3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting/DNA response regulator
publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Dna binding protein
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
1U4RA 1RJTA 3HOZI 2K1BA 2EOTA 5IP9I 2EPBA 2R93I 4A3II 1TWFI 3VMIA 2NVXI 2L12A 2E2JI 4A3MI 1E0BA 4R9WA 1U4MA 4A3BI 2L9HA 3R93A 3GTGI 2MJ8A 2BDNA 1G91A 2DY8A 2Q8RE 1HFNA 3S16I 1L1OC 3S1MI 5DNFA 2KEEA 1QYPA 2RVLA 5CM2M 1ML8A 1EL0A 3HOWI 1AZPA 5FLMI 1F9QA 4OIJA 4NBFA 2JA5I 2VUMI 2MP1A 1WTWA 1O80A 3CQZI 1HHVA 4QUCA 1F9SA 3MWYW 1BNZA 2K04A 4A3GI 2SDFA 1O7ZA 1MSGA 4HCSA 1WTXA 4ZLTF 1SDFA 1CA5A 2JP1A 1R9TI 2D9UA 4HAEA 1KNEA 4XDXA 2K01A 1F9PA 3DM1A 1NUIA 2J6AA 1HRJA 1A15A 4NB9A 1RHPA 4HSVA 1VLAA 2L4NA 3P7JA 1SAPA 3FKII 5EJWA 4ZKBB 5D65A 1J9OA 3HP3A 2RSOA 3GTMS 3SVMA 3TN2A 1YUAA 1TWGI 2X69A 4XT3B 4CJ2C 1WD1A 3EERA 1X3WA 3GTMI 4NBBA 2M2LA 1IKMA 4QTUA 1G2TA 2NZ1D 3RZOI 3S1RI 3FDTA 1JICA 2X6LA 3U50C 2NWGA 1S4ZA 2PK7A 4NBAA 1TFIA 4XT1B 5C44I 2K28A 5T1GA 4NBDA 1C8CA 2H1EA 4Y52I 2K5RA 1Y1VI 1X3QA 1QNKA 3GTPI 1U4PA 1WTOA 1PLFA 3PO2I 2VXWA 4DN4M 3M4OI 1EQTA 3S2DI 3KUPA 3N52A 5COYA 5CORA 1DOKA 1MGSA 2HUGA 3VMGA 1TWHI 4X3UA 1WTVA 4ZKCB 1ESRA 2B2YA 3GV6A 1ZB9A 3DEOA 1LV9A 3GCFA 2Q8TA 4RWSC 1RO4A 1ICWA 3IL8A 1B4OA 4NBHA 2HDLA 4CJ0B 3Q87A 1TWCI 2KECA 4O42A 3S1NI 4R8IA 5JJZA 4LMQD 1I6HI 1TVXA 1JE4A 2FMMA 4A3EI 3ESWA 3FPUB 3GV3A 3RZDI 1G2SA 3Q6SA 4IURA 2B2YC 1DZ1A 4Y7NI 4IUPA 2B2TA 5T1IA 2JNYA 2B2WA 1HA6A 1QE6A 2N55A 1NR4A 3G7LA 3UI2A 3HOYI 1MSHA 5EPKA 5IP7I 3TZDA 5EKIA 1DOMA 1TWAI 2FJ2A 1HFGA 4NW2A 3GTLI 1LQLA 2KVMA 1PFBA 5E4XA 2NYZD 5CMDA 1PDQA 1EIGA 2JS4A 2JR6A 3S2HI 2NVQI 1X32A 1BO0A 1B2TA 3KBXA 2KUMA 2FHTA 1HUNA 1O7YA 4RAUC 1EIHA 2B2WC 1DL6A 4IUVA 1K83I 1AP0A 4ZK9B 1USPB 1PFTA 2K05A 1DOLA 4QTTA 5EPJA 1CM9A 3K7AI 4A3DI 4HEDA 4BBRI 4A3KI 2YU9I 4A3CI 1ILQA 1G6ZA 1RLYA 2R3ZA 2E2HI 1RTNA 1VMCA 5C4JI 5C4XI 3I07A 2AKLA 1Q3LA 2X6GA 3GTKI 1XX8A 2HF1A 4MN3A 4RA8A 4NBCA 1IKLA 3H3VJ 3S15I 2HDMA 5EPLA 3I4MI 1IL8A 3F2UA 2L11A 1WD0A 1B53A 4NBGA 4BXXI 1SSOA 3VB9A 4A3JI 2JA7I 1F9RA 1KNAA 1WTPA 1ZB8A 2BJOA 1PFNA 4BBSI 1EOTA 1B50A 3H91A 5C3EI 1Y1WI 2E2II 4X3KA 3HOUI 1F2LA 2RBLA 3PO3S 1HUMA 2NVTI 2JYOA 1BBXC 2L1BA 3I4NI 2MGSA 4A3FI 1NAPA 3HOXI 4NOZA 1ZXTA 3PO3I 1I50I 4A93I 2KOLA 1AZQA 4X3TA 3I91A 2RA4A 3GTOI 5EQ0A 1PFMA 1BF4A 5E4WC 3QO2A 2JA6I 1X3PA 1MI2A 2B63I 3I3CA 2EE1A 4X3SA 1WCMI 1GUWA 2RSNA 1DONA 2FINB 4IUUA 2DE5A 1CA6A 2B2UA 3DEPA 1WVLA 4IUQA 2IL8A 1WW9A 4MHEA 3LWEA 2R92I 2DE6A 2XIWA 4U68A 2R7ZI 1U4LA 1B3AA 2NVYI 2HCIA 3IFDA 2J7ZA 2N88A 2B2TC 3H0GI 3LUSA 1VMPA 