5M3FB 2PMZA 1SNCA 2Z1CA 3EEDA 3GTMI 2O53A 5C44B 4ODGA 3RLFA 4CL1A 1NJI1 3MVVA 3VB9A 4ZLTF 1FNUA 3SK5A 2QILA 4KN4C 1K9M1 1LT5D 2KCCA 5CYUA 2W03A 2MJ8A 3NDIA 5C5MA 1ICWA 3U50C 3E0JA 1SE4A 3DWQA 3K0YA 3NTHA 3I56Z 3KBGA 5IT9f 5LHY1 2V8JA 3PIO3 4XYOA 5EGTA 1SSOA 1TS2A 3WOEA 2JSOA 4NB9A 4FF1A 4FF3A 4E2ZA 1BCPB 3BVMA 4RVHA 1VQ5Z 1TWCB 2B39A 1YI2Z 1EYDA 1EIGA 1M902 1SYBA 4EVOA 2RSNA 4NKLA 3VR3A 5C0XH 1WTQA 2Q8IB 5CC4A 3S1NB 3A8KE 4DN4M 4AYBB 5CGKA 3NTIA 3MFGA 2PO4A 2P28A 2WKCA 1STAA 5C6AA 2NVQI 2KCNA 4E31A 2LY7A 4GZYC 2PK7A 2EE1A 1U4MA 3CCM1 2NWGA 4RGOS 3R93A 3IFTA 1VF5C 2L0CA 2F0OA 1I4QA 3F3FC 3T13A 1Z02A 1XTCD 3CCR1 4V190 5I9PA 4OIKA 4PMBA 1WIIA 5KGUA 1CHQD 3A55A 5T6BA 1VQ4Z 2PM9A 1JOKA 3CCJZ 2J4XA 3S1RI 1SNOA 2QA4Z 1JCKB 1PRTC 5AFWA 3FPPA 3TZUA 1VQPZ 1Q812 4K6LA 2A69C 1S5CD 3A8JE 3M4OB 1W2BY 4OL7A 5DEHA 3CME1 1PTOD 4WRDA 3GTMS 1SJED 1TT2A 3CQZB 1JJ2Y 3CCE1 2B63I 3BDLA 2E2JB 5EJWA 1RF2D 3K5LA 4EGVA 4JK1C 4FO2A 1JICA 1YJ91 3DWAA 3M7GA 2JE6I 1PFTA 3CCLZ 2DN8A 3CCVZ 1F2LA 1LO5D 1YJN1 1TWFI 2DNEA 5D1OB 2OXPA 2DE7A 3J7AV 1B44D 2EYMA 1CQFA 2PQEA 1BDOA 1IKLA 5ELDA 3HOYI 2XRQD 1CZGA 1W2BZ 1AN8A 4U673 1PYWD 3NPPA 4A3DI 3FRPB 1JJ2Z 2AQ2B 2HCIA 1GUTA 1WTRA 3NH4A 4CKCA 4KKTA 1S5BD 2H4OA 2WKDA 3D9XA 5CBEE 2Z8LA 4J8QA 2JA7I 3I90A 1MGSA 1PFMA 5E4XA 3L3OC 1QYPA 1Y1VS 5C3EI 4LK1C 2F0VA 3J80L 5ELEA 1U9RA 1S72Z 4NBEA 2WV6D 3JAME 2Z4IA 1KTKA 3HOZB 1HFNA 2ZXPA 3CXCY 3HZXA 3GV3A 4L6TB 5EPKA 3FEWX 3PO2I 4ZRZA 3T56B 3IL8A 1Y69U 3SXHA 5CMDA 3S14B 1SBBB 2LIYA 1STBA 1WTVA 3PV0A 2B2TA 1VQNZ 1P9NA 5C4JB 4A3FI 2Y0SB 1W6KA 3VYRA 5C3WA 4DF7A 4XQNA 5FO8B 1FR3A 5CR3A 2IJ0A 3QJYA 4OIJA 4ZAIA 2F0KA 1M1K2 3PMFA 4H7BA 2E74C 2EYHA 3CC21 4CJ1B 1MSGA 3GTOB 1L1OC 1EZ6A 3CXCZ 4E30A 3H3VC 2WINB 2L11A 2LFUA 1BCPD 1LTID 4QB4A 5CM2M 5JPNC 1KD12 1EOTA 1JORA 3K7AB 4KKUA 4FNFA 2LFNA 1EEFD 1QB5D 4XX2A 1VQ71 1WCMI 1QJOA 2X6GA 3MXNA 2CQAA 1ENAA 5IGDA 1R9TB 4E6IA 4EWCA 4ABNA 1YUKA 2GTHA 4ZQ3A 4RKLA 3D3RA 2QDBA 1YIJZ 5IIFA 1I3QB 3FKII 3GTQB 1NUCA 5IT9b 1X3WA 5M5WB 5KNBA 2Q8RE 3P75A 2F0PA 2A68D 3PUXA 1RD9D 4MD8A 2B2VC 3NBIA 3SR1A 1O7YA 4OO1G 4DGZA 3NUCA 1DONA 3W3AA 4A3MB 2A6HC 1KDBA 5JEAG 3ZYYX 3QOJA 5ISRA 4HH4A 1EQTA 3GTKB 1USPB 1Q862 1EU4A 2RHBA 3MZLB 3E6ZX 3NFZA 4NBDA 2E2HI 5C4XB 2FJ2A 1V1OA 4NP5A 4IN3A 3NK9A 2IX0A 2YU9B 3S9WA 2OTL1 3M7NA 1YITZ 5EKLA 3C2PA 3I4NB 4A3EB 1TWCI 4QUFA 1QNKA 2LMCB 2HCCA 3T16A 4KY5A 2IW3A 3S17B 2QEJC 1YHQZ 1EY4A 3S1NI 4DXFA 1QVFY 1WTXA 1I4HA 1ZEQX 3KLRA 2SNMA 3JAMb 3P1HA 4RVDA 3T4NB 1YNJD 4J6HA 4MXUA 4A3KI 1KDAA 1ZYRC 3T53B 2EY2A 3R2IA 3MZKB 1TWHI 2VUGA 1EQVA 3DHQA 4BBSB 1ILPA 5CV5A 2L1BA 4EQNA 2R93B 4FP5D 3PUWA 3KUPA 1WTPA 1ENFA 1R4QB 5AN9F 5EBCA 2NVXB 2PNRC 1FD7D 3TP8A 4EQPA 4BXXI 1VMCA 1JWMD 1KC82 1I6VC 1L0YB 1QVFZ 1RJTA 5JEAJ 2V4DA 1LLRD 3M4OI 3W2DA 1Q12A 4R8NA 2Z4HA 1S7MA 1ZB8A 3I8ZA 1LTSD 1TKWB 2H85A 3DEOA 3V96A 4KV6A 4XIGS 1VQK1 1A6XA 2E2JI 1RNIA 1G8ZD 3S15I 4EQOA 2KA7A 2P3YA 3S16I 5M5XB 2K33A 3H6MA 5I9OA 4B08A 3K58A 1K8A2 5KIXA 4E33A 1S4ZA 1EIHA 5G3LD 4KJNA 2F0UA 1G91A 5DM73 2XNAC 1G2TA 3TDQA 1RODA 3VR6A 4X6AI 2B2WC 5A2Qb 3HKZB 1KQSY 2RDFA 5LL6S 1RQFA 4R8IA 1GUNA 1IKMA 2A74C 3C1FA 2F0WA 2RVLA 4QIWB 1JQYD 2WAQB 3X3NA 1W6JA 3I4LA 2QEXZ 1SYGA 2NN6G 2AQ1B 2F0TA 3OWEB 1SE3A 2K5RA 2BE5C 1QVGZ 1RTOA 1YNNC 2KEDA 3H91A 1H9SB 3KK7A 1J8IA 1O78A 5C5LA 1VQMZ 3Q24A 1QWYA 2BA1A 5CV8A 3HOUB 3R2TA 3BVGA 2QKIC 1KQSZ 1PRTF 1VLAA 2RT9A 1VQ8Z 1SMYD 3GV6A 4UAIA 1Q821 1Y1WI 1PFBA 2QLVB 1I4XA 1K8OA 3HOZI 4RCNA 2WIIB 4F8MA 2PCFB 3S2HB 1LQLA 1KC81 1EYAA 4IFDH 4ILWA 1E0BA 4CHTB 2NB0A 1BR9A 1A15A 5CV4A 4XTCS 2ID0A 3S14I 2RIQA 1K83B 1DL6A 3QWNA 1Q1BA 3CMA1 2PZTA 2EDGA 3QG1A 1Z03A 3CD6Z 1A3VA 3AU7A 4IZ8A 1X0TA 1O80A 4ZYSA 1PLFA 2AWNA 1EZ8A 3VR4A 1D5MC 4V0BA 3NE5B 2NVYB 4K8IA 1TQOA 3OW7A 4KI0A 1OO9B 2BDNA 3J81E 3I4MB 2HDMA 3Q22A 1O7LA 3TN2A 2EJMA 4RVFA 2K1BA 4WJWA 5J39A 5JJZA 1SJHD 4OO1I 1Z47A 3BDOA 3I3CA 1I3QI 4DAYA 3HOXB 3GTQI 1L0XB 4MN3A 2EZVA 4AYBA 4DNTB 1VQ6Z 5JPMC 3LX0A 1TU2B 4A3MI 5DM63 3OIQA 4RGNA 2VXWA 1B2TA 1ESRA 2F0JA 3HP3A 1VQL1 3VMIA 1Z7TA 3O13A 4R9WA 1DCZA 4G7OC 4KJOA 4HSVA 3G6E1 1STYA 3BYYB 4X3SA 1A3UA 4F7XA 5C4XI 2KVMA 2L9HA 5D65A 2JA5B 3BDCA 1CA5A 1HQRD 2VF1A 1JWUD 2ICEC 1K8MA 1GXDC 2KJXA 4MONA 2YU9I 2EVBA 3F2UA 3S2DB 4Q5VA 3I4NI 2V8KA 4A3EI 1Y8OB 2ZXOA 1BO0A 3F3PC 1OXUA 1XWEA 1NAPA 2F4IA 4C3JB 5C3XA 2TMPA 3S17I 3CCMZ 4F87A 1TVXA 1VQ51 3CCRZ 1AP0A 3VTNA 1Y1VI 5D1OA 1GUSA 1SDFA 4C3JG 2R7ZB 1JWSD 1NSNS 5T1GA 3MTSA 2KOLA 1EY0A 5FKAC 4ID6A 3N6RA 2M2LA 5IODA 1PRTB 1SNMA 3K5MA 4BBSI 4BBRB 3ND8A 2R93I 1I6HB 2EYLA 3FMCA 2NVXI 1VF7A 2XWJB 3LUSA 3JAMf 2L5TA 1HHVA 3MC0B 2JUBA 4N9PA 2K32A 2EPBA 1Y8PB 1MI2A 3CCJ1 2CW0D 2K7VA 4BY7B 3GTGB 4RVGA 2QA41 1UEAB 1ZXTA 1PZID 2F0HA 3SK4A 3HOWB 1K732 2OF1A 4CGYB 3QIAA 3MEHA 2IX3A 5BN4A 3EJIA 2X6LA 1JOOA 3CC4Z 3IFUA 3TDHB 1D5ZC 3NP8A 2F0IA 5TSSA 4BWGB 2ZT9C 1M4VA 1EL0A 1VCIA 4MH4A 2XRSD 1C8CA 4E2XA 1I50B 1SYEA 4WFN3 1ET6A 2R6GA 1TWGI 1CI3M 4C2MB 2NVTB 3PUVA 4TKOB 1M901 1B3AA 1ET9A 2PW5A 2SDFA 5M5YB 2JA8B 3CCL1 1HQMC 3CCV1 2MUYA 4UDUC 3PUYA 2EXZA 3GQBA 5M3MB 2B2UA 4JBWA 2Y0SA 4LAAA 3CCUZ 1EFID 4X3TA 5FOBB 1CTMA 1CZWA 1N2FA 1DYQA 4K8JA 3MZ5A 2F0QA 1B50A 4KHVA 4DFAA 2F3WA 4Q0FA 3LWUA 2NTTA 3CCS1 3BVZA 4DU9A 5T64A 5A2Qf 4K2LA 2R3ZA 1AFPA 2F4OA 1VDZA 2VNUD 3DM1A 5EKKA 3G7LA 2EY5A 1Q811 3MXUA 1QCBD 1BF4A 4Y52I 4DQYB 3A8IE 1IW7C 3GTPB 3AB9A 4A93B 3IFDA 4K14A 3U9SA 3S2HI 4CJ2C 3J80E 1CA6A 1B1ZA 4IQZA 1WVLA 4Z9CB 2KHSA 2PZWA 3OW2Y 2C5CA 3RD4A 2SNSA 4DGLA 3CKIB 4A3GB 4ULLA 3Q6SA 4KKSA 2O2LD 1SNDA 2MPMA 1C48A 1ENCA 2JEAI 3P5JB 2D9UA 2RPRA 1V8QA 2RQXA 3BS1A 2XWBB 3WOFA 1JOQA 3KBXA 1VQN1 1AEXA 1USPA 5IGBA 1ZH1A 3MHBA 4A3BB 3IF8A 3MXPA 1D5XC 3P7JA 2IT1A 2OZKA 2J7ZA 1RHPA 3CC7Z 3OW2Z 1HFGA 1VQ9Z 1LTBD 4NOZA 1HA5A 1DM0B 3GKQA 3MONA 1F2YA 1X3QA 2PZUA 1G2SA 3I4MI 3BG3A 2RDGA 5T1IA 1JR0D 2AUKA 1SYCA 1HRJA 4HGZA 1F9SA 2D5DA 1F9PA 2OTJZ 2NTSA 2FHTA 3M4YA 3HOXI 4M1UB 2PW7A 1KDCA 1AZQA 3EERA 1Q7Y2 5C44I 3VR5A 4IUNA 4FVMA 1ML8A 4ZKCB 1YIJ1 1CT1D 5D14A 2F0MA 5E4WC 5KRUA 1PRTD 3GTMB 1AZPA 4O42A 1GUGA 3S1MB 2A69D 1A3TA 3TSSA 5IGCA 2DE5A 1BXTA 2XIWA 5DNFA 5K36H 1LT4D 4NBCA 4BY1B 1OXVA 2ENBA 1FNVA 2OTLZ 3K59A 2PPBC 3MFYA 4MD9A 1STHA 2B2YA 4E32A 4I7ZC 2JA5I 1PMRA 3A7AB 3E5SA 4IUTA 4RHSA 1M1K1 4E2YA 3D4RA 3S2DI 5IP9I 2E2IB 5I6YA 1GHJA 2NBFA 4IALA 2JA6B 2K5WA 1HTPA 3PO3B 2F0DA 3RZOB 4C56C 3C46A 3NH5A 1YIT1 1ONLA 3H3VJ 1KD11 4FXDA 3BG1B 2J0TD 4A3CI 2K5QA 2R61A 3ONAB 4RS4A 4K6DA 3NXWA 2R7ZI 1S5DD 1PZKD 1YHQ1 5FLXL 4IUUA 2A6EC 5D1PA 3J80b 3A54A 1RCVD 4MRIA 3HKZA 1RO2A 1DOMA 5JVG3 3OIPA 2CHBD 4C1NI 4BBRI 2F0EA 4U68A 2WAQA 1LT3D 2QKDA 3A7LA 3DUZA 3S1RB 1I6HI 5FLMI 4IURA 1KAAA 3I70A 1G291 1ILQA 5FLXE 4RKBA 1TY0A 3CQZI 5CV6A 4DNRB 1X3ZA 1H9SA 1X32A 1Q861 4BY7I 1EY9A 3GTGI 2VUMB 3HOWI 4G4KA 2DY8A 5E3FA 1IL8A 3EFXD 1QVGY 3AMUA 2N55A 5LL6X 2KEEA 4KHZA 4CKBA 2AKLA 3SVMA 1V1PB 2K6AA 1I50I 3Q87A 4G7ZC 2KI7B 5I2YA 5EBDA 3MAQA 3I551 3G4SZ 3KLSX 1BCPF 2L12A 4DK1A 4NBFA 4K5XA 2I46A 1LABA 2KPIA 3GD7A 1PTOH 3GTJB 3VYTA 5KYLA 4MD7A 1LTRD 3J81f 4Y7NB 4ZUJA 3ITPA 1IHZA 5NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNY A;  5CBE E;  5C4X I;  2KVM A;  2L9H A;  5D65 