1RODA 3I90A 4MH4A 3D6WA 4QUFA 4NB8A 2DE7A 2KPIA 1WTQA 2DY7A 3VMHA 2B2VA 3HOVI 1X3ZA 2JA8I 4NBEA 1NCVA 2B2UC 4OIKA 1NR2A 1SFOI 2KEDA 3I8ZA 4X6AI 2K03A 1RTOA 4ZAIA 2CVRA 3GTJI 4XX2A 3ONAB 1Y1VS 4IUTA 3S1QI 1XYIA 1I3QI 1ILPA 2HCCA 3S17I 2P3YA 1J8IA 2FFKB 1USPA 3M3YI 3GKQA 3S14I 4BY1I 3GTQI 2F4MA 1M8AA 4BY7I 4A3LI 5AFWA 4UAIA 1WTRA 1ML0D 5CBAE 1QG7A 3MTSA 1N2FA 2F4OA 2B2VC 4CJ1B 5D14A 2MPMA 5CBEE
chains in the Genus database with same CATH superfamily
4F87A 4I7AA 5EKKA 3OMCA 3E3XA 1A0IA 2OEOA 4DV3L 3H3VH 4DR6Q 4A3II 2NVXI 4Y52H 4LFAL 1KXLA 2E5LQ 1Y1VH 2L12A 1YUKA 3NBHB 4XIGS 1E0BA 1RDPD 4EVOA 2R7DA 1Q1EA 3Q0AA 3R93A 4FF2A 3ICEA 4E2XA 3D9XA 1MHWC 1N36Q 4KHZA 3S2DH 1RO0A 4JG2A 1L1OC 1S5BD 5DNFA 2KCTA 1IBLL 1Y8CA 3HG9A 3QR8A 2W03A 5CM2M 1ML8A 2F3VA 1S721 2O5IC 1YZ6A 5DAUA 3HOWI 4GZYC 1SXTA 3NUCA 4NBFA 1LTID 4NPSA 1SN8A 4ZRZA 5IY0A 1K8A2 5BR8L 4MXUA 2MP1A 1WTWA 3NH4A 3NBHA 4RHSA 5FLXE 1F9SA 4ODGA 2DJGC 3EEDA 1BNZA 1HH2P 2K04A 2NBFA 2JIMA 2WKDA 3VTNA 2PI2E 1QJOA 1Q821 1A3VA 1O7ZA 2JXMB 3PO2G 2BH2A 2A6HD 4NB3A 3SXHA 3J81i 3BDLA 1WTXA 3PO2B 1CA5A 3OW2Z 4DNRB 4NXNQ 2MUYA 3K6OA 4XDXA 3IR7A 5FLXf 3F1ZA 4FXDA 2RT9A 1S7MA 2J6AA 3RMHA 2E5LL 4NB9A 2MO1A 1I6HH 3CU7A 4AH6A 4A3FH 1V1QA 1Q812 2CH4W 1SIWA 4DF7A 3FHWA 4LJZC 1T5EA 1Z9FA 1SAPA 2NAPA 2A19A 1V1OA 1STEA 4OX9L 2B8GA 1IL2A 4UP7A 5G3LF 2E75C 2XRQD 1J9OA 2RSOA 1SRUA 1H95A 2F4IA 3D0FA 1NTGA 5IYDG 3SVMA 1YUAA 3NTIA 4IQZA 3CCU1 4XT3B 3L9AX 4IZ8A 3QWUA 1Y1WG 1VQLA 3EERA 1KC81 3PSIA 5M5WB 1A63A 1VQ71 3CC7Z 2Q2UA 2HIXA 3I70A 1JQYD 4M1UB 3FQMA 4QMGA 1F2ZA 3HGBA 1X65A 3S1RI 3W3AA 2X6LA 4UHVA 5GROA 3U50C 2QEXA 4GOPB 2O4HA 4G7OC 2PK7A 1S5DD 2P5ZX 5J1ZA 3MZLB 1PHJA 3H3VI 1GUGA 4B3TQ 2CWAA 3KF8A 1XNRQ 2H1EA 4JI3Q 3FMCA 2LXJA 3M7NA 2BA1A 4Y52I 1VQJA 3UE0A 5C0XG 1Y1VI 4NXNL 4E2YA 2BA0A 4XTCS 1Y8OB 3CCLZ 1T9HA 1O78A 5CV7A 2LSSA 4FO2A 4LF8L 1FNVA 2VXWA 4DAPA 4Y7NB 4MIUA 5HGQA 4M8AA 3S2DI 5COYA 1DJRD 3DUZA 1MGSA 2CWPA 1JOOA 4DV7Q 1Z6HA 4L5TA 1QNUA 4R4QA 3M4YA 2QA41 3CME1 1ENAA 3ER0A 4IJHA 4S1TA 5CYUA 1WTVA 2V8KA 4GOPA 1N8R2 1YJ91 3SK6A 3TMEA 1D6EC 3KF6B 1TWAB 1K8GA 3K59A 3GV6A 2VPWA 3TZUA 5LL6S 2KQ3A 4LF5Q 4FVMA 4BBRH 2JUBA 5I6YA 5NUCA 2WB1E 2R7ZG 3MXPA 2VS1A 4QF4A 2RQXA 2NVQB 4YIJA 1UEAB 4FP5D 3HEJA 1TY2A 1VQKZ 1EUJA 3Q87A 3S15H 4CKBA 3VDYA 3K0YA 1KD11 4B3TL 1SEBD 2F0HA 2KECA 4R8IA 3SK5A 5JJZA 4X66L 4LMQD 1PH9A 1I6HI 3CC21 2FMMA 5EGTA 1K83B 3KF6A 1S5ED 1Q82C 3KLSX 3WOEA 3D4DA 5IOCA 3GV3A 3HOVG 2ZJPA 3HFZB 1TS4A 2JA8G 1BOSA 3K7AB 2JA7H 1WJ2A 3A0JA 2YTYA 3CD6A 1Q8IA 3EFXD 5CV4A 1DZ1A 4DUZL 1X0TA 3I56A 2UXCQ 4IUPA 2B2TA 4JV5Q 1JT8A 1SMXA 4J6HA 2E2IH 2HD3A 4KJNA 3GTKB 4X64L 1YJWA 2KHIA 2YTXA 4JI5Q 3G7LA 4L5RC 5EPKA 3EN2A 3G4SA 2F0IA 4LF5L 3I4NH 1VQGA 2A6EC 4I7ZC 3HOXH 4RFBA 2FXQA 5DM73 3PO3H 2NZHA 2JQOA 1NY4A 4NW2A 1JB3A 3J7YW 1LQLA 1B70B 2KVMA 1A6XA 2JEAI 4WRDA 1PFBA 1YJNZ 3SR1A 3J80c 1KC8C 3CCEA 4DR4Q 3CCM1 3NWTA 1C0AA 1W2BY 2JS4A 1EEID 2EGTA 5D3DA 1E24A 1X3GA 1X32A 1BO0A 2IHEA 3KFUA 3CRKC 3KBXA 1W2BA 1KLGD 3F8TA 4OO1G 1NMGA 4JK1C 3CF5A 1PV4A 4JYAL 1HUNA 2Z6KA 3HOUB 3CCJZ 5ELEA 3A8KE 4KY6A 1VQEA 2NVTB 4KD3A 1LO5D 4A3MG 1SE2A 4DR5Q 2K05A 3CW2C 3HZXA 2BCOA 2J4XA 4QTTA 2XGTA 4JV5L 2K6AA 1LUZA 3GO5A 2R92H 4BBRI 1PYBA 1ILQA 4C2MB 1G6ZA 1VQLZ 3DLLA 2O53A 1NJI1 1RCVD 3GTOB 1FGBD 2KJXA 4C3JH 2B63B 2ZXRA 3RUZA 2HF1A 3JAML 2ZTEA 1SYFA 4ME3A 2Q51A 2OWOA 4OONA 2KCMA 3H0GH 3S15I 4KMUC 2HDMA 3K80C 4J15A 4DR4L 3F2UA 5JEAH 1WD0A 3RLOA 2ZJRA 4A3GG 1HCZA 2WACA 4P72A 4HJ7A 4B3RL 4A3GB 4NBGA 1SNMA 3ULPA 1VQ4A 4DR1L 3P75A 2VQFQ 3K57A 1KNAA 2JA7I 3QOLA 4HGYA 1ZB8A 1XNQQ 1PFNA 1LM0A 4LUOA 3STBC 4FF1A 4C3HG 3PUZA 5LHY1 4CDEC 4C3HB 2E2II 4DR5L 1PH8A 2KI7B 2OXPA 1C48A 1VQ9A 3S1QH 3MFGA 2Q8IB 3OIPA 1KQSZ 1LTBD 1PVOA 2JYOA 2BE5D 4DV5Q 1Q81C 3I4NI 1AA6A 3S14H 3MONA 4TNUA 1QVGZ 3D6CA 1VQ7A 4BY1H 3HOXI 5JJLA 2G2KA 3PO3I 2MHVA 3CCL1 1JORA 2Q4ZA 4X62Q 1AZQA 4WJWA 4X3TA 1BBUA 4JI8L 5CC4A 2ALYB 1ASYA 4A3LH 5CV6A 3M9BA 1K732 2RA4A 3PIP3 4LF9L 2WB1B 1X6OA 3QO2A 5KNDA 4RCNA 3CCVZ 1UE7A 3I3CA 2XTIA 1GVPA 3GTJB 2B29A 2UUAQ 2IWHA 5C44G 1QZHA 1VQ8A 1FNWA 2R61A 1I3QB 2FINB 3L3OC 4IUUA 3RLNA 1VQ6A 4WJ4A 1FR3A 5GAGC 1G291 2AHOB 3S17B 1YIJA 4A3BH 3VR6A 4DAYA 2N3SA 4B3MQ 1HNZQ 1EQRA 4H0LC 1Y8NB 1SR3A 1NBWA 3J80b 1U9RA 1SMYC 2WAQE 2V45A 2V4DA 4MHEA 3M4QA 2V1CC 1Y14B 2JSOA 2R92I 4BY7B 3JAMb 2XIWA 2AUKA 3HKZG 5T6BA 1SE3A 4UP8A 3HRZC 1B3AA 4DV5L 2HCIA 1EFWA 2VZAA 4JI2Q 4DV0Q 1K9M1 1C4QA 3G48A 5FLMH 4GNXB 1PMRA 2J7ZA 2JA5H 5IP9G 3HOZB 2N88A 3H0GI 2VUMH 1E2WA 3U4VA 1VDZA 1PFSA 2Y0SA 1NJIC 2ASBA 2MFIA 2DE7A 3CC4Z 1I4RA 3CCSA 4E6IA 3VA7A 4ZUJA 3DXJC 4F88A 2ZXOA 4LF7Q 2E2JB 2F0VA 1WTQA 4B08A 3J81c 3TBIB 3NTKA 1X3ZA 2VUGA 2B2UC 1R9TH 4OIKA 1NR2A 1OXSC 2WV6D 2KEDA 4AIMA 2NUCA 2OT2A 3S16B 3I8ZA 4R4OA 1RTOA 1BQQT 1EZ6A 2RHSB 1PTOC 1Y8PB 4PMWA 5CV8A 4DR7Q 2EYLA 3VR4A 4B3ML 3S1QI 2WP8J 2A5HA 1B9NA 2LFNA 1EY5A 1USPA 1X54A 3CQZB 3S14I 4DA2A 2ZAEB 4TRDA 5LMUQ 4BY1I 4E33A 1EY7A 3TE5B 4MRIA 4GLXA 1LT4D 5KRUA 4K0KL 1JB7A 3PQIA 2HT1A 4KHPQ 2JJQA 1SNOA 3TDQA 1YHQZ 4DV0L 4JI2L 2F0JA 4LF6Q 4HIKA 4G7ZC 4A3LI 4UAIA 2PQAA 3CP0A 4ALPA 1QILA 5L37A 1Q7Y1 2SEBD 1KAWA 1ET6A 2ICEC 2OQKA 5C3WA 5I4DA 4LF7L 4LUZA 1RJTA 1OTCA 3D31A 1I4XA 