A;  1CA5 A;  3GCF A;  1WTW A;  2JA7 I;  3I90 A;  1MGS A;  1PFM A;  5E4X A;  1F9R A;  2K05 A;  2YU9 I;  1X3P A;  3M3Y I;  3F2U A;  1QYP A;  1Y1V S;  4NB8 A;  5C3E I;  3I4N I;  4A3E I;  3I07 A;  1DOK A;  1BO0 A;  2HF1 A;  2DY7 A;  4NBE A;  4ZKB B;  4NBG A;  1NAP A;  1HFN A;  1GUW A;  2L4N A;  1MSH A;  3S17 I;  5EPJ A;  3GV3 A;  5EPK A;  3GTP I;  3QO2 A;  3PO2 I;  1PDQ A;  4A93 I;  1TVX A;  3IL8 A;  1AP0 A;  1U4P A;  5CMD A;  1WD0 A;  2FFK B;  1Y1V I;  1SDF A;  1WW9 A;  5C4J I;  5T1G A;  3MTS A;  4XDX A;  2KOL A;  2B2W A;  1WTV A;  2B2T A;  4A3G I;  4A3F I;  3N52 A;  1CM9 A;  2JYO A;  1DOL A;  1WTO A;  1HA6 A;  2M2L A;  4LMQ D;  4OIJ A;  4ZAI A;  4BBS I;  1KNA A;  3HOV I;  3RZD I;  3GTO I;  2R93 I;  4CJ1 B;  5CBA E;  2NVX I;  1MSG A;  1L1O C;  2K03 A;  2B2Y C;  3LUS A;  1HHV A;  2DE6 A;  1NR2 A;  4A3B I;  2L11 A;  2EPB A;  1BNZ A;  1MI2 A;  3K7A I;  5CM2 M;  1PFN A;  1EOT A;  5COR A;  4NBH A;  1ZXT A;  4ZK9 B;  4XX2 A;  1WCM I;  1M8A A;  2MP1 A;  2X6G A;  1R9T I;  1Q3L A;  2X6L A;  3LWE A;  4A3I I;  3TZD A;  1EL0 A;  3FKI I;  4MH4 A;  3S1Q I;  1C8C A;  2K04 A;  1X3W A;  2Q8R E;  2NVT I;  4A3L I;  2JA8 I;  1TWG I;  2B2V C;  1B3A A;  2SDF A;  1O7Y A;  1LV9 A;  2NZ1 D;  1DON A;  4NBB A;  1NCV A;  4QTU A;  4X3U A;  3GTK I;  3DEP A;  1EQT A;  2B2U A;  3S1M I;  3D6W A;  1USP B;  4X3T A;  1N2F A;  4BY1 I;  4NBD A;  3ESW A;  2E2H I;  1B50 A;  2FJ2 A;  1TWA I;  1YUA A;  1F9Q A;  2NYZ D;  4NBA A;  4MHE A;  5COY A;  2BJO A;  2R3Z A;  2Q8T A;  2F4O A;  2JP1 A;  3DM1 A;  4CJ0 B;  1TWC I;  3G7L A;  1BBX C;  4QUF A;  1DZ1 A;  2E2I I;  1QNK A;  2HCC A;  2RSO A;  1BF4 A;  2JA6 I;  1JE4 A;  1G6Z A;  4Y52 I;  3RZO I;  3PO3 I;  3I91 A;  4RA8 A;  3S1N I;  3IFD A;  4CJ2 C;  3S2H I;  1WTX A;  4RWS C;  1CA6 A;  5EKI A;  1WVL A;  5EQ0 A;  2F4M A;  4A3K I;  3Q6S A;  3MWY W;  2MPM A;  1TWH I;  4XT3 B;  4IUV A;  1WD1 A;  1B4O A;  4QTT A;  2JS4 A;  2D9U A;  1ILP A;  2FIN B;  2FMM A;  2L1B A;  3H0G I;  1RLY A;  3KUP A;  4HAE A;  1WTP A;  1QE6 A;  1VMP A;  3KBX A;  4HED A;  2X69 A;  2R92 I;  1USP A;  4BXX I;  1VMC A;  3P7J A;  2J7Z A;  1RJT A;  2MGS A;  1RHP A;  3M4O I;  2K01 A;  4XT1 B;  4HCS A;  1HFG A;  4NW2 A;  1ZB8 A;  3I8Z A;  1SAP A;  4NOZ A;  3DEO A;  1O7Z A;  2VUM I;  3GKQ A;  3FDT A;  2E2J I;  1X3Q A;  1G2S A;  3I4M I;  3S15 I;  5T1I A;  2P3Y A;  2RA4 A;  3S16 I;  1HRJ A;  1F9S A;  2J6A A;  1B53 A;  3FPU B;  1F9P A;  3UI2 A;  1S4Z A;  1EIH A;  2CVR A;  2FHT A;  4RAU C;  3HOX I;  1G91 A;  1HUN A;  4X3K A;  1G2T A;  1AZQ A;  3EER A;  1QG7 A;  2HUG A;  1ROD A;  4X6A I;  1HUM A;  5C44 I;  1U4L A;  2B2W C;  1KNE A;  1ML8 A;  3GTM I;  4ZKC B;  4R8I A;  1U4R A;  1IKM A;  5D14 A;  5E4W C;  2RVL A;  1AZP A;  4O42 A;  2IL8 A;  3VB9 A;  4ZLT F;  2DE5 A;  2XIW A;  5DNF A;  3PO3 S;  4NBC A;  1ZB9 A;  3GTJ I;  2MJ8 A;  1ICW A;  3U50 C;  2K5R A;  1XX8 A;  1RTO A;  4Y7N I;  2KED A;  2B2Y A;  3H91 A;  1J8I A;  2JA5 I;  3HOU I;  4IUT A;  2KEC A;  1ML0 D;  1SSO A;  4NB9 A;  3S2D I;  1VLA A;  3GTL I;  5IP9 I;  2JR6 A;  3GV6 A;  4UAI A;  1EIG A;  2RSN A;  1Y1W I;  1PFB A;  1RTN A;  3HOZ I;  1WTQ A;  3VMG A;  1LQL A;  4DN4 M;  3H3V J;  1E0B A;  4IUP A;  1A15 A;  4A3C I;  5IP7 I;  2H1E A;  4A3J I;  3ONA B;  2NVQ I;  1K83 I;  2PK7 A;  2EE1 A;  1NR4 A;  3S14 I;  2KUM A;  1U4M A;  2B2V A;  2NWG A;  3R93 A;  2R7Z I;  1DL6 A;  4IUU A;  1J9O A;  2EOT A;  1NUI A;  4OIK A;  1DOM A;  2B2U C;  2N88 A;  1SFO I;  3S1R I;  4BBR I;  1O80 A;  4U68 A;  1XYI A;  5AFW A;  1I6H I;  5FLM I;  4IUR A;  1PLF A;  2NVY I;  1ILQ A;  1TFI A;  2RBL A;  3CQZ I;  3GTM S;  1X3Z A;  1X32 A;  4BY7 I;  2BDN A;  3GTG I;  3HOW I;  2B63 I;  5EJW A;  2DY8 A;  2HDM A;  1IL8 A;  1JIC A;  1RO4 A;  2N55 A;  3TN2 A;  1PFT A;  2K1B A;  1F2L A;  2KEE A;  1TWF I;  5JJZ A;  4QUC A;  2DE7 A;  3I3C A;  1I3Q I;  2AKL A;  3SVM A;  3GTQ I;  4MN3 A;  2B2T C;  1IKL A;  2K28 A;  1I50 I;  3Q87 A;  3HOY I;  5EPL A;  3VMH A;  2L12 A;  4A3M I;  4A3D I;  2VXW A;  1B2T A;  1ESR A;  3HP3 A;  4NBF A;  3VMI A;  2HCI A;  2KPI A;  4R9W A;  1WTR A;  4HSV A;  4X3S A;  4IUQ A;  2HDL A; 
#chains in the Genus database with same CATH topology
 3G71 1;  2JNY A;  1LM0 A;  1TS3 A;  1JC7 A;  3GCF A;  1XXG A;  1EQQ A;  2RCN A;  3NEN A;  4Y52 H;  2K05 A;  3NDJ A;  1VQN A;  2K5V A;  2QDL A;  1X3P A;  4O1N A;  2QEX 1;  1UAP A;  4QY7 A;  5ELO A;  4M8A A;  2V45 A;  4NB8 A;  2D2C C;  3GTL B;  3S2H H;  3KOJ A;  2ZAE B;  5FO7 B;  3I07 A;  3DXJ C;  3DMU A;  1P8L A;  1JB7 A;  1VQB A;  4HIM A;  4KN7 C;  3K57 A;  4K2K A;  1PTO C;  4NBG A;  4A4I A;  4YIJ A;  3OPO A;  1MJC A;  1GUW A;  3NHH A;  1VQM 1;  1G51 A;  4JI1 L;  1MSH A;  1TII D;  5EPJ A;  2E75 C;  4X66 L;  1I4P A;  3CXC A;  2O5I C;  3GTP I;  3CCQ Z;  1BQQ T;  1FYC A;  1PDQ A;  3E9I A;  4A93 I;  1GUO A;  1D8L A;  2A6H D;  4A3J B;  5FO9 B;  1B9N A;  3KF6 A;  3P20 A;  5KYI A;  1U4P A;  2V1C C;  4L63 B;  2VW9 A;  2A5H A;  1K9M 2;  5C4J I;  3SK8 A;  2BOS A;  2LKV A;  4RFB A;  4XDX A;  2AQ3 B;  4KD3 A;  4ZCK A;  1MJE A;  4A3G I;  2HHH L;  1K3B C;  2O4X A;  1YJW Z;  1K8A 1;  2JYO A;  2N3S A;  3RLO A;  4B3T Q;  3PO2 G;  1HA6 A;  3K6O A;  4I65 A;  4LMQ D;  1SFO B;  1I94 Q;  5CV9 A;  3OHX C;  5ELF A;  1SE2 A;  3KDF B;  3Q8D A;  4R4C A;  1KNA A;  2VQE L;  4DV4 L;  1YIJ A;  3GTO I;  4DV3 Q;  1I4R A;  1WYD A;  5CBA E;  2Z0S A;  2ZXR A;  5IYC G;  1BUV T;  3H3V I;  4A3F G;  1VQH A;  5LMN Q;  3QOL A;  2NAP A;  4IFD G;  2NUC A;  3I4M H;  4A3B I;  3CD6 1;  2RBM A;  2ZM6 L;  5LMU L;  3FKI H;  1OXT A;  3CHB D;  5CV7 A;  3K7A I;  1HZA A;  3EBE A;  5C4H A;  1PFN A;  4JOI C;  2GA4 B;  4NBH A;  4ZK9 B;  4X65 L;  3NWT A;  1CFM A;  1H9M A;  2JQO A;  2MP1 A;  1R9T I;  5IYB H;  1HPC A;  1YNX A;  2M48 A;  3C1E A;  5M3F H;  2D62 A;  3T1H Q;  3SEB A;  5C44 H;  3HGB A;  5FJ8 H;  2HT1 A;  4OWW B;  3RN2 A;  3KLS A;  3TZD A;  2UUC L;  1B8A A;  4LWC A;  1JWH C;  1H9J A;  4HSP A;  4FXG C;  1TS5 A;  1D1I A;  1ZYR D;  2YAD A;  2K04 A;  2VPZ A;  1WCM G;  3OOC A;  4DAP A;  3T4A C;  4TQU S;  4BA1 I;  1VQO 1;  1KHI A;  1IXR A;  4DV2 L;  1CKO A;  1YIT A;  1XPU A;  1BVS A;  3PUZ A;  4NH1 C;  1LV9 A;  2NZ1 D;  4UHV A;  1KRL A;  4NBB A;  1NCV A;  2XSC A;  3NQT A;  5IT9 c;  1KLG D;  2M00 A;  3GTK I;  4JI1 Q;  4HGY A;  2EXD A;  3IAY A;  2G2K A;  3D31 A;  2JA5 H;  3S1M I;  3D6W A;  1PXU A;  4KTA A;  3SE0 A;  1YHQ A;  1GKH A;  1KAW A;  1VQ6 1;  3VR2 A;  5C4Z A;  1TWC H;  4BY1 I;  2I5L X;  3WWV A;  4LJZ C;  4H13 C;  1F77 A;  2OEO A;  4LFC L;  1YVC A;  4WOR A;  1YUA A;  4QMG A;  1STE A;  2E2H B;  3KIF A;  1EIF A;  1F9Q A;  2HQE A;  3TS2 A;  5G3L F;  5COY A;  3M3Y B;  4A75 A;  2BJO A;  1D1K A;  1NBW A;  3C3L A;  1SXT A;  2G9D A;  2Q8T A;  4XQJ A;  4HMI A;  3D0F A;  3NWS A;  4DK6 C;  2W04 A;  3CRK C;  3I56 1;  4GLX A;  2F0L A;  4DV4 Q;  3TP5 A;  2LXK A;  4RHR A;  2JP1 A;  1ESF A;  4A3C H;  2GN5 A;  2ICI A;  4MTK A;  1BBX C;  4NFR A;  1A2U A;  1BCP C;  2E2I I;  2H5X A;  3PGZ A;  4IFD J;  1CKM A;  1SEB D;  2RSO A;  1IBL L;  2JA6 I;  1N34 L;  5IGF A;  4GNX C;  2R7Z H;  2IPK D;  4YY3 L;  3RZO I;  3PO3 I;  3I91 A;  2JMO A;  4MNO A;  2XGT A;  