1DCZA 2R93I 2EPBA 1ZH1A 1MIUA 2SOBA 3K5NA 4POGA 3NSWA 4LWCA 1PZID 3S24A 4LNQA 1UE5A 2I5LX 1VQL1 4A3BI 4OL7A 3PIO3 4GKJL 3PO2H 2D2CC 2GTHA 1B7YB 2NN6G 3NHHA 1VCIA 3K8AA 4RGOS 1TWGB 4DR7L 3EQLC 2H85A 1PH7A 2Q8RE 3NWSA 1STAA 3GTMB 1ZEQX 1QYPA 1FJGL 1RD9D 3DWAA 4DK0A 3BZCA 1H9JA 4CDFC 2KA7A 3CCRA 5FLMI 1BXTA 1C9OA 4OIJA 2JA5I 4KHPL 4A3DG 2VUMI 4RH6A 1O80A 4LF6L 3BZKA 2JMOA 1KRLA 4RGMA 3MXNA 5C4XG 5IYDH 3NPPA 1TIID 5IGBA 2EDGA 5C4XB 5LMNQ 1K9MC 1MSGA 4MZ9A 5M5WH 4HCSA 3DWPA 1SDFA 2JP1A 1R9TI 1EEFD 2PW7A 4MTNA 4F8MA 1KNEA 1A3UA 1XMQL 5J39A 1BCPD 2K01A 2F0QA 2A6HC 1EWHA 5A2QL 1J5EQ 3CC7A 1YIJZ 2N8NA 1CQVA 1Q822 4BXXG 3TP8A 3I4OA 2VPZA 3RN2A 3BZDB 3GD7A 1TR5A 5C0XH 2RKSA 4KN7C 3UDFA 3PIPA 1CKMA 3J81b 4Y7NH 3AB9A 2WAQB 4DV3Q 4I65A 2X69A 4CJ2C 2JIOA 3DHQA 2M2LA 1IKMA 4QTUA 2OTLA 1G2TA 2NZ1D 1I4GA 3T1HQ 1FVIA 3S1NB 3FDTA 2F3IA 2XN9C 1I5FA 1TWAH 1GHJA 4A3EG 3CD61 4OWXB 4DR3Q 5CV9A 4NBAA 1TFIA 4A3EB 2K28A 5T1GA 3OHXC 1IBLQ 4NBDA 1C8CA 2D0PA 3A8IE 3UDXA 1KC82 2K5RA 1HZ9A 1D1KA 3KDFA 1QNKA 1Q7YC 2WAQA 4G4KA 5FJ8G 1WTOA 2NVQH 3CMAA 1QUQA 1LTAD 2E76C 2IX0A 3G4S1 5BR8Q 3PO2I 4HTHA 3ZYYX 4DN4M 1J5EL 1WCMG 1GHKA 1EQTA 1AW7A 2LXKA 1LTGD 5CORA 2HUGA 3HOYG 1MBYA 4U673 5IT9c 4CL1A 5I9OA 2OQ0A 5M5YB 1PRTB 5C4ZA 3HOYB 2Z6BA 4DQYB 1K83H 5D1PA 1S40A 3M7GA 1YNND 1HTPA 3HKSA 3K7UC 2K33A 1I94L 3CCE1 1P8LA 1VQKA 2F4VQ 4WORA 3MAQA 3ULLA 1BCPF 3K7AH 3J7A5 1NMFA 3AFQA 1ZB9A 3GTLB 1CTMA 2K5VA 1LV9A 2ZM6L 1KIXA 1PH2A 4V0BA 2LMCB 3W5OA 1RO4A 5BN4A 1EYCA 3T1HL 4K6DA 5GAEC 3S2HB 3GTKH 2QF7A 2QRCB 4OX9Q 1IW7D 3IL8A 1B4OA 1YBYA 2PPBC 5A2Qb 2OOYB 4DR3L 2LFUA 2A69D 1VQBA 3SK4A 1FNUA 4O42A 3IAYA 2A68D 5IT9L 1JE4A 2VQEL 2EYFA 2AQ1B 3ESWA 2AKWB 2PZUA 2RBMA 1EOVA 1YHQ1 4LW1A 1SYEA 1B8AA 2JIRA 1G2SA 3D3RA 4IPGA 5C0XI 4IURA 2YU9B 5LMNW 2V8JA 1FYCA 2Z0SA 5C6AA 1HNXQ 2E2HB 4KTAA 3NH8A 4Y7NI 1YJNA 1L0YB 4MONA 4OO1H 3HOUH 5K5PA 1QE6A 2F4VL 1L0XB 4O1NA 3CCRZ 1PRTD 2F0WA 3UI2A 1HPCA 2NVTH 2JIQA 3ERSX 3X3MA 5IYCG 3NTHA 4LF4Q 4IPHA 4LF8Q 1VF5C 1VQ41 1UUPA 3B6YA 3TZDA 4DAMA 3RN5A 2RCNA 1DOMA 2G9DA 1TWAI 2FJ2A 3CCJA 2HIVA 2L0CA 3QB3A 3T4AC 1CT1D 3PIOA 2GU2A 3ULJA 2E9HA 4C2MH 3K5OA 3VR5A 3GTOH 4G57A 5E4XA 1N34Q 4EQNA 1PDQA 4PZ8A 3C1EA 1VQ91 1B3QA 2B63H 4JI4L 1IBML 1WIIA 2NVQI 4QGUA 4HJAA 4DV6L 1LACA 4O0AA 2VB3X 2FHTA 3L0OA 2PCFB 2CW0C 1Y1WB 4B9XA 5I9PA 1YNXA 1XPRA 2F1MA 4A3IG 1EIHA 3OOCA 1QF8A 4K8JA 3BVGA 1W6JA 1HTLD 3E5SA 1K83I 1PZKD 5HY6A 1ZYRD 1PFTA 1PZJD 1YI2Z 1N32Q 4A3GH 2WKCA 1HNXL 4S3SA 4AYBE 1KLUD 1HZBA 5EPJA 1I50B 5T67A 1CM9A 4OGQC 1L1OB 3K7AI 4ZCKA 2QEJC 4KKTA 4X66Q 4MD9A 1KRSA 3MXUA 1RLYA 