4B3M L;  3TME A;  2ZM6 Q;  1M1K C;  5LMU Q;  3R3O A;  1YI2 1;  1LYL A;  4RWS C;  1B7Y B;  1QVF A;  5EKI A;  2PMZ B;  2K5D A;  1GJX A;  4X65 Q;  1Z01 A;  2F4M A;  4JI5 L;  4BXX H;  4C3I B;  4MZ9 A;  1LTT D;  4N8F A;  3I72 A;  2R6M A;  1NP6 A;  2K75 A;  3AFQ A;  4A3K B;  2M9V A;  1I6H H;  5IYD G;  2UUA L;  1Q8I A;  5FLM H;  3M4O H;  1KD1 C;  2A68 C;  2BE5 D;  4X62 L;  4XT3 B;  2OOX B;  2AWO A;  2UUC Q;  4JYA Q;  5T67 A;  1B4O A;  3CME Z;  2JS4 A;  1YNN D;  2PQA A;  1TWH B;  5C0X G;  4C3I G;  3HOV B;  3RZD B;  2UU9 L;  3CQZ H;  3F2B A;  3U4Z A;  4HAE A;  4A3K G;  2XN9 C;  4YCV A;  2E2J H;  1D6E C;  2R7F A;  4PQX A;  3CCE Z;  3L7Z C;  4J1M A;  3GTG H;  4DV2 Q;  2Q51 A;  4S3S A;  1VQ4 1;  1J6Q A;  4E2W A;  2JIR A;  1YJ9 Z;  5IT9 L;  1I5F A;  1H95 A;  2MGS A;  3V05 A;  3HOV G;  2IHF A;  2HQL A;  2K01 A;  4HCS A;  3GO5 A;  2CFM A;  1VQP 1;  1YJN Z;  2AMC B;  1SAP A;  2F3V A;  3J80 f;  1HR0 L;  4HJ9 A;  4X6A H;  2VUM I;  5A35 A;  1E2W A;  2NZO A;  1QNU A;  1TY2 A;  2RHS B;  4QF4 A;  4A3I B;  1G6P A;  1I50 H;  5I6W A;  4LUV A;  2QEX A;  4NXN Q;  5J22 A;  4S1T A;  3J81 b;  1JB3 A;  3VA5 A;  2AUJ D;  4LFC Q;  2IX1 A;  3S15 B;  2QCP X;  5IT9 E;  3OMG A;  3L9A X;  1B53 A;  2LEX A;  1DXM A;  3FPU B;  3S1Q B;  5JVH 3;  1QVG A;  3S16 B;  2E9H A;  2QF7 A;  1EU3 A;  1SNQ A;  5IGE A;  3ERO A;  4A3I G;  1FGB D;  2VB2 X;  4JVZ A;  4X3K A;  3EIV A;  3KIH A;  1B9M A;  1HTL D;  1VQM A;  2EYO A;  3ND9 A;  1QG7 A;  2HUG A;  2PQA B;  1C7Y A;  3CC4 1;  4GOP A;  2NN6 I;  1U4L A;  4IO9 A;  3QR8 A;  1KNE A;  2CWA A;  4HJA A;  1D2B A;  1KQS A;  1U4R A;  1CQV A;  1VQ8 A;  1IBL Q;  4PMW A;  1N34 Q;  4A3L G;  1C0A A;  4OGQ C;  1YNJ C;  3VYU A;  4DV5 L;  2IL8 A;  2KQ3 A;  2GTI A;  1UUP A;  4LFA L;  1ASY A;  3CCS Z;  3HG9 A;  3PO3 S;  5DAU A;  5M9O A;  1ZB9 A;  4P75 A;  3GTJ I;  3PIP 3;  1OXS C;  3MXG A;  4PV1 C;  2HIV A;  3AQQ A;  1XX8 A;  4NB3 A;  1II3 A;  1L1O A;  4Y7N I;  1TWA B;  4BA2 I;  3NBH A;  4IOC A;  2C9O A;  3JAM L;  2UUA Q;  2KHI A;  3QWU A;  4FXK C;  3TP6 A;  5IY0 A;  2B8G A;  3STB C;  5JOB A;  2K3R A;  3HOU I;  3SHL A;  3GP7 A;  1S5F D;  4DR5 L;  2KEC A;  4X62 Q;  1ML0 D;  3CCU 1;  3HS0 C;  3X3M A;  5C0X J;  4XYQ A;  4OHJ A;  3GTP H;  4HJ8 A;  2KCT A;  3CD6 A;  3GTL I;  3IKJ A;  3PF4 A;  3S14 H;  1FVI A;  4RV9 A;  3JAM i;  2JR6 A;  3I73 A;  3AYH B;  1GOZ A;  3OWF A;  1FDO A;  3NSW A;  4F88 A;  2O4H A;  2BCO A;  3D4D A;  5C4J H;  4HMJ A;  2OT2 A;  1RTN A;  2BA0 A;  4A3G H;  1ZKO A;  1JJG A;  3VMG A;  1Y1W B;  3VA7 A;  1T5E A;  1S72 1;  1Y8C A;  4C3H B;  4PMC A;  4IUP A;  1Q82 C;  2F03 A;  3BYT B;  1K73 1;  5IP7 I;  2H1E A;  4A3J I;  5BN3 A;  1K83 I;  2G9H D;  4P74 A;  1VQJ A;  1NR4 A;  3CC2 Z;  2KUM A;  1KC8 C;  2B2V A;  3ER0 A;  3FVQ A;  3GTO H;  2WAC A;  1GHK A;  1CHP D;  5ELB A;  1Q46 A;  1Y1W G;  3HOZ G;  2QRD B;  1J9O A;  2EOT A;  1NUI A;  3KF8 A;  4C3H G;  3ULP A;  2Q4Z A;  1T5X D;  3FQM A;  3NBH B;  4H44 C;  4A3B H;  2B2U C;  4C1N K;  3H0G B;  1E2V A;  1HCZ A;  4DA2 A;  1EWH A;  1X55 A;  3DM3 A;  1LT6 D;  4IFD I;  2ALY B;  2N88 A;  4YWL A;  1SFO I;  5HUR A;  3K7A H;  3Q23 A;  3A0J A;  1XYI A;  2R92 B;  5J1Z A;  1VQ7 Z;  2RKS A;  2EJG C;  3MEF A;  2IV2 X;  2PI2 E;  2F3I A;  4KK7 A;  1R9T H;  3H0G G;  2NVY I;  2JIO A;  2EYJ A;  4DXG A;  1VQ6 A;  4JI3 Q;  3QB3 A;  1TFI A;  1Z6H A;  4OO1 H;  2TSS A;  2RBL A;  2QR1 B;  4DV5 Q;  2R92 G;  1N8R 2;  5A2Q L;  3GTQ H;  1XPR A;  2E2D C;  5E1F A;  4TRD A;  5M5W H;  2OQK A;  5JEA H;  2MHV A;  1Q90 A;  1MBY A;  1UE5 A;  1RO4 A;  4A3M H;  3CC7 1;  5BR8 L;  4FF4 A;  3K5O A;  3V2T A;  2JN4 A;  1VQ9 1;  1PZJ D;  3PCO B;  1SMY C;  4QUC A;  4HTH A;  4DK0 A;  4DR5 Q;  4RGT A;  3GTK H;  3NTK A;  3ICE A;  5A2Q E;  2B2T C;  3BG0 B;  2K28 A;  3S1M H;  1ICF B;  5KEE A;  4XXE A;  3AFP A;  3U9O A;  2F0S A;  2PYK A;  2B8F A;  3CPW Y;  1PTO F;  1TXY A;  3T1Y Q;  1IYU A;  4FYD A;  5EPL A;  2EYP A;  3VMH A;  5C4X H;  4BY1 H;  2OCE A;  3D6C A;  3J7A F;  4RH6 A;  4CDD C;  2YU9 H;  5FLX f;  2OTJ 1;  4PNY A;  1RKN A;  1TR5 A;  1C4Q A;  4RCO A;  2EJF C;  2K5N A;  4CBV A;  1IYV A;  4A3E H;  4JPB W;  1QUQ A;  1LTG D;  3CCM A;  3SK6 A;  4KY6 A;  2EY6 A;  2F0F A;  3IX0 A;  4IUQ A;  2HDL A;  3CCR A;  4HJ5 A;  2WB1 A;  2EGT A;  1EY6 A;  4TSS A;  3S17 H;  5LL6 f;  1HXY D;  2E2I H;  1WTW A;  4LF5 L;  1F9R A;  1STN A;  3CF5 A;  3RZO H;  2VPW A;  3PO3 H;  3A5Z B;  3M3Y I;  4JI2 L;  2E76 C;  3CPW Z;  2ZTC A;  1A62 A;  1PHJ A;  4KY7 A;  1DOK A;  2HF1 A;  2F0G A;  2DY7 A;  1JT8 A;  3G6J B;  4ZKB B;  3EQL C;  3CAM A;  3J7A 4;  4XQQ A;  2L4N A;  4N9T A;  5K36 G;  2BDO A;  1AW7 A;  2EQS A;  1DJR D;  1KLU D;  4BBS H;  3QO2 A;  1RIP A;  1SYF A;  4CKE A;  2NVQ B;  2R93 H;  1WD0 A;  2FFK B;  1N8R 1;  1WJ2 A;  4TNU A;  2NVX H;  1WW9 A;  4CDC C;  2L55 A;  5D3D A;  4DKA C;  2B2W A;  4HN7 A;  1Y1V B;  1QUQ B;  5C0X I;  1V1P A;  3FQQ A;  1VQF A;  1FL0 A;  1KAB A;  3R8B A;  5GQO A;  4R4T A;  4OON A;  3N52 A;  5BR8 Q;  1CM9 A;  2DGY A;  1DOL A;  1WTO A;  3Q0A A;  1QOH A;  3RMH A;  2WB1 B;  2PI2 A;  5JAV A;  3CC4 A;  2I07 B;  4G7H C;  4LF8 Q;  1LTA D;  1E2Z A;  3TRZ A;  1SNP A;  1Y1V G;  3EVQ A;  3HOV I;  3RZD I;  4YWK A;  1K3R A;  2JXM B;  1EWC A;  2E5L L;  1H9K A;  1Q7Y 1;  3CU7 A;  1JE5 A;  3NH8 A;  3RUZ A;  4KMU C;  2K03 A;  1VQK Z;  2VUM H;  2B2Y C;  2IZ3 A;  1Q82 2;  2HU9 A;  4OEL B;  2DE6 A;  5F2D A;  1NR2 A;  5D3I B;  4IPG A;  2VB3 X;  5KNC A;  1SYD A;  1H9R A;  2LXJ A;  1BNZ A;  1A8V A;  1EY8 A;  4HR7 B;  1PH3 A;  4DAV A;  2A73 B;  2SEB D;  2VZA A;  5GAE C;  5COR A;  2B63 B;  1OXX K;  1NE3 A;  1IW7 D;  2M6N A;  1M8A A;  4ALP A;  1Q3L A;  4DR6 L;  3LWE A;  4GKK L;  3CCU A;  5HGQ A;  1YHB A;  5JJL A;  4A3I I;  1I94 L;  1YBY A;  2NN6 H;  2DJG C;  1BOS A;  2VPY A;  4R4I A;  3SDZ A;  3TEH B;  3TBI B;  2B63 G;  1TWF B;  3ERQ A;  1UNS A;  3S1Q I;  2V8I A;  3I55 Z;  5ELC A;  2O5J C;  4JI2 Q;  5LMN L;  1BBW A;  2NVT I;  4A3L I;  5HY6 A;  3HOY B;  2JA8 I;  1UE1 A;  3H94 A;  4P2C B;  4JBM A;  3D8G A;  1TWG B;  2EIF A;  4A3D B;  4QTU A;  1PH8 A;  5K5P A;  3L0O A;  1S5E D;  4X3U A;  2YYZ A;  4Y7N H;  1Q1E A;  4MIU A;  2WP8 J;  3NQI A;  4LUO A;  3DEP A;  1M90 C;  5FK9 C;  3MA2 B;  3G71 Z;  1SMX A;  3HOU H;  1LAC A;  2PMZ E;  1CKN B;  4KD4 A;  1VQG A;  3A56 A;  4A3D G;  4JV5 L;  1F2Z A;  1S3O A;  2GU2 A;  3KDF A;  2OOY B;  3BZD B;  3HEJ A;  3G4S 1;  3GTL H;  3GDE A;  3ESW A;  3EA6 A;  1A0I A;  4K5W A;  4B9W A;  1TWA I;  3DWP A;  4L8J A;  1V9P A;  2JA7 B;  1MD2 D;  3OSO A;  2NYZ D;  5IWA Q;  4NBA A;  4MHE A;  2QRC B;  3URY A;  1N32 L;  1YHA A;  3LNN A;  5C3E B;  3RNU A;  4KLK A;  2IWH A;  1QIL A;  1PTO B;  3VYS A;  2KBN A;  5NUC A;  5I4D A;  4DPG A;  2E5L Q;  4JOI A;  2JA7 G;  4CJ0 B;  5IP7 H;  4A3J H;  2Q2U A;  1CK1 A;  4POG A;  4G57 A;  1DZ1 A;  1K83 H;  2JEB I;  2VPX A;  2CW0 C;  1XNR L;  1R4P B;  4KHP L;  1FNW A;  1JE4 A;  1NJI 2;  1G6Z A;  5C3E G;  5I2X A;  2F1M A;  3CMA Z;  2LS0 1;  3K80 C;  4RA8 A;  1VQ8 1;  3PO2 B;  2RHQ B;  1V43 A;  1Q81 C;  1SLJ A;  1DD2 A;  3K81 C;  3K8A A;  4H0L C;  1SIW A;  3J7Y W;  2RCF A;  5EQ0 A;  1WZN A;  4ZUI