3TQYA 3MVVA 5ISRA 4YCUA 1ESFA 3I07A 3H3VC 1QWYA 3D2LA 4GN5A 4LF4L 4C3HH 2OTLZ 1VQ81 5FLXc 2JK8A 2K5HA 2ZXPA 3GTKI 1VQ61 1XX8A 1LTSD 4KHVA 4RA8A 1EY0A 3WOFA 3HOWG 3NFZA 1YIJ1 5IT9b 3H3VJ 1UNSA 4CKCA 3BDCA 3MZKB 4DUZQ 1LT6D 1ENFA 4A75A 4DPGA 4DUYL 1KQSY 4ILWA 4IN3A 2R6MA 1N34L 1OO9B 2AQ2B 2PW5A 1NJI2 3FQQA 2Z6KC 1QVGY 4X64Q 1KQSA 5ELDA 2OOXB 2QLVB 1SYGA 3UE1A 1HZAA 1L1OA 1HA5A 1PRTF 1SBBB 3U58A 3CMAZ 1QVGA 1SSOA 2K5WA 5IGDA 3J7ZC 1JC7A 4GN4B 2F03A 4XQNA 4GKKQ 1GUTA 3GTJH 3A56A 1EOTA 4UDUC 2R7ZB 4XQQA 1SNQA 3DWQA 2NVYB 4NKLA 4DR2L 2QREB 3EBEA 3I72A 3J81j 1N32L 3E6ZX 4OO1I 3HOUI 1F2LA 4QJFA 2IX1A 3CCS1 3CCVA 1I3QH 3PO3S 3F3PC 2NVTI 2J0TD 3JAME 3S17H 1M901 5IYBH 1Q46A 3T53B 4A3FI 1LTRD 1NAPA 4JYAQ 1JJ2Y 5D3IB 3SEBA 4MD7A 2BOSA 2KOLA 3C46A 3MHBA 2BE5C 1K8A1 2F0EA 4BY7H 1JJ2A 1EIYB 1GUSA 1L2FA 4IALA 3HOVB 3GTOI 2JA8B 4PZ6A 3JAMf 1BF4A 5E4WC 4POFA 2B63I 1E7ZA 1KHIA 4IPCA 2I46A 1QCBD 3TS2A 1BKBA 2EY1A 2F0OA 3HKZE 5LL6X 1U0LA 1L0WA 3HOZH 1CSQA 5IP9H 1CFMA 1MD2D 2DE5A 4OWWB 1STGA 3ITPA 2E2JH 5EBDA 3KIFA 1DYQA 1Y1VG 3BG3A 3I55Z 4N8X1 1Q16A 3A54A 3DEPA 1WVLA 5JAVA 4GKKL 4H02A 1GUNA 3E9IA 1KRTA 4IUQA 1XMOQ 3GTQB 1FGUA 1KAAA 3EVQA 3CC4A 1VQFA 1K3RA 5CGKA 3Q22A 2O2LD 3S16H 4U68A 1G51A 1OXTA 4RG1A 3SGIA 4B3RQ 4DNIA 4B3SQ 3VR3A 3L2PA 4DR1Q 1GJXA 5DM63 3G71Z 1E3PA 3T13A 1AFPA 5IGEA 1CHQD 4DV4Q 4LFCQ 5LL6f 2XWBB 3CQZH 2Z4IA 4FXGC 3D6WA 1TWFB 4YWKA 2O5JC 4IJLA 4DKAC 2AYDA 2KPIA 2IZ3A 4A3MB 1JWHC 2F52A 2F0DA 2IW3A 2F0NA 5C3XA 3GTGB 1K9M2 5JVG3 3P20A 2PI2A 1IYUA 2DNCA 4WJ3M 4JW0A 1D1IA 3CCR1 4KLKA 3AU7A 3J80L 2VW9A 1TXYA 2ZT9C 5KNBA 3K5MA 3S1MB 1VQMZ 2K03A 3PUVA 1YHQA 3GTJI 4ZQ3A 4XX2A 4JI8Q 2EY5A 3BG1B 5E7NA 3ONAB 2PMZE 4LF9Q 3BJUA 1BDOA 2Z9HA 1I3QI 5JOBA 1XMOL 1ILPA 2HCCA 3S17I 2QDLA 1J8IA 3OWEB 3H15A 4AYBG 1JJGA 2MO0A 4AYBB 1D7QA 2K75A 1Z7TA 5KYLA 2F4MA 1KL9A 1TWGH 4B3SL 4CBVA 2NN6H 3T16A 2EVBA 4BY7I 4YHHL 3GTMH 1PA6A 3CXCZ 1ML0D 2K5QA 1KD1C 3CC71 1QG7A 3MTSA 1EQVA 2K52A 4LFCL 3VA5A 1N2FA 4DV4L 1M90C 2M9VA 2XSCA 1XTDA 1EU4A 3R3OA 5I2XA 2DNEA 4CDDC 3U9OA 3KYHC 5CBEE 3J7AF 1HJPA 4HIMA 1CHPD 2K7VA 1YI21 3HOZI 1H9RA 2K1BA 4K14A 2A8VA 4FYDA 2EOTA 2L15A 3BS1A 4KY7A 5IP9I 2C9OA 1VQNA 3FKIG 3MEHA 3A5UA 2GTIA 3FKIB 4MNOA 1SJED 1XXGA 2E2JI 3O13A 1UE6A 4JPBW 2OF1A 5C4XH 4K5WA 4O2DA 1Q7Y2 2HQLA 3OYYA 2OTL1 1VQAA 1D5XC 2R6GA 5IODA 1PH6A 4RCOA 2DY8A 2KENA 3S16I 4MD8A 4JBKA 4DNTB 3RZOB 4LFBL 1PYSB 1AZPA 4DAVA 1P16A 2PQEA 1IBKQ 3CMA1 1H9MA 3CQZI 3SK8A 5C44B 1HHVA 4BBRG 2YADA 1JJ2Z 3MWYW 2NB0A 4E2WA 3BYTB 4L8JA 2I3CA 2F0MA 3GTPB 4OXPA 4ZUIA 3M85A 3CPWY 5ELFA 2EYMA 2WB1A 3M4OB 