A;  3CC7 A;  3OW2 A;  1SFO H;  3UDF A;  2RDH A;  1VQ9 A;  2DNC A;  2F0N A;  4DR6 Q;  1STG A;  1F2M A;  2FMC A;  3OMC A;  4A3F B;  4GKK Q;  3MWY W;  2YTY A;  4LNQ A;  2QRE B;  4PZ6 A;  4ME5 A;  1EEI D;  3PF5 A;  1EY7 A;  3CCQ 1;  2NVY H;  4IUV A;  4HID A;  3BJU A;  4QTT A;  1WD1 A;  4QL5 A;  3PSI A;  2FIN B;  2FMM A;  1PFS A;  3H0G I;  2ZJQ A;  1EYC A;  1RLY A;  5BN5 A;  3M85 A;  5IGG A;  1QF8 A;  2DUD A;  1EY5 A;  1QE6 A;  1VMP A;  4HCE A;  4HED A;  5HGT A;  2X69 A;  3TE5 B;  2R92 I;  3D4W A;  2OTJ A;  2N78 A;  3J81 L;  1Y8N B;  3T51 B;  3HRZ C;  1YJW 1;  4NMZ A;  5E7N A;  2I5H A;  2MFI A;  4NDX A;  4LW1 A;  1RO0 A;  4XT1 B;  4NW2 A;  4QCL A;  4DR1 L;  2VS1 A;  5FLX b;  3HOX H;  3J81 i;  1WCM B;  5IOC A;  1O7Z A;  3FDT A;  1DGS A;  4JV5 Q;  4R1J A;  3CRL C;  4RGM A;  4K5V A;  5ELN A;  4JYA L;  3TP7 A;  2XVS A;  1UWV A;  2RA4 A;  4OWX B;  1XJV A;  1TS4 A;  1VQO Z;  2J6A A;  4O2D A;  2OTL A;  3FKI B;  3H09 A;  3UI2 A;  3WDN A;  1I4G A;  2EYF A;  4BS9 A;  1N32 Q;  2EY1 A;  2SOB A;  1X3G A;  1VQL Z;  2A6E D;  3K5N A;  2CVR A;  1J5E L;  3ERS X;  2UXD L;  4RAU C;  1LTL A;  1HUN A;  2I3C A;  4FF2 A;  4B9X A;  2IZ4 A;  5KND A;  1HUM A;  1RDP D;  3G6E Z;  1A2T A;  3F2C A;  5M3F B;  3E9H A;  2PMZ A;  1SNC A;  3FKI G;  1KRT A;  2Z1C A;  3EED A;  3GTM I;  2O53 A;  5C44 B;  1XNR Q;  4ODG A;  2Z6K A;  3RLF A;  4KHP Q;  2JA9 A;  4CL1 A;  3FHW A;  1XNQ Q;  4PZ7 A;  4DAM A;  1NJI 1;  1IBK Q;  4OEM B;  5IYB G;  3MVV A;  3VB9 A;  1KL9 A;  4ZLT F;  1FNU A;  5M3F G;  3S2D H;  3SK5 A;  3I4O A;  3W5O A;  3BU2 A;  3SGI A;  4NXN L;  2QIL A;  3DLL A;  4KN4 C;  1K9M 1;  1LT5 D;  2KCC A;  5CYU A;  5IP9 H;  5C44 G;  5FJ8 G;  2W03 A;  3NDI A;  3IR7 A;  2MJ8 A;  2N49 A;  5C5M A;  1ICW A;  4CDF C;  3U50 C;  3E0J A;  1SE4 A;  3DWQ A;  2IHE A;  4R4O A;  1MKH A;  3K0Y A;  3NTH A;  3I56 Z;  1YEZ A;  1AA6 A;  4JG2 A;  4C3J H;  3KBG A;  2YTX A;  5IE8 A;  5IT9 f;  1NMF A;  5LHY 1;  2V8J A;  3PIO 3;  4XYO A;  5EGT A;  1SSO A;  1TS2 A;  3WOE A;  2I0Q A;  2JSO A;  4NB9 A;  4FF1 A;  4FF3 A;  1IL2 A;  4E2Z A;  1BCP B;  3CW2 C;  3BVM A;  4RVH A;  1VQ5 Z;  1TWC B;  2B39 A;  5IYD H;  4GNX B;  3M4Q A;  1YI2 Z;  1EYD A;  1EIG A;  1M90 2;  4UY8 C;  1SYB A;  4EVO A;  1AE3 A;  2RSN A;  1WJJ A;  4GLV B;  4DAY B;  4NKL A;  3VR3 A;  5C0X H;  1WTQ A;  2Q8I B;  5CC4 A;  3S1N B;  3A8K E;  4JBJ A;  4DN4 M;  2UXB L;  4AYB B;  2CQO A;  5CGK A;  3NTI A;  3MFG A;  2PO4 A;  4BBR H;  2P28 A;  4DR1 Q;  2WKC A;  1STA A;  4DK3 C;  5C6A A;  2NVQ I;  2KCN A;  4E31 A;  2LY7 A;  4GZY C;  2PK7 A;  2EE1 A;  2VY3 A;  1U4M A;  3CCM 1;  2NWG A;  4RGO S;  3R93 A;  3RZD H;  3JAM c;  3IFT A;  1VF5 C;  2L0C A;  4HJ7 A;  2F0O A;  1I4Q A;  4AYB G;  3F3F C;  3T13 A;  1Z02 A;  1XTC D;  3CCR 1;  4V19 0;  5I9P A;  4OIK A;  4PMB A;  1WII A;  5KGU A;  1CHQ D;  3A55 A;  5T6B A;  1E24 A;  1VQ4 Z;  4A3C G;  2PM9 A;  1JOK A;  4BY7 H;  3CCJ Z;  2J4X A;  3S1R I;  3HOW H;  1J5E Q;  2UXD Q;  1SNO A;  2QA4 Z;  1JCK B;  1PRT C;  5AFW A;  3FPP A;  3TZU A;  1VQP Z;  1Q81 2;  4K6L A;  2A69 C;  1S5C D;  4LF6 Q;  3A8J E;  4JBK A;  1W2B Y;  3M4O B;  4OL7 A;  5DEH A;  1CSQ A;  3S24 A;  3CME 1;  5GAG C;  1PTO D;  4WRD A;  4BXX G;  3GTM S;  3G4S A;  1SJE D;  1TT2 A;  2JIM A;  1OTC A;  3CQZ B;  3FP9 A;  1JJ2 Y;  1Y14 B;  3CCE 1;  2B63 I;  5JJK A;  3BDL A;  2E2J B;  5EJW A;  1RF2 D;  5FLM G;  2R7D A;  2JK8 A;  3K5L A;  4C2M H;  4JK1 C;  4EGV A;  4FO2 A;  2NVT H;  1JIC A;  1YJ9 1;  3DWA A;  5M5Y H;  2JA8 H;  3M7G A;  2JE6 I;  4DV0 L;  1Q86 C;  1PFT A;  4AH6 A;  3CCL Z;  3ZJY C;  2DN8 A;  3CCV Z;  2NZH A;  1F2L A;  2LSS A;  4J15 A;  1LO5 D;  1YJN 1;  1TWF I;  2DNE A;  5D1O B;  2OXP A;  5M3M H;  2DE7 A;  3J7A V;  1B44 D;  2EYM A;  1CQF A;  2ZJP A;  2PQE A;  3U58 A;  1BDO A;  4K0K Q;  1IKL A;  5ELD A;  2GVB A;  2OWO A;  3HOY I;  2XRQ D;  1CZG A;  4JI3 L;  5DLQ E;  2L15 A;  1W2B Z;  1AN8 A;  4U67 3;  1PYW D;  3NPP A;  2F4V L;  4A3D I;  3J7A 5;  3FRP B;  1JJ2 Z;  1PH1 A;  2AQ2 B;  2HCI A;  2UXB Q;  4GN5 A;  1GUT A;  1EOV A;  1WTR A;  3NH4 A;  3CCQ A;  4CKC A;  4KKT A;  4L5R C;  1S5B D;  2H4O A;  3D9X A;  2WKD A;  5CBE E;  4LF4 L;  2Z8L A;  4J8Q A;  2JA7 I;  3I90 A;  1MGS A;  1PFM A;  5E4X A;  2WB1 E;  4A93 H;  3L3O C;  1QYP A;  3T1Y L;  1Y1V S;  5C3E I;  4LK1 C;  4UP8 A;  2F0V A;  1YJW A;  3J80 L;  5ELE A;  1U9R A;  2UXC L;  1S72 Z;  1S40 A;  4NBE A;  2WV6 D;  3JAM E;  2Z4I A;  1ASZ A;  1KTK A;  3HOZ B;  1HFN A;  2F52 A;  1E7Z A;  2ZXP A;  3CXC Y;  3HZX A;  3GV3 A;  4L6T B;  4QQB X;  5EPK A;  3J80 i;  2MNA A;  3FEW X;  3PO2 I;  4DV7 L;  4ZRZ A;  2Q2H A;  3F2D A;  3T56 B;  3IL8 A;  1Y69 U;  3SXH A;  3OTO L;  5CMD A;  3S14 B;  4GKJ L;  1SBB B;  3H3V H;  4GOP C;  2IY5 B;  4EX5 A;  2JJQ A;  2LIY A;  1STB A;  4UP7 A;  1WTV A;  3PV0 A;  2B2T A;  2BH8 A;  4RG1 A;  1VQN Z;  1P9N A;  5C4J B;  4DV0 Q;  4A3F I;  2Y0S B;  1W6K A;  3VYR A;  5C3W A;  4DF7 A;  4XQN A;  5FO8 B;  1FR3 A;  5CR3 A;  4B3R Q;  4JI7 Q;  2IJ0 A;  3QJY A;  4OIJ A;  4ZAI A;  2CH4 A;  2F0K A;  4FDB A;  1M1K 2;  3PMF A;  4H7B A;  1KIX A;  1X9N A;  2E74 C;  2EYH A;  4GLA C;  3CC2 1;  1K8A C;  4CJ1 B;  2Y0S G;  4RMF A;  1PVO A;  1MSG A;  3GTO B;  1L1O C;  1EZ6 A;  3CXC Z;  4E30 A;  4AIM A;  3H3V C;  2WIN B;  2E8G A;  2L11 A;  2F4V Q;  3I7F A;  4HIK A;  2LFU A;  1BCP D;  1LTI D;  2HIX A;  2MO0 A;  4QB4 A;  5CM2 M;  5JPN C;  1KD1 2;  1EOT A;  1JOR A;  3K7A B;  4KKU A;  4FNF A;  4IOA A;  2LFN A;  1CUK A;  1EEF D;  1QB5 D;  4XX2 A;  1VQ7 1;  1WCM I;  1QJO A;  2X6G A;  3MXN A;  2CQA A;  1ENA A;  5IGD A;  1R9T B;  4E6I A;  4A3B G;  4EWC A;  4ABN A;  1YUK A;  4LF8 L;  2GTH A;  4ZQ3 A;  4RKL A;  3D3R A;  4LF4 Q;  2QDB A;  1GO3 E;  1PYS B;  1YIJ Z;  3GTM H;  1HNW L;  5IIF A;  5EAY A;  1WOC A;  1I3Q B;  3FKI I;  3GTQ B;  1NUC A;  1PH6 A;  5IT9 b;  1X3W A;  5M5W B;  5KNB A;  2Q8R E;  4OWT B;  3P75 A;  2F0P A;  2A68 D;  3PUX A;  1RD9 D;  4MD8 A;  2B2V C;  3NBI A;  2UXC Q;  3SR1 A;  1O7Y A;  4OO1 G;  4DGZ A;  1SR3 A;  3NUC A;  3H15 A;  3W3A A;  1DON A;  2B3G A;  4A3M B;  1HNZ L;  4JC0 A;  2A6H C;  1KDB A;  5JEA G;  1JMC A;  2MQH A;  3QOJ A;  3ZYY X;  5ISR A;  4HH4 A;  4POF A;  1EQT A;  3GTK B;  4DV7 Q;  1USP B;  1Q86 2;  1EU4 A;  4P73 A;  2RHB A;  4A3M G;  3OTO Q;  1HR0 W;  4IPD A;  4GKJ Q;  3MZL B;  4NXM Q;  3E6Z X;  3NFZ A;  4NBD A;  2E2H I;  4DV6 Q;  2JA6 H;  5C4X B;  2FJ2 A;  1Z9F A;  1V1O A;  4NP5 A;  3MXN B;  4IN3 A;  3NK9 A;  4GN3 B;  2IX0 A;  2YU9 B;  3S9W A;  2OTL 1;  3M7N A;  1YIT Z;  5EKL A;  3C2P A;  3I4N B;  4A3E B;  5C4X G;  1X3E A;  2CWP A;  3CME A;  1TWC I;  2I5M X;  4QUF A;  4YWM A;  1QNK A;  2LMC B;  2HCC A;  4O0A A;  4YHH Q;  3T16 A;  4KY5 A;  2IW3 A;  3J81 j;  3S17 B;  2QEJ C;  1YHQ Z;  3I4N G;  3CCE A;  4A3E G;  1EY4 A;  4DV1 Q;  3S1N I;  4DXF A;  1QVF Y;  1LUZ A;  1YJ9 A;  1WTX A;  1I4H A;  1ZEQ X;  3KLR A;  2SNM A;  1K28 A;  3JAM b;  3P1H A;  4RVD A;  3T4N B;  1L2F A;  1YNJ D;  4J6H A;  4MXU A;  3LGJ A;  3S1R H;  4A3K I;  3KYH C;  4A76 A;  1YJN A;  1KDA A;  3RN5 A;  5IWA L;  2V3V A;  1ZYR C;  1EYG A;  3T53 B;  2EY2 A;  3R2I A;  4TVA B;  4WJ3 M;  3MZK