1ONLA 5I6WA 2D9UA 3OSOA 4HAEA 2LIYA 1VQK1 3AFPA 3DM1A 3CPWA 3S1NH 2EXDA 1CKOA 1QB5D 5KIXA 5J22A 3HKZB 4K0KQ 1A15A 4RVDA 1RHPA 2H4OA 1TWHB 4ZYSA 4JC0A 4IFDH 2D62A 3BVZA 5GQOA 1VLAA 1QXFA 4A3EH 2L4NA 2GN5A 1BCPC 1UAPA 3P7JA 4ABNA 2I07B 1TS5A 5GADC 5EJWA 4ZKBB 4XYQA 4E32A 3T4NB 3BU2A 3V2TA 2Q2HA 5D65A 1DM0B 3HP3A 2QRDB 2F0FA 3WWVA 5K36G 2I5HA 5FJ8H 1VQOZ 4P73A 3NQTA 1TWGI 2GVAA 1QOHA 2NN6I 1X3WA 3GTMI 5M5YH 4NBBA 3HOYH 1IBKL 1K0SA 4IO9A 1Q90A 4GKJQ 1TWCB 5IP7H 5JEAJ 5E1FA 4GNXA 4NXMQ 3HOXG 4KN4C 3I551 3KLSA 4DXGA 1SLJA 3GTLH 2CHBD 3FRPB 4DGLA 3OMGA 1D8LA 1FJGQ 1YJN1 2OTJA 3RZDB 4DV2Q 5KYIA 3U4ZA 2QKIC 3A8JE 3IF8A 1YNJC 4FXKC 3S2HH 2QCPX 2NZOA 1PH4A 5M3FG 2OCEA 1B1ZA 1I6VC 3CAMA 3IKJA 5M3FB 2K32A 1DOKA 3J81L 4PMBA 1ET9A 1VQHA 2CQAA 2N78A 3VMGA 3CCJ1 3PV0A 1X9NA 4KK7A 2ZTDA 1GD7A 4A76A 2PMZB 1S72Z 1TY0A 4NH1C 3KJPA 5A35A 2B2YA 2K5NA 3NELA 1XMQQ 1VQCA 4CDCC 1XJVA 1NSNS 1RKNA 2YU9H 4R4CA 2IT1A 2C5CA 2E2HH 3URYA 3GCFA 2KBNA 4RWSC 4HJ8A 3TREA 4YY3Q 4Q0FA 2Q2IA 4C3JG 2K14A 1H9KA 1CKNB 4NXML 3VYRA 1HR0Q 1JOQA 4NBHA 4G7HC 2E8GA 5JPMC 2HDLA 5GAHC 2ZJQA 4DK3C 2VF1A 3S1NI 5IYCH 1VQNZ 3IX0A 1BUVT 1SNPA 4DXFA 4DV2L 4QCLA 4IFDI 3CHBD 3MZ5A 4A3EI 2A69C 3KOJA 1A3TA 2JA9A 4YCWA 3HS0C 4HIOA 4PQXA 4H7BA 1QZGA 4GLVB 4A3DB 1V9PA 2F0LA 4A3KG 4A3CG 1SNDA 3Q6SA 4A3KB 1PTOB 4IUNA 1IXRA 1KDCA 1M1K1 3U9SA 5C4JB 1JMCA 2JNYA 3JAMi 1HQMC 2B2WA 1Y1WH 1Q8KA 3KBGA 1TQOA 2N55A 5C5LA 4EQ5A 1EQQA 2CQOA 3HOYI 3I4MG 1H9SB 2RDFA 1SMYD 3KK7A 1B9MA 4FNFA 3I4MB 5C4HA 4DV1Q 1IYJB 3A74A 5IP7I 4K2LA 3FVQA 4P74A 5FO7B 4KI0A 1I50H 1TS2A 2PNRC 1HFGA 3KIHA 1W6KA 4YY3L 3GTLI 4N9TA 1GUOA 4RHRA 1RO2A 1WOCA 1TT2A 1HR0L 5HURA 5H1SE 2ZTCA 4A3JG 1MJEA 1YI2A 4OWTB 2R7FA 2NYZD 2UU9Q 1LTLA 4A3JB 1I94Q 4EQPA 1EIGA 1JWSD 2JR6A 4N8FA 3CCV1 3S2HI 3NEMA 1KDAA 4BBSG 5IGFA 3CPWZ 2ID0A 1QVFY 4BBSB 5C3EG 4J8QA 2IY5B 1K28A 1HQRD 2ZM6Q 5C3EB 4KKUA 3KLRA 4HMJA 1QVFA 1LT5D 2QA4Z 3CMEZ 1O7YA 2EYOA 2IJ0A 3PMFA 4RAUC 2R93G 5KEEA 2R93B 2KHJA 4IUVA 1XPOA 3PUWA 4NP5A 1NNXA 4A3BG 4A93G 4JI0L 2YYZA 3A5ZB 3KJOA 4JCVE 1B44D 4A93B 1S3OA 2PZWA 1D2BA 1PTOD 4XXEA 2YU9I 2RF4A 1M4VA 2E2DC 2WFWA 2E2HI 1FL0A 1RTNA 2VQEQ 2JA6G 2R7ZH 1JR0D 2V8IA 2NVYH 2XNAC 2JA6B 1I4PA 2X6GA 1CK1A 4DV1L 3EJIA 1EY4A 2C35B 2AWNA 4PZ7A 1R4QB 4MN3A 2FMCA 1WCMB 1PH3A 1UWVA 2RIQA 1EWCA 4HJ5A 1LTTD 2VUMG 4DFAA 1X3EA 1SJHD 3E0JA 1QVCA 2UU9L 4RS4A 2OTJZ 3C1FA 2L11A 3CC41 1KDBA 3OPOA 4ME5A 5E3FA 1B53A 2VL6A 2UUCL 2KCCA 2HHHQ 3IRBA 4EX5A 3HOVH 2JA8H 5M3MG 4GN3B 2F0GA 1WTPA 3WDNA 5M3MB 2O4XA 1HNWQ 4X6AH 1HR0W 3D8GA 3MFYA 3H91A 1RL2A 3CPFA 1Y1WI 4X3KA 1LLRD 1LYLA 