B;  1TWH I;  2VUG A;  1HNW Q;  1EQV A;  3DHQ A;  4BBS B;  1ILP A;  5CV5 A;  2L1B A;  1WI5 A;  4EQN A;  2R93 B;  4FP5 D;  3PUW A;  3STB D;  3KUP A;  2XTI A;  3M9B A;  1WTP A;  1ENF A;  1R4Q B;  5AN9 F;  5EBC A;  4LF7 L;  2NVX B;  5AJ3 Q;  2PNR C;  1FD7 D;  3TP8 A;  3U4V A;  4BXX I;  4EQP A;  1CKN A;  1VMC A;  2KCM A;  4BBS G;  1JWM D;  1KC8 2;  1I6V C;  1L0Y B;  3I2Z A;  1QVF Z;  1HNZ Q;  1RJT A;  5JEA J;  2V4D A;  2JIQ A;  1LLR D;  3NEM A;  2R93 G;  3M4O I;  3W2D A;  1Q12 A;  4R8N A;  1QVC A;  2Z4H A;  4DR3 L;  1S7M A;  1ZB8 A;  3I8Z A;  1LTS D;  1TKW B;  1TWF H;  4P71 A;  2H85 A;  3HKS A;  3DEO A;  1B70 B;  3V96 A;  4KV6 A;  2VQF L;  4XIG S;  1VQK 1;  4APV A;  2E2J I;  1A6X A;  1RNI A;  1G8Z D;  3S15 I;  1N36 Q;  4EQO A;  3CCS A;  2KA7 A;  3HOY H;  2P3Y A;  4AQY L;  3S16 I;  5M5X B;  2Z9H A;  2K33 A;  3H6M A;  5I9O A;  4B08 A;  2ES2 A;  3K58 A;  1K8A 2;  5KIX A;  4E33 A;  2FXQ A;  4A3D H;  1S4Z A;  1EIH A;  5G3L D;  4KJN A;  2F0U A;  2VUM G;  1G91 A;  4IPC A;  5DM7 3;  3GTJ H;  2XNA C;  1G2T A;  3TDQ A;  3J81 c;  1ROD A;  2GVA A;  3VR6 A;  4X6A I;  2B2W C;  5A2Q b;  3HKZ B;  1KQS Y;  2RDF A;  5LL6 S;  1RQF A;  4DR4 L;  4R8I A;  1GUN A;  1XMQ L;  1IKM A;  2A74 C;  3C1F A;  2F0W A;  2RVL A;  4QIW B;  4UP9 A;  1JQY D;  2WAQ B;  4AYB E;  2YTV A;  3X3N A;  2JA7 H;  4I7A A;  1W6J A;  3HKZ G;  3I4L A;  2QEX Z;  1UEB A;  1SYG A;  4LF9 L;  2NN6 G;  2AHO B;  3KFU A;  2AQ1 B;  2F0T A;  3OWE B;  1SE3 A;  2K5R A;  2BE5 C;  1QVG Z;  1RTO A;  2WAQ G;  1YNN C;  2KED A;  1V1Q A;  3H91 A;  1H9S B;  3KK7 A;  1J8I A;  1O78 A;  4JI8 L;  3CC2 A;  2C35 B;  5C5L A;  1VQM Z;  1CSP A;  1QWY A;  3Q24 A;  2K4K A;  3KJP A;  2BA1 A;  5CV8 A;  3PIP A;  3HOU B;  2HD3 A;  4JI0 Q;  3R2T A;  4R4Q A;  3BVG A;  2QKI C;  1KQS Z;  1PRT F;  3PO2 H;  1VLA A;  2RT9 A;  1VQ8 Z;  1SMY D;  3UE1 A;  3GV6 A;  4UAI A;  4LF7 Q;  1XNQ L;  4CDE C;  1IBK L;  4JI4 L;  3UDG A;  1Q82 1;  1Y1W I;  1PFB A;  3HOU G;  2QLV B;  1VQC A;  1I4X A;  1QZG A;  1K8O A;  3HOZ I;  5IYC H;  1VQ7 A;  4IPH A;  4RCN A;  2WII B;  3UE0 A;  4F8M A;  2PCF B;  4A3F H;  3S2H B;  1LQL A;  1KC8 1;  1EYA A;  4IFD H;  4ILW A;  1E0B A;  4CHT B;  2NB0 A;  5GAD C;  4DR3 Q;  1BR9 A;  1A15 A;  5CV4 A;  4XTC S;  3CP0 A;  2ID0 A;  1N33 L;  3S14 I;  1X3F A;  2VQF Q;  2RIQ A;  1K83 B;  1DL6 A;  3QWN A;  1Q1B A;  3CMA 1;  1K73 C;  2EDG A;  2PZT A;  3QG1 A;  4AQY Q;  1Z03 A;  3B6Y A;  3CD6 Z;  1A3V A;  3K7U C;  1VQE A;  5IP7 G;  3AU7 A;  4A3J G;  4IZ8 A;  4GN4 B;  1X0T A;  1O80 A;  3A74 A;  4DR7 L;  4ZYS A;  1PLF A;  1WCM H;  1MHW C;  2AWN A;  1EZ8 A;  2RF4 A;  1HNX L;  4DR4 Q;  1XMQ Q;  3VR4 A;  1D5M C;  4OX9 L;  1VQA A;  3NE5 B;  1SRU A;  4V0B A;  2NVY B;  4K8I A;  1TQO A;  1HJP A;  3OW7 A;  4KI0 A;  1GM5 A;  1OO9 B;  3VDY A;  2BDN A;  1EIY B;  3J81 E;  4LF9 Q;  3I4M B;  2HDM A;  1SRO A;  3Q22 A;  1O7L A;  3TN2 A;  2EJM A;  3M4P A;  2KEN A;  4RVF A;  5L37 A;  2K1B A;  4GNX A;  2DJF C;  3F1Z A;  4L5T A;  3KF6 B;  4WJW A;  4JI8 Q;  5J39 A;  5JJZ A;  1SJH D;  4OO1 I;  1Z47 A;  3BDO A;  3I3C A;  3I4M G;  1I3Q I;  4DAY A;  3HOX B;  3GTQ I;  1L0X B;  4MN3 A;  3IRB A;  2EZV A;  1RL2 A;  4LF6 L;  4AYB A;  4DNT B;  1VQ6 Z;  1E22 A;  5JPM C;  4LUZ A;  3LX0 A;  3CPW A;  1TU2 B;  4JI4 Q;  4A3M I;  5DM6 3;  3HOX G;  3OIQ A;  4RGN A;  2VXW A;  2E2H H;  1B2T A;  1ESR A;  3BZK A;  2F0J A;  3HP3 A;  3M3Y H;  1VQL 1;  3VMI A;  1Z7T A;  4QJF A;  1X6O A;  2K5H A;  1PH2 A;  3O13 A;  4R9W A;  1DCZ A;  3TQY A;  4YCU A;  4X66 Q;  4G7O C;  4KJO A;  4HSV A;  3G6E 1;  1STY A;  3BYY B;  1N33 Q;  4X3S A;  4IJH A;  1A3U A;  4F7X A;  2VL6 A;  1PV4 A;  5C4X I;  1N9W A;  2KVM A;  2Y0S E;  2L9H A;  5D65 A;  2JA5 B;  1KRS A;  3BDC A;  1CA5 A;  4WJ4 A;  1HQR D;  2VF1 A;  1JWU D;  2ICE C;  1K8M A;  1GXD C;  4K0K L;  2KJX A;  4MON A;  2YU9 I;  4DR2 L;  2EVB A;  3F2U A;  1L0W A;  2HHH Q;  3UDI A;  3S2D B;  4Q5V A;  3S1N H;  3I4N I;  5LMN W;  2V8K A;  4A3E I;  1Y8O B;  2ZXO A;  1BO0 A;  2JA5 G;  4C3I H;  4DR7 Q;  2VQE Q;  3F3P C;  1BKB A;  1OXU A;  1XWE A;  1NAP A;  4A3K H;  2F4I A;  3RLN A;  1HNX Q;  4C3J B;  5C3X A;  1WTH A;  2TMP A;  2A8V A;  3S17 I;  4OX9 Q;  3CCM Z;  2AYD A;  1VQK A;  5IP9 G;  2B29 A;  4F87 A;  1TVX A;  1TWH H;  1T9H A;  1VQ5 1;  3HOV H;  3CCR Z;  4JI6 L;  1AP0 A;  3VTN A;  1Y1V I;  5D1O A;  1GUS A;  1SDF A;  4C3J G;  2R7Z B;  1JWS D;  1NSN S;  2K52 A;  4PZ8 A;  3MTS A;  5T1G A;  2KOL A;  4DUZ L;  1EY0 A;  5FKA C;  1Q16 A;  3EN2 A;  5J3B A;  2Z6K C;  4ID6 A;  1SE8 A;  1U5K A;  4NPS A;  1X65 A;  1N8R C;  1U0L A;  3N6R A;  2M2L A;  3A5U A;  3AEV A;  5IOD A;  2R7Z G;  1PRT B;  1SNM A;  4QGU A;  3J80 c;  3K5M A;  4BBS I;  4BBR B;  1PYB A;  3ND8 A;  3F8T A;  1XMO L;  2R93 I;  1B3Q A;  1I6H B;  2EYL A;  3FMC A;  3I55 A;  2NVX I;  1VF7 A;  2WFW A;  4A3I H;  1VS0 A;  1VQI A;  4JW0 A;  2UUB L;  2XWJ B;  3LUS A;  3JAM f;  2L5T A;  1HHV A;  3MC0 B;  2JUB A;  3S15 H;  4BBR G;  1D7Q A;  4N9P A;  2K32 A;  2EPB A;  1Y8P B;  1Q7Y C;  1MI2 A;  3S1Q H;  3S16 H;  1AH9 A;  3CCJ 1;  2CW0 D;  2K7V A;  4BY7 B;  3GTG B;  4RVG A;  2QA4 1;  1UEA B;  1ZXT A;  1PZI D;  2F0H A;  3SK4 A;  3HOW B;  4A3L H;  1K73 2;  2OF1 A;  4CGY B;  3QIA A;  4N8X 1;  3MEH A;  2IX3 A;  2MO1 A;  5BN4 A;  3EJI A;  2X6L A;  3G71 A;  1JOO A;  4B3R L;  3CC4 Z;  4JI7 L;  3IFU A;  3TDH B;  1D5Z C;  3NP8 A;  4BY7 G;  2F0I A;  3HOW G;  5TSS A;  4EQ5 A;  4BWG B;  1JJC B;  1HZC A;  2ZT9 C;  1M4V A;  1EL0 A;  1VCI A;  4MH4 A;  2XRS D;  1C8C A;  4E2X A;  4DR2 Q;  1HZB A;  4IJL A;  3UDX A;  2ZTE A;  1I50 B;  1SYE A;  2Q2T A;  4WFN 3;  1ET6 A;  3RR5 A;  2R6G A;  1TWG I;  1CI3 M;  4C2M B;  1P16 A;  2NVT B;  3PUV A;  4TKO B;  1M90 1;  1B3A A;  1ET9 A;  2PW5 A;  2SDF A;  5M5Y B;  2N8N A;  2JA8 B;  3CCL 1;  1TWA H;  1HQM C;  3CCV 1;  3D2L A;  2MUY A;  4UDU C;  3PUY A;  3KJO A;  2EXZ A;  1QXF A;  3GQB A;  2G5D A;  5M3M B;  2B2U A;  4JBW A;  2Y0S A;  4LAA A;  4YY3 Q;  3CMA A;  3CCU Z;  1EFI D;  2K50 A;  4X3T A;  5FOB B;  1CTM A;  2JA8 G;  1CZW A;  4B3M Q;  4JI6 Q;  1N2F A;  1AE2 A;  3ULL A;  3NEL A;  2OQ0 A;  1HH2 P;  1XPO A;  1DYQ A;  4K8J A;  4X64 L;  3MZ5 A;  2F0Q A;  4DUZ Q;  1B50 A;  5M3M G;  4KHV A;  4DFA A;  2F3W A;  4Q0F A;  3LWU A;  4ME3 A;  2NTT A;  3CCS 1;  4JI5 Q;  3BVZ A;  2QGQ A;  1IZ6 A;  1Y1W H;  4DU9 A;  5T64 A;  5A2Q f;  4K2L A;  3HOZ H;  2R3Z A;  1C9O A;  4C3H H;  2AKW B;  4L5S A;  1AFP A;  4B3S L;  2F4O A;  1VDZ A;  1XMO Q;  2VNU D;  3DM1 A;  3PQI A;  5EKK A;  1W3S A;  3G7L A;  2EY5 A;  1Q81 1;  3MXU A;  1QCB D;  2CKZ B;  2UU9 Q;  2P5Z X;  3KLW A;  1BF4 A;  2UUB Q;  4Y52 I;  3HFZ B;  3J7Z C;  4DQY B;  3A8I E;  1IW7 C;  3GTP B;  3AB9 A;  1PH7 A;  4A93 B;  3IFD A;  4K14 A;  3H0G H;  3S2H I;  3U9S A;  4CJ2 C;  4NXM L;  1IBM L;  4GOP B;  3J80 E;  5H1S E;  1CA6 A;  1B1Z A;  4IQZ A;  1WVL A;  4Z9C B;  2KHS A;  4DV6 L;  2PZW A;  2BH2 A;  3OW2 Y;  2C5C A;  2ZTD A;  3RD4 A;  2SNS A;  2R92 H;  4DGL A;  3CKI B;  1NY4 A;  4A3G B;  4ULL A;  3Q6S A;  4DUY L;  4A93 G;  1HR0 Q;  4KKS A;  2O2L D;  1SND A;  2MPM A;  1C48 A;  1EWI A;  2D0O A;  1ENC A;  2JEA I;  3P5J B;  2PNH A;  2D9U A;  2RPR A;  1V8Q A;  4YHH L;  4A3G G;  2RQX A;  1VQO A;  1L1O B;  3BS1 A;  2XWB B;  3BZC A;  3WOF A;  1JOQ A;  3KBX A;  1VQN 1;  3HKZ E;  1AEX A;  1VQL A;  1USP A;  5IGB A;  4DV1 L;  2QW7 A;  1VQD A;  1ZH1 A;  1K0R A;  3MHB A;  4A3B B;  3IF8 A;  3MXP A;  1D5X C;  3P7J A;  2IT1 A;  2OZK A;  2J7Z A;  1NTG A;  1RHP A;  3CC7 Z;  1X56 A;  2K14 A;  4QIW E;  3G6E A;  2WAQ E;  4H02 A;  3OW2 Z;  4GS3 A;  1HFG A;  1VQ9 Z;  1GVP A;  1EUJ A;  1LTB D;  2JIP A;  4NOZ A;  1HA5 A;  1I3Q H;  1DM0 B;  4OXP A;  3GKQ A;  3MON A;  1F2Y A;  1X3Q A;  4LFA Q;  2PZU A;  1G2S A;  3I4M I;  3BG3 A;  1O7I A;  2RDG A;  5T1I A;  1JR0 D;  2CH4 W;  2AUK A;  4X64 Q;  3W1B A;  1SYC A;  1HRJ A;  4HGZ A;  5FLX c;  1F9S A;  2D5D A;  1F9P A;  1FGU A;  5AJ3 L;  2OTJ Z;  2NTS A;  3ULJ A;  5GAH C;  3I56 A;  2KHJ A;  3E0E A;  2FHT A;  3M4Y A;  1EQR A;  3HOX I;  1PH5 A;  4M1U B;  1FJG L;  2PW7 A;  4B3S Q;  1KDC A;  3KF8 B;  3EER A;  1AZQ A;  1Q7Y 2;  5C44 I;  3VR5 A;  3L2P A;  4PG3 A;  4IUN A;  2ZJR A;  4FVM A;  1ML8 A;  4ZKC B;  1MIU A;  1NNX A;  1PH9 A;  1YIJ 1;  1CT1 D;  1VQ5 A;  5D14 A;  2F0M A;  5E4W C;  5KRU A;  1PRT D;  3GTM B;  2A19 A;  1AZP A;  4LFB L;  1YI2 A;  4O42 A;  1GUG A;  3S1M B;  1X54 A;  2A69 D;  1A3T A;  3TSS A;  1K0S A;  5IGC A;  2DE5 A;  1IBM Q;  1BXT A;  1N36 L;  2XIW A;  5DNF A;  5K36 H;  1EFW A;  1LT4 D;  4NBC A;  4BY1 B;  1OXV A;  2Z6B A;  2ENB A;  1Q8K A;  1FNV A;  2OTL Z;  1NJI C;  3K59 A;  3I4N H;  3TS0 A;  3CPF A;  2PPB C;  3MFY A;  4MD9 A;  1STH A;  2B2Y A;  4E32 A;  4DUY Q;  4I7Z C;  1K9M C;  2JA5 I;  1PMR A;  3A7A B;  3E5S A;  4IUT A;  4BY1 G;  1SN8 A;  4RHS A;  4L5Q A;  4HIO A;  1M1K 1;  4E2Y A;  3JC6 6;  3D4R A;  2NVQ H;  3S2D I;  4MTN A;  1QZH A;  1VQ4 A;  5IP9 I;  2E2I B;  5I6Y A;  1GHJ A;  3CCJ A;  1HZ9 A;  2NBF A;  4IAL A;  1Y1V H;  2JA6 B;  2K5W A;  1HTP A;  3PIO A;  2QA4 A;  2F0D A;  3PO3 B;  3RZO B;  4C56 C;  3C46 A;  3NH5 A;  1VQP A;  1YIT 1;  1ONL A;  3H3V J;  1KD1 1;  4FXD A;  3BG1 B;  2J0T D;  5GRO A;  1PH4 A;  3E3X A;  4A3C I;  2K5Q A;  2JA6 G;  2A1A A;  2R61 A;  1NMG A;  3K0X A;  3ONA B;  3PO3 G;  4RS4 A;  4K6D A;  3NXW A;  2Q2I A;  2R7Z I;  1S5D D;  1PZK D;  4UPA A;  1YHQ 1;  5FLX L;  4IUU A;  2A6E C;  5D1P A;  3J80 b;  3A54 A;  4DNI A;  1RCV D;  4JI0 L;  4MRI A;  1UE7 A;  3HKZ A;  1RO2 A;  1DOM A;  1K8G A;  5JVG 3;  4YCW A;  3OIP A;  2CHB D;  3CCL A;  4C1N I;  2B63 H;  3CCV A;  4BBR I;  2F0E A;  4U68 A;  2WAQ A;  1LT3 D;  2QKD A;  3A7L A;  2YV5 A;  1FJG Q;  3DUZ A;  3S1R B;  2ASB A;  1XTD A;  1I6H I;  3W1G A;  5FLM I;  4IUR A;  1KAA A;  3I70 A;  1G29 1;  2ATW A;  1ILQ A;  5FLX E;  4RKB A;  1GD7 A;  1TY0 A;  1W2B A;  1YZ6 A;  2WB1 G;  4LFB Q;  3CQZ I;  5CV6 A;  5M5X H;  4DNR B;  1X3Z A;  1H9S A;  1X32 A;  1Q86 1;  4BY7 I;  1EY9 A;  3GTG I;  2VUM B;  3HOW I;  4G4K A;  1JJ2 A;  2DY8 A;  1E3P A;  5E3F A;  1IL8 A;  3EFX D;  1QVG Y;  4P72 A;  3AMU A;  2N55 A;  3OYY A;  1TWG H;  1FDI A;  2D0P A;  3TRE A;  2CCZ A;  1UE6 A;  4B3T L;  5LL6 X;  2KEE A;  2E7Z A;  4KHZ A;  4CKB A;  2AKL A;  3SVM A;  4DV3 L;  1V1P B;  2K6A A;  1PA6 A;  4LF5 Q;  1I50 I;  3Q87 A;  4G7Z C;  2KI7 B;  5I2Y A;  5EBD A;  1WFQ A;  3I55 1;  3MAQ A;  3G4S Z;  1E1T A;  3KLS X;  1BCP F;  2L12 A;  4DK1 A;  1S72 A;  1IYJ B;  1KXL A;  4NBF A;  4K5X A;  1A63 A;  2I46 A;  1LAB A;  5C3E H;  2KPI A;  4JCV E;  3GD7 A;  1PTO H;  3HOY G;  3GTJ B;  5JJI A;  3VYT A;  3G48 A;  5KYL A;  4MD7 A;  1E1O A;  1LTR D;  3J81 f;  4Y7N B;  4ZUJ A;  3ITP A;  1IHZ A;  3T1H L;  1BBU A; 
#chains in the Genus database with same CATH homology
 3G71 1;  2JNY A;  1TS3 A;  1JC7 A;  3GCF A;  1XXG A;  2K05 A;  3NDJ A;  1X3P A;  4O1N A;  2QEX 1;  1UAP A;  4M8A A;  4NB8 A;  2D2C C;  3GTL B;  2ZAE B;  5FO7 B;  3I07 A;  3DXJ C;  3DMU A;  4KN7 C;  3K57 A;  4K2K A;  1PTO C;  4NBG A;  4YIJ A;  3OPO A;  1GUW A;  3NHH A;  1VQM 1;  1MSH A;  1TII D;  5EPJ A;  2E75 C;  1I4P A;  2O5I C;  3GTP I;  3CCQ Z;  1BQQ T;  1FYC A;  1PDQ A;  4A93 I;  1GUO A;  2A6H D;  4A3J B;  5FO9 B;  1B9N A;  3P20 A;  5KYI A;  1U4P A;  4L63 B;  2A5H A;  1K9M 2;  5C4J I;  3SK8 A;  2BOS A;  2LKV A;  4RFB A;  4XDX A;  2AQ3 B;  4KD3 A;  4A3G I;  2O4X A;  1YJW Z;  1K8A 1;  2JYO A;  1HA6 A;  3K6O A;  4I65 A;  4LMQ D;  1SFO B;  5CV9 A;  3OHX C;  5ELF A;  1SE2 A;  1KNA A;  3GTO I;  1I4R A;  5CBA E;  2ZXR A;  1BUV T;  3QOL A;  4IFD G;  2NUC A;  4A3B I;  3CD6 1;  2RBM A;  1OXT A;  3CHB D;  5CV7 A;  3K7A I;  5C4H A;  1PFN A;  2GA4 B;  4NBH A;  4ZK9 B;  3NWT A;  1CFM A;  1H9M A;  2MP1 A;  1R9T I;  1HPC A;  2M48 A;  3C1E A;  2D62 A;  3SEB A;  3HGB A;  3KLS A;  3TZD A;  1JWH C;  1H9J A;  4HSP A;  4FXG C;  1TS5 A;  1D1I A;  1ZYR D;  2YAD A;  2K04 A;  3OOC A;  4DAP A;  3T4A C;  4TQU S;  4BA1 I;  1VQO 1;  3PUZ A;  4NH1 C;  1LV9 A;  2NZ1 D;  1KRL A;  4NBB A;  1NCV A;  2XSC A;  3NQT A;  1KLG D;  2M00 A;  3GTK I;  4HGY A;  3IAY A;  2G2K A;  3D31 A;  3S1M I;  3D6W A;  1PXU A;  4KTA A;  3SE0 A;  1VQ6 1;  3VR2 A;  5C4Z A;  4BY1 I;  4LJZ C;  4H13 C;  1F77 A;  2OEO A;  4WOR A;  1YUA A;  4QMG A;  1STE A;  2E2H B;  3KIF A;  1F9Q A;  2HQE A;  5G3L F;  5COY A;  3M3Y B;  2BJO A;  1D1K A;  3C3L A;  1SXT A;  2G9D A;  2Q8T A;  4XQJ A;  4HMI A;  3NWS A;  2W04 A;  3CRK C;  3I56 1;  2F0L A;  3TP5 A;  4RHR A;  2JP1 A;  1ESF A;  2ICI A;  1BBX C;  4NFR A;  1A2U A;  1BCP C;  2E2I I;  4IFD J;  2RSO A;  1SEB D;  2JA6 I;  5IGF A;  2IPK D;  3RZO I;  3PO3 I;  3I91 A;  2JMO A;  3TME A;  3R3O A;  1YI2 1;  4RWS C;  5EKI A;  2PMZ B;  2K5D A;  1GJX A;  1Z01 A;  2F4M A;  4C3I B;  1LTT D;  3I72 A;  2R6M A;  1NP6 A;  4A3K B;  2M9V A;  1Q8I A;  2A68 C;  2BE5 D;  4XT3 B;  2OOX B;  2AWO A;  5T67 A;  1B4O A;  3CME Z;  2JS4 A;  1YNN D;  1TWH B;  5C0X G;  4C3I G;  3HOV B;  3RZD B;  4HAE A;  2XN9 C;  1D6E C;  4PQX A;  3CCE Z;  3L7Z C;  4J1M A;  2Q51 A;  4S3S A;  1VQ4 1;  4E2W A;  1YJ9 Z;  5IT9 L;  2MGS A;  3V05 A;  2K01 A;  4HCS A;  3GO5 A;  1VQP 1;  1YJN Z;  1SAP A;  2F3V A;  3J80 f;  2VUM I;  5A35 A;  1E2W A;  1QNU A;  1TY2 A;  4QF4 A;  4A3I B;  5I6W A;  5J22 A;  4S1T A;  3J81 b;  1JB3 A;  3VA5 A;  2AUJ D;  2IX1 A;  3S15 B;  2QCP X;  5IT9 E;  3OMG A;  3L9A X;  1B53 A;  1DXM A;  3FPU B;  3S1Q B;  5JVH 3;  3S16 B;  2E9H A;  2QF7 A;  1EU3 A;  1SNQ A;  5IGE A;  3ERO A;  1FGB D;  2VB2 X;  4X3K A;  3KIH A;  1B9M A;  1HTL D;  2EYO A;  3ND9 A;  1QG7 A;  2HUG A;  3CC4 1;  2NN6 I;  1U4L A;  1KNE A;  1D2B A;  1U4R A;  1CQV A;  4PMW A;  4OGQ C;  1YNJ C;  3VYU A;  2IL8 A;  2KQ3 A;  2GTI A;  1UUP A;  3CCS Z;  3HG9 A;  3PO3 S;  5DAU A;  5M9O A;  1ZB9 A;  3GTJ I;  3PIP 3;  1OXS C;  3MXG A;  4PV1 C;  1XX8 A;  1II3 A;  1TWA B;  4Y7N I;  4BA2 I;  3NBH A;  2C9O A;  3JAM L;  3QWU A;  4FXK C;  3TP6 A;  2B8G A;  5JOB A;  2K3R A;  3HOU I;  3SHL A;  3GP7 A;  1S5F D;  2KEC A;  1ML0 D;  3CCU 1;  3HS0 C;  3X3M A;  5C0X J;  4XYQ A;  4OHJ A;  3GTL I;  3IKJ A;  4RV9 A;  2JR6 A;  3I73 A;  1GOZ A;  3OWF A;  3NSW A;  4F88 A;  2O4H A;  2BCO A;  3D4D A;  4HMJ A;  2OT2 A;  1RTN A;  2BA0 A;  1ZKO A;  3VMG A;  1Y1W B;  3VA7 A;  1T5E A;  1S72 1;  4C3H B;  4PMC A;  4IUP A;  2F03 A;  3BYT B;  1K73 1;  5IP7 