4JOIA 4KJOA 3MEFA 1Q861 1YITA 3R8BA 1SYDA 3NE5B 4JI4Q 1IBMQ 1K3BC 2K50A 4DV6Q 2MGSA 4NOZA 3OTOQ 1M1KC 1I50I 3GTQH 2EIFA 2JE6I 4CHTB 2PNHA 1MKHA 2K5DA 3I91A 4GOPC 4QY7A 2PO4A 3CCMZ 3VYSA 3I55A 1XWEA 3I4LA 1UEBA 4RGTA 5TSSA 1SFOB 1KD12 1WJJA 2RDHA 1M902 3R2TA 5C5MA 1EIFA 4X3SA 1LABA 4F7XA 2XVSA 1IZ6A 2UXBL 1PTOF 2HHHL 2LEXA 1TWFH 3AQQA 2RSNA 5C0XJ 1CA6A 4EGVA 1SE8A 3G71A 3Q23A 4A3MH 2QR1B 4RVFA 3M3YB 1EZ8A 4L6TB 1STYA 2B39A 2SNMA 1HNWL 3CRLC 4K6LA 3GTGH 4R8NA 5M5XB 3EROA 3I73A 4DUYQ 1WW9A 3F2CA 3LWEA 2DE6A 3S1MH 3J7AV 4BA1I 2R7ZI 2EYJA 3H6MA 3Q8DA 3ND8A 2NVYI 1VQN1 2QGQA 3FEWX 3T51B 4C3IG 3CKIB 3IFDA 3OTOL 4C3IB 3H09A 3PCOB 2RCFA 4RMFA 4RVGA 2B2TC 4DK1A 1YEZA 1VQMA 1G6PA 1RODA 2F0PA 2CH4A 1N36L 4A3IB 3KF8B 2NVXB 4NB8A 4DR2Q 2L5TA 3DMUA 1X3FA 1GO3E 3UDGA 1HXYD 4C1NK 1GKHA 1O7IA 2DY7A 1Z02A 2B2VA 3HOVI 2WIIB 4NMZA 2JA8I 4NBEA 1NCVA 1EU3A 1STNA 2RHQB 3TRZA 3PF4A 1IYVA 3CXCY 1D5MC 1TU2B 1QVFZ 3BDOA 4X6AI 4QL5A 5M9OA 4HR7B 2ATWA 4ZAIA 1I4HA 2CVRA 4J1MA 1VQ5Z 3CXCA 4K2KA 2H5XA 2Z1CA 1HZCA 4IUTA 3G6EA 1XYIA 3I2ZA 4OELB 3HOWB 3FKIH 4JBJA 5ELBA 2P3YA 4PG3A 5FK9C 3RD4A 2OZKA 3GKQA 1CSPA 1KTKA 3GTQI 1BBWA 3L7ZC 3VYUA 2F3WA 4YWLA 5J3BA 3A7AB 1I4QA 3VYTA 3QIAA 1Q86C 1M8AA 5AFWA 4BS9A 4ID6A 1WTRA 1T5XD 1A8VA 1X55A 5CBAE 1NUCA 2F4OA 4CJ1B 5JPNC 4H44C 3RZOH 4JBMA 1Z47A 1U4RA 1PH5A 3J80E 5FLXL 3N6RA 1DD2A 5C44H 1EYDA 1TWFI 3VMIA 2VY3A 1Y69U 2M48A 4LAAA 4A3MI 2EY2A 4E30A 1U4MA 4R9WA 2NTTA 4UPAA 1YVCA 2L9HA 1E2ZA 1VQPZ 3GTPH 3TDHB 3GTGI 1UE1A 3J80f 3M4OH 3BG0B 2GVBA 2EJGC 1CUKA 2MJ8A 3NDIA 1A62A 2BDNA 3LNNA 2EYHA 4GLAC 4H13C 1G91A 1YITZ 1HFNA 3S1MI 2YV5A 2CCZA 3A7LA 2JN4A 2I0QA 4B9WA 1XNRL 1TWHH 5BN3A 2KEEA 2RVLA 4JI3L 4TVAB 2A73B 3RNUA 3S1RB 4EWCA 2OTJ1 1EL0A 3GQBA 2Y0SE 3ZJYC 2PYKA 4HMIA 1F9QA 2DN8A 2AWOA 3F3FC 4PMCA 4P75A 2AUJD 1N9WA 5DEHA 4QUCA 4DV7L 1F77A 5EBCA 1Q811 5K36H 1Y1VB 4A3GI 2SDFA 4YWMA 3TSSA 4Q5VA 1WFQA 1ASZA 1LT3D 3FP9A 4TQUS 4ZLTF 2PZTA 2PM9A 2ENBA 2K3RA 5IE8A 3S2DB 2KHSA 4R4TA 4NFRA 3OIQA 1TWCH 3DM3A 1PXUA 1F9PA 1VQOA 4MTKA 1NUIA 1HRJA 4X65Q 2AMCB 4HSVA 1SYCA 3CCQA 1K0RA 3OW7A 4YHHQ 4LK1C 1N33Q 3D4WA 4KY5A 1S5CD 3FKII 3RZDH 3I7FA 4BA2I 2D5DA 3JC66 2CW0D 1AEXA 4Z9CB 2BDOA 3GTMS 4TKOB 3JAMc 4HGZA 3TN2A 3LGJA 5M3FH 2L55A 3X3NA 1TS3A 1WD1A 3HOUG 2QDBA 2VB2X 3BYYB 4LUVA 3RR5A 1TKWB 5FLXb 2SNSA 3PUXA 4NDXA 2MNAA 1WZNA 1F2YA 3RZOI 3SHLA 1E1OA 1JICA 4A3FG 1I6HB 3BVMA 4A3FB 1FDOA 2NWGA 5KGUA 1S4ZA 2UXCL 3QOJA 5AN9F 2CFMA 5C44I 4XT1B 1NE3A 2F0SA 1S72A 4L5SA 1PH1A 1N8R1 1Z03A 1X3QA 4JI5L 4LFBQ 3TP5A 2B63G 2EXZA 4XYOA 3GTPI 1U4PA 1PLFA 4X65L 2A1AA 