I;  2H1E A;  4A3J I;  5BN3 A;  1K83 I;  2G9H D;  1NR4 A;  3CC2 Z;  2KUM A;  2B2V A;  3FVQ A;  1GHK A;  2WAC A;  1CHP D;  5ELB A;  2QRD B;  1J9O A;  2EOT A;  3KF8 A;  1NUI A;  4C3H G;  2Q4Z A;  1T5X D;  3FQM A;  4H44 C;  2B2U C;  4C1N K;  3H0G B;  1E2V A;  1HCZ A;  4DA2 A;  1EWH A;  1LT6 D;  4IFD I;  2N88 A;  1SFO I;  5HUR A;  3Q23 A;  1XYI A;  2R92 B;  5J1Z A;  1VQ7 Z;  2RKS A;  2EJG C;  4KK7 A;  2NVY I;  2EYJ A;  4DXG A;  3QB3 A;  1TFI A;  1Z6H A;  4OO1 H;  2TSS A;  2RBL A;  2QR1 B;  1N8R 2;  5A2Q L;  2E2D C;  5E1F A;  4TRD A;  5JEA H;  2MHV A;  1Q90 A;  1MBY A;  1RO4 A;  3CC7 1;  4FF4 A;  3K5O A;  3V2T A;  1VQ9 1;  1PZJ D;  1SMY C;  4QUC A;  4HTH A;  4DK0 A;  4RGT A;  3NTK A;  5A2Q E;  2B2T C;  3BG0 B;  2K28 A;  5KEE A;  4XXE A;  3U9O A;  2F0S A;  2PYK A;  2B8F A;  3CPW Y;  1PTO F;  4FYD A;  1IYU A;  5EPL A;  2EYP A;  3VMH A;  3D6C A;  3J7A F;  4RH6 A;  5FLX f;  2OTJ 1;  4PNY A;  1RKN A;  1TR5 A;  1C4Q A;  4RCO A;  2EJF C;  4CBV A;  1IYV A;  1LTG D;  3SK6 A;  4KY6 A;  2EY6 A;  2F0F A;  3IX0 A;  4IUQ A;  2HDL A;  2WB1 A;  2EGT A;  1EY6 A;  4TSS A;  5LL6 f;  1HXY D;  1WTW A;  1F9R A;  1STN A;  3M3Y I;  2E76 C;  3CPW Z;  4KY7 A;  1DOK A;  2HF1 A;  2F0G A;  2DY7 A;  3G6J B;  4ZKB B;  3EQL C;  3J7A 4;  4XQQ A;  2L4N A;  4N9T A;  5K36 G;  2BDO A;  1AW7 A;  1DJR D;  1KLU D;  3QO2 A;  1SYF A;  4CKE A;  2NVQ B;  1WD0 A;  2FFK B;  1N8R 1;  4TNU A;  1WW9 A;  2L55 A;  5D3D A;  2B2W A;  4HN7 A;  1Y1V B;  5C0X I;  1V1P A;  3FQQ A;  1KAB A;  3R8B A;  3N52 A;  1CM9 A;  1DOL A;  1WTO A;  3Q0A A;  1QOH A;  3RMH A;  2WB1 B;  5JAV A;  2I07 B;  4G7H C;  1LTA D;  1E2Z A;  1SNP A;  3EVQ A;  3HOV I;  3RZD I;  2JXM B;  1EWC A;  1H9K A;  1Q7Y 1;  3CU7 A;  3NH8 A;  3RUZ A;  4KMU C;  2K03 A;  1VQK Z;  2B2Y C;  2IZ3 A;  1Q82 2;  2HU9 A;  2DE6 A;  5F2D A;  1NR2 A;  5D3I B;  2VB3 X;  5KNC A;  1SYD A;  1H9R A;  1BNZ A;  1EY8 A;  4HR7 B;  4DAV A;  2A73 B;  2SEB D;  5COR A;  2B63 B;  1OXX K;  1IW7 D;  2M6N A;  1M8A A;  1Q3L A;  3LWE A;  4A3I I;  2NN6 H;  1BOS A;  3SDZ A;  3TBI B;  1TWF B;  3ERQ A;  1UNS A;  3S1Q I;  2V8I A;  3I55 Z;  5ELC A;  2O5J C;  2NVT I;  4A3L I;  3HOY B;  2JA8 I;  3H94 A;  4P2C B;  3D8G A;  1TWG B;  4A3D B;  4QTU A;  5K5P A;  1S5E D;  4X3U A;  2YYZ A;  1Q1E A;  4MIU A;  2WP8 J;  3NQI A;  3DEP A;  5FK9 C;  3MA2 B;  3G71 Z;  1LAC A;  4KD4 A;  3A56 A;  1F2Z A;  2GU2 A;  2OOY B;  3BZD B;  3HEJ A;  3G4S 1;  3ESW A;  3EA6 A;  4K5W A;  4B9W A;  1TWA I;  3DWP A;  4L8J A;  2JA7 B;  1MD2 D;  3OSO A;  2NYZ D;  4NBA A;  4MHE A;  2QRC B;  3URY A;  3LNN A;  5C3E B;  2IWH A;  1QIL A;  1PTO B;  3VYS A;  5I4D A;  4CJ0 B;  1CK1 A;  1DZ1 A;  4G57 A;  2JEB I;  2CW0 C;  1R4P B;  1FNW A;  1JE4 A;  1NJI 2;  1G6Z A;  5I2X A;  2F1M A;  3CMA Z;  2LS0 1;  4RA8 A;  1VQ8 1;  3PO2 B;  1V43 A;  1DD2 A;  4H0L C;  3J7Y W;  5EQ0 A;  4ZUI A;  2RDH A;  2DNC A;  2F0N A;  1STG A;  1F2M A;  2FMC A;  3OMC A;  4A3F B;  3MWY W;  2QRE B;  4ME5 A;  1EEI D;  1EY7 A;  3CCQ 1;  4IUV A;  1WD1 A;  4QTT A;  2FIN B;  2FMM A;  3H0G I;  1EYC A;  1RLY A;  5BN5 A;  3M85 A;  5IGG A;  1QF8 A;  5HGT A;  1EY5 A;  1QE6 A;  1VMP A;  4HCE A;  4HED A;  2X69 A;  3TE5 B;  2R92 I;  3D4W A;  3J81 L;  1Y8N B;  3T51 B;  3HRZ C;  1YJW 1;  4NMZ A;  4NDX A;  4XT1 B;  1RO0 A;  4NW2 A;  4QCL A;  5FLX b;  1WCM B;  5IOC A;  1O7Z A;  3FDT A;  3CRL C;  4RGM A;  4K5V A;  3TP7 A;  2XVS A;  2RA4 A;  1TS4 A;  1VQO Z;  2J6A A;  3FKI B;  3H09 A;  3UI2 A;  3WDN A;  1I4G A;  2EYF A;  4BS9 A;  2EY1 A;  2SOB A;  1VQL Z;  2A6E D;  3K5N A;  2CVR A;  4RAU C;  1HUN A;  2I3C A;  4FF2 A;  4B9X A;  2IZ4 A;  5KND A;  1HUM A;  1RDP D;  3G6E Z;  1A2T A;  5M3F B;  2PMZ A;  1SNC A;  2Z1C A;  3EED A;  3GTM I;  2O53 A;  5C44 B;  4ODG A;  3RLF A;  4CL1 A;  1NJI 1;  3MVV A;  3VB9 A;  4ZLT F;  1FNU A;  3SK5 A;  2QIL A;  4KN4 C;  1K9M 1;  1LT5 D;  2KCC A;  5CYU A;  2W03 A;  2MJ8 A;  3NDI A;  5C5M A;  1ICW A;  3U50 C;  3E0J A;  1SE4 A;  3DWQ A;  3K0Y A;  3NTH A;  3I56 Z;  3KBG A;  5IT9 f;  5LHY 1;  2V8J A;  3PIO 3;  4XYO A;  5EGT A;  1SSO A;  1TS2 A;  3WOE A;  2JSO A;  4NB9 A;  4FF1 A;  4FF3 A;  4E2Z A;  1BCP B;  3BVM A;  4RVH A;  1VQ5 Z;  1TWC B;  2B39 A;  1YI2 Z;  1EYD A;  1EIG A;  1M90 2;  1SYB A;  4EVO A;  2RSN A;  4NKL A;  3VR3 A;  5C0X H;  1WTQ A;  2Q8I B;  5CC4 A;  3S1N B;  3A8K E;  4DN4 M;  4AYB B;  5CGK A;  3NTI A;  3MFG A;  2PO4 A;  2P28 A;  2WKC A;  1STA A;  5C6A A;  2NVQ I;  2KCN A;  4E31 A;  2LY7 A;  4GZY C;  2PK7 A;  2EE1 A;  1U4M A;  3CCM 1;  2NWG A;  4RGO S;  3R93 A;  3IFT A;  1VF5 C;  2L0C A;  2F0O A;  1I4Q A;  3F3F C;  3T13 A;  1Z02 A;  1XTC D;  3CCR 1;  4V19 0;  5I9P A;  4OIK A;  4PMB A;  1WII A;  5KGU A;  1CHQ D;  3A55 A;  5T6B A;  1VQ4 Z;  2PM9 A;  1JOK A;  3CCJ Z;  2J4X A;  3S1R I;  1SNO A;  2QA4 Z;  1JCK B;  1PRT C;  5AFW A;  3FPP A;  3TZU A;  1VQP Z;  1Q81 2;  4K6L A;  2A69 C;  1S5C D;  3A8J E;  3M4O B;  1W2B Y;  4OL7 A;  5DEH A;  3CME 1;  1PTO D;  4WRD A;  3GTM S;  1SJE D;  1TT2 A;  3CQZ B;  1JJ2 Y;  3CCE 1;  2B63 I;  3BDL A;  2E2J B;  5EJW A;  1RF2 D;  3K5L A;  4EGV A;  4JK1 C;  4FO2 A;  1JIC A;  1YJ9 1;  3DWA A;  3M7G A;  2JE6 I;  1PFT A;  3CCL Z;  2DN8 A;  3CCV Z;  1F2L A;  1LO5 D;  1YJN 1;  1TWF I;  2DNE A;  5D1O B;  2OXP A;  2DE7 A;  3J7A V;  1B44 D;  2EYM A;  1CQF A;  2PQE A;  1BDO A;  1IKL A;  5ELD A;  3HOY I;  2XRQ D;  1CZG A;  1W2B Z;  1AN8 A;  4U67 3;  1PYW D;  3NPP A;  4A3D I;  3FRP B;  1JJ2 Z;  2AQ2 B;  2HCI A;  1GUT A;  1WTR A;  3NH4 A;  4CKC A;  4KKT A;  1S5B D;  2H4O A;  2WKD A;  3D9X A;  5CBE E;  2Z8L A;  4J8Q A;  2JA7 I;  3I90 A;  1MGS A;  1PFM A;  5E4X A;  3L3O C;  1QYP A;  1Y1V S;  5C3E I;  4LK1 C;  2F0V A;  3J80 L;  5ELE A;  1U9R A;  1S72 Z;  4NBE A;  2WV6 D;  3JAM E;  2Z4I A;  1KTK A;  3HOZ B;  1HFN A;  2ZXP A;  3CXC Y;  3HZX A;  3GV3 A;  4L6T B;  5EPK A;  3FEW X;  3PO2 I;  4ZRZ A;  3T56 B;  3IL8 A;  1Y69 U;  3SXH A;  5CMD A;  3S14 B;  1SBB B;  2LIY A;  1STB A;  1WTV A;  3PV0 A;  2B2T A;  1VQN Z;  1P9N A;  5C4J B;  4A3F I;  2Y0S B;  1W6K A;  3VYR A;  5C3W A;  4DF7 A;  4XQN A;  5FO8 B;  1FR3 A;  5CR3 A;  2IJ0 A;  3QJY A;  4OIJ A;  4ZAI A;  2F0K A;  1M1K 2;  3PMF A;  4H7B A;  2E74 C;  2EYH A;  3CC2 1;  4CJ1 B;  1MSG A;  3GTO B;  1L1O C;  1EZ6 A;  3CXC Z;  4E30 A;  3H3V C;  2WIN B;  2L11 A;  2LFU A;  1BCP D;  1LTI D;  4QB4 A;  5CM2 M;  5JPN C;  1KD1 2;  1EOT A;  1JOR A;  3K7A B;  4KKU A;  4FNF A;  2LFN A;  1EEF D;  1QB5 D;  4XX2 A;  1VQ7 1;  1WCM I;  1QJO A;  2X6G A;  3MXN A;  2CQA A;  1ENA A;  5IGD A;  1R9T B;  4E6I A;  4EWC A;  4ABN A;  1YUK A;  2GTH A;  4ZQ3 A;  4RKL A;  3D3R A;  2QDB A;  1YIJ Z;  5IIF A;  1I3Q B;  3FKI I;  3GTQ B;  1NUC A;  5IT9 b;  1X3W A;  5M5W B;  5KNB A;  2Q8R E;  3P75 A;  2F0P A;  2A68 D;  3PUX A;  1RD9 D;  4MD8 A;  2B2V C;  3NBI A;  3SR1 A;  1O7Y A;  4OO1 G;  4DGZ A;  3NUC A;  1DON A;  3W3A A;  4A3M B;  2A6H C;  1KDB A;  5JEA G;  3ZYY X;  3QOJ A;  5ISR A;  4HH4 A;  1EQT A;  3GTK B;  1USP B;  1Q86 2;  1EU4 A;  2RHB A;  3MZL B;  3E6Z X;  3NFZ A;  4NBD A;  2E2H I;  5C4X B;  2FJ2 A;  1V1O A;  4NP5 A;  4IN3 A;  3NK9 A;  2IX0 A;  2YU9 B;  3S9W A;  2OTL 1;  3M7N A;  1YIT Z;  5EKL A;  3C2P A;  3I4N B;  4A3E B;  1TWC I;  4QUF A;  1QNK A;  2LMC B;  2HCC A;  3T16 A;  4KY5 A;  2IW3 A;  3S17 B;  2QEJ C;  1YHQ Z;  1EY4 A;  3S1N I;  4DXF A;  1QVF Y;  1WTX A;  1I4H A;  1ZEQ X;  3KLR A;  2SNM A;  3JAM b;  3P1H A;  4RVD A;  3T4N B;  1YNJ D;  4J6H A;  4MXU A;  4A3K I;  1KDA A;  1ZYR C;  3T53 B;  2EY2 A;  3R2I A;  3MZK B;  1TWH I;  2VUG A;  1EQV A;  3DHQ A;  4BBS B;  1ILP A;  5CV5 A;  2L1B A;  4EQN A;  2R93 B;  4FP5 D;  3PUW A;  3KUP A;  1WTP A;  1ENF A;  1R4Q B;  5AN9 F;  5EBC A;  2NVX B;  2PNR C;  1FD7 D;  3TP8 A;  4EQP A;  4BXX I;  1VMC A;  1JWM D;  1KC8 2;  1I6V C;  1L0Y B;  1QVF Z;  1RJT A;  5JEA J;  2V4D A;  1LLR D;  3M4O I;  3W2D A;  1Q12 A;  4R8N A;  2Z4H A;  1S7M A;  1ZB8 A;  3I8Z A;  1LTS D;  1TKW B;  2H85 A;  3DEO A;  3V96 A;  4KV6 A;  4XIG S;  1VQK 1;  1A6X A;  2E2J I;  1RNI A;  1G8Z D;  3S15 I;  4EQO A;  2KA7 A;  2P3Y A;  3S16 I;  5M5X B;  2K33 A;  3H6M A;  5I9O A;  4B08 A;  3K58 A;  1K8A 2;  5KIX A;  4E33 A;  1S4Z A;  1EIH A;  5G3L D;  4KJN A;  2F0U A;  1G91 A;  5DM7 3;  2XNA C;  1G2T A;  3TDQ A;  1ROD A;  3VR6 A;  4X6A I;  2B2W C;  5A2Q b;  3HKZ B;  1KQS Y;  2RDF A;  5LL6 S;  1RQF A;  4R8I A;  1GUN A;  1IKM A;  2A74 C;  3C1F A;  2F0W A;  2RVL A;  4QIW B;  1JQY D;  2WAQ B;  3X3N A;  1W6J A;  3I4L A;  2QEX Z;  1SYG A;  2NN6 G;  2AQ1 B;  2F0T A;  3OWE B;  1SE3 A;  2K5R A;  2BE5 C;  1QVG Z;  1RTO A;  1YNN C;  2KED A;  3H91 A;  1H9S B;  3KK7 A;  1J8I A;  1O78 A;  5C5L A;  1VQM Z;  3Q24 A;  1QWY A;  2BA1 A;  5CV8 A;  3HOU B;  3R2T A;  3BVG A;  2QKI C;  1KQS Z;  1PRT F;  1VLA A;  2RT9 A;  1VQ8 Z;  1SMY D;  3GV6 A;  4UAI A;  1Q82 1;  1Y1W I;  1PFB A;  2QLV B;  1I4X A;  1K8O A;  3HOZ I;  4RCN A;  2WII B;  4F8M A;  2PCF B;  3S2H B;  1LQL A;  1KC8 1;  1EYA A;  4IFD H;  4ILW A;  1E0B A;  4CHT B;  2NB0 A;  1BR9 A;  1A15 A;  5CV4 A;  4XTC S;  2ID0 A;  3S14 I;  2RIQ A;  1K83 B;  1DL6 A;  3QWN A;  1Q1B A;  3CMA 1;  2PZT A;  2EDG A;  3QG1 A;  1Z03 A;  3CD6 Z;  1A3V A;  3AU7 A;  4IZ8 A;  1X0T A;  1O80 A;  4ZYS A;  1PLF A;  2AWN A;  1EZ8 A;  3VR4 A;  1D5M C;  4V0B A;  3NE5 B;  2NVY B;  4K8I A;  1TQO A;  3OW7 A;  4KI0 A;  1OO9 B;  2BDN A;  3J81 E;  3I4M B;  2HDM A;  3Q22 A;  1O7L A;  3TN2 A;  2EJM A;  4RVF A;  2K1B A;  4WJW A;  5J39 A;  5JJZ A;  1SJH D;  4OO1 I;  1Z47 A;  3BDO A;  3I3C A;  1I3Q I;  4DAY A;  3HOX B;  3GTQ I;  1L0X B;  4MN3 A;  2EZV A;  4AYB A;  4DNT B;  1VQ6 Z;  5JPM C;  3LX0 A;  1TU2 B;  4A3M I;  5DM6 3;  3OIQ A;  4RGN A;  2VXW A;  1B2T A;  1ESR A;  2F0J A;  3HP3 A;  1VQL 1;  3VMI A;  1Z7T A;  3O13 A;  4R9W A;  1DCZ A;  4G7O C;  4KJO A;  4HSV A;  3G6E 1;  1STY A;  3BYY B;  4X3S A;  1A3U A;  4F7X A;  5C4X I;  2KVM A;  2L9H A;  5D65 A;  2JA5 B;  3BDC A;  1CA5 A;  1HQR D;  2VF1 A;  1JWU D;  2ICE C;  1K8M A;  1GXD C;  2KJX A;  4MON A;  2YU9 I;  2EVB A;  3F2U A;  3S2D B;  4Q5V A;  3I4N I;  2V8K A;  4A3E I;  1Y8O B;  2ZXO A;  1BO0 A;  3F3P C;  1OXU A;  1XWE A;  1NAP A;  2F4I A;  4C3J B;  5C3X A;  2TMP A;  3S17 I;  3CCM Z;  4F87 A;  1TVX A;  1VQ5 1;  3CCR Z;  1AP0 A;  3VTN A;  1Y1V I;  5D1O A;  1GUS A;  1SDF A;  4C3J G;  2R7Z B;  1JWS D;  1NSN S;  5T1G A;  3MTS A;  2KOL A;  1EY0 A;  5FKA C;  4ID6 A;  3N6R A;  2M2L A;  5IOD A;  1PRT B;  1SNM A;  3K5M A;  4BBS I;  4BBR B;  3ND8 A;  2R93 I;  1I6H B;  2EYL A;  3FMC A;  2NVX I;  1VF7 A;  2XWJ B;  3LUS A;  3JAM f;  2L5T A;  1HHV A;  3MC0 B;  2JUB A;  4N9P A;  2K32 A;  2EPB A;  1Y8P B;  1MI2 A;  3CCJ 1;  2CW0 D;  2K7V A;  4BY7 B;  3GTG B;  4RVG A;  2QA4 1;  1UEA B;  1ZXT A;  1PZI D;  2F0H A;  3SK4 A;  3HOW B;  1K73 2;  2OF1 A;  4CGY B;  3QIA A;  3MEH A;  2IX3 A;  5BN4 A;  3EJI A;  2X6L A;  1JOO A;  3CC4 Z;  3IFU A;  3TDH B;  1D5Z C;  3NP8 A;  2F0I A;  5TSS A;  4BWG B;  2ZT9 C;  1M4V A;  1EL0 A;  1VCI A;  4MH4 A;  2XRS D;  1C8C A;  4E2X A;  1I50 B;  1SYE A;  4WFN 3;  1ET6 A;  2R6G A;  1TWG I;  1CI3 M;  4C2M B;  2NVT B;  3PUV A;  4TKO B;  1M90 1;  1B3A A;  1ET9 A;  2PW5 A;  2SDF A;  5M5Y B;  2JA8 B;  3CCL 1;  1HQM C;  3CCV 1;  2MUY A;  4UDU C;  3PUY A;  2EXZ A;  3GQB A;  5M3M B;  2B2U A;  4JBW A;  2Y0S A;  4LAA A;  3CCU Z;  1EFI D;  4X3T A;  5FOB B;  1CTM A;  1CZW A;  1N2F A;  1DYQ A;  4K8J A;  3MZ5 A;  2F0Q A;  1B50 A;  4KHV A;  4DFA A;  2F3W A;  4Q0F A;  3LWU A;  2NTT A;  3CCS 1;  3BVZ A;  4DU9 A;  5T64 A;  5A2Q f;  4K2L A;  2R3Z A;  1AFP A;  2F4O A;  1VDZ A;  2VNU D;  3DM1 A;  5EKK A;  3G7L A;  2EY5 A;  1Q81 1;  3MXU A;  1QCB D;  1BF4 A;  4Y52 I;  4DQY B;  3A8I E;  1IW7 C;  3GTP B;  3AB9 A;  4A93 B;  3IFD A;  4K14 A;  3U9S A;  3S2H I;  4CJ2 C;  3J80 E;  1CA6 A;  1B1Z A;  4IQZ A;  1WVL A;  4Z9C B;  2KHS A;  2PZW A;  3OW2 Y;  2C5C A;  3RD4 A;  2SNS A;  4DGL A;  3CKI B;  4A3G B;  4ULL A;  3Q6S A;  4KKS A;  2O2L D;  1SND A;  2MPM A;  1C48 A;  1ENC A;  2JEA I;  3P5J B;  2D9U A;  2RPR A;  1V8Q A;  2RQX A;  3BS1 A;  2XWB B;  3WOF A;  1JOQ A;  3KBX A;  1VQN 1;  1AEX A;  1USP A;  5IGB A;  1ZH1 A;  3MHB A;  4A3B B;  3IF8 A;  3MXP A;  1D5X C;  3P7J A;  2IT1 A;  2OZK A;  2J7Z A;  1RHP A;  3CC7 Z;  3OW2 Z;  1HFG A;  1VQ9 Z;  1LTB D;  4NOZ A;  1HA5 A;  1DM0 B;  3GKQ A;  3MON A;  1F2Y A;  1X3Q A;  2PZU A;  1G2S A;  3I4M I;  3BG3 A;  2RDG A;  5T1I A;  1JR0 D;  2AUK A;  1SYC A;  1HRJ A;  4HGZ A;  1F9S A;  2D5D A;  1F9P A;  2OTJ Z;  2NTS A;  2FHT A;  3M4Y A;  3HOX I;  4M1U B;  2PW7 A;  1KDC A;  1AZQ A;  3EER A;  1Q7Y 2;  5C44 I;  3VR5 A;  4IUN A;  4FVM A;  1ML8 A;  4ZKC B;  1YIJ 1;  1CT1 D;  5D14 A;  2F0M A;  5E4W C;  5KRU A;  1PRT D;  3GTM B;  1AZP A;  4O42 A;  1GUG A;  3S1M B;  2A69 D;  1A3T A;  3TSS A;  5IGC A;  2DE5 A;  1BXT A;  2XIW A;  5DNF A;  5K36 H;  1LT4 D;  4NBC A;  4BY1 B;  1OXV A;  2ENB A;  1FNV A;  2OTL Z;  3K59 A;  2PPB C;  3MFY A;  4MD9 A;  1STH A;  2B2Y A;  4E32 A;  4I7Z C;  2JA5 I;  1PMR A;  3A7A B;  3E5S A;  4IUT A;  4RHS A;  1M1K 1;  4E2Y A;  3D4R A;  3S2D I;  5IP9 I;  2E2I B;  5I6Y A;  1GHJ A;  2NBF A;  4IAL A;  2JA6 B;  2K5W A;  1HTP A;  3PO3 B;  2F0D A;  3RZO B;  4C56 C;  3C46 A;  3NH5 A;  1YIT 1;  1ONL A;  3H3V J;  1KD1 1;  4FXD A;  3BG1 B;  2J0T D;  4A3C I;  2K5Q A;  2R61 A;  3ONA B;  4RS4 A;  4K6D A;  3NXW A;  2R7Z I;  1S5D D;  1PZK D;  1YHQ 1;  5FLX L;  4IUU A;  2A6E C;  5D1P A;  3J80 b;  3A54 A;  1RCV D;  4MRI A;  3HKZ A;  1RO2 A;  1DOM A;  5JVG 3;  3OIP A;  2CHB D;  4C1N I;  4BBR I;  2F0E A;  4U68 A;  2WAQ A;  1LT3 D;  2QKD A;  3A7L A;  3DUZ A;  3S1R B;  1I6H I;  5FLM I;  4IUR A;  1KAA A;  3I70 A;  1G29 1;  1ILQ A;  5FLX E;  4RKB A;  1TY0 A;  3CQZ I;  5CV6 A;  4DNR B;  1X3Z A;  1H9S A;  1X32 A;  1Q86 1;  4BY7 I;  1EY9 A;  3GTG I;  2VUM B;  3HOW I;  4G4K A;  2DY8 A;  5E3F A;  1IL8 A;  3EFX D;  1QVG Y;  3AMU A;  2N55 A;  5LL6 X;  2KEE A;  4KHZ A;  4CKB A;  2AKL A;  3SVM A;  1V1P B;  2K6A A;  1I50 I;  3Q87 A;  4G7Z C;  2KI7 B;  5I2Y A;  5EBD A;  3MAQ A;  3I55 1;  3G4S Z;  3KLS X;  1BCP F;  2L12 A;  4DK1 A;  4NBF A;  4K5X A;  2I46 A;  1LAB A;  2KPI A;  3GD7 A;  1PTO H;  3GTJ B;  3VYT A;  5KYL A;  4MD7 A;  1LTR D;  3J81 f;  4Y7N B;  4ZUJ A;  3ITP A;  1IHZ A;  5NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...