3NH5A 1ICFB 4KKSA 3M4OI 1S5FD 3NK9A 3KUPA 3N52A 1N33L 2QKDA 2JIPA 3NXWA 3EA6A 1G8ZD 1BVSA 2QEXZ 2VPYA 1JE5A 3G6EZ 4V190 2EYPA 1CZGA 3FPPA 1TWHI 1NP6A 4X3UA 2XRSD 2LY7A 5EAYA 2B8FA 4QB4A 2P28A 4QQBX 3P1HA 4DGZA 3GP7A 3LX0A 4ZKCB 4WFN3 4RGNA 1ESRA 1SNCA 5CR3A 1K8AC 1DXMA 4A3DH 3V05A 3UDIA 4GNXC 4A3KH 1PTOH 3DEOA 4A3CH 4AYBA 1EY6A 2XWJB 2Q8TA 5C4JH 1AN8A 4R4IA 5AJ3Q 1ICWA 3E9HA 3F2DA 4JI7Q 2BH8A 3MC0B 5HGTA 1VQ51 2LS01 2EJFC 3QWNA 4CJ0B 2EZVA 1EY8A 3I4MH 1TWCI 3CCUA 1SE4A 3K58A 3NQIA 3J81E 3K5LA 1JWMD 1TVXA 4FF3A 4DAYB 3FPUB 3AEVA 4BXXH 1OXXK 1ZKOA 2G9HD 4ULLA 3RZDI 2K4KA 3QJYA 4BWGB 1KABA 2WB1G 4A3JH 2CKZB 5FO8B 5F2DA 2Q2TA 4BBRB 2V3VA 3NDJA 2B2YC 3J81f 5IWAQ 4BBSH 5T1IA 1BR9A 5C3EH 2IHFA 4EQOA 4RKBA 4JBWA 2A6ED 3W1GA 1HA6A 1V1PB 1E1TA 4CKEA 1NR4A 1U5KA 2R93H 1MSHA 1VS0A 1Q12A 4QIWE 3S15B 2VQFL 5EKLA 1II3A 2Y0SG 3TEHB 5IYBG 1XNQL 2Y0SB 5EKIA 5FOBB 4A93H 3CD6Z 5AJ3L 2VNUD 2QA4A 1GXDC 2F0UA 1VQP1 3CMEA 5IIFA 1M1K2 4JI7L 3I56Z 3G6JB 4IOCA 4BY7G 2JA7G 2W04A 1YJ9A 3D4RA 1R4PB 3TS0A 2QILA 5CMDA 2JA7B 1YJWZ 2JA6H 2RPRA 1YIT1 3H94A 2QW7A 4L63B 1XTCD 4R1JA 5BN5A 3G4SZ 1STBA 1B2TA 1WCMH 1V1PA 2KUMA 2NTSA 3CCQZ 4P71A 3HOZG 2E2IB 2Z8LA 1D5ZC 4X62L 2LKVA 2WINB 3HKZA 1F2MA 1EFID 2B2WC 5I2YA 1N8RC 1E2VA 1DL6A 3I4NG 3ERQA 2Z4HA 1AP0A 4ZK9B 1FD7D 1USPB 3CCEZ 1CQFA 1MJCA 3I4NB 3PO3G 2TSSA 5IGGA 5IWAL 4HJ9A 3T56B 3HOXB 1DOLA 2UUBQ 3PO3B 4OEMB 5A2QE 1IHZA 1V43A 4C1NI 3VR2A 3C3LA 4A3DI 5M3MH 4HEDA 3CC2A 2IX3A 1XPUA 5D1OB 1W2BZ 1STHA 4A3KI 4A3CI 3IFTA 4L5QA 2UUAL 2R3ZA 5JJIA 1VQDA 3V96A 1VMCA 5C4JI 2PQAB 5C4XI 4HCEA 3S9WA 4APVA 2IZ4A 2AKLA 1Q3LA 5ELOA 2M00A 5IGCA 4HIDA 1V8QA 2HQEA 5A2Qf 3W2DA 3G711 5DLQE 4NBCA 1IKLA 1Q1BA 5ELNA 1HNZL 1EWIA 5EPLA 3I4MI 2UXDQ 2EQSA 2I5MX 3SDZA 2F0TA 1VF7A 1EYGA 5KNCA 1IL8A 3OWFA 2MQHA 4HN7A 4TSSA 1AE2A 2ICIA 3STBD 4BXXI 4FDBA 5D1OA 4OHJA 4UY8C 1YNNC 3VB9A 1GOZA 4A3JI 4C56C 1F9RA 1FDIA 2R92G 1SFOH 2R92B 2BJOA 3KLWA 5JJKA 3F2BA 3IFUA 4BBSI 1BCPB 1DGSA 1VQM1 1JWUD 1B50A 3PF5A 3CCMA 4C3JB 5C3EI 1RF2D 1K731 3LWUA 4DR6L 3NBIA 4E2ZA 3PUYA 4PV1C 4UP9A 4P2CB 2UUBL 2RBLA 3H0GG 5ELCA 1HUMA 3QG1A 1BBXC 2L1BA 3H0GB 2PMZA 3M3YH 1IW7C 1P9NA 1VQ4Z 5CV5A 3MA2B 1VQIA 4K5XA 4KD4A 5JEAG 4RVHA 2GA4B 1ZXTA 2TMPA 5M5XH 4A93I 3MXNB 1K8MA 3SE0A 1OXVA 2IPKD 1K8OA 2EY6A 1W3SA 3TP7A 3W1BA 2A68C 1J6QA 5EQ0A 4FF4A 3J80i 1E22A 1PFMA 1Q862 3AYHB 5FKAC 4HH4A 1VQ9Z 1SROA 3OW2Y 2QEX1 2JA6I 2DGYA 1X3PA 1MI2A 3G6E1 4JI0Q 2UXDL 4K5VA 2EE1A 1CKNA 5T64A 4C3IH 3CCUZ 3ND9A 2F0KA 3OW2A 1EYAA 4IFDJ 1WCMI 1YHBA 1RQFA 5LMUL 1GUWA 1Z01A 1JOKA 2YTVA 3E0EA 1VQ7Z 2E74C 2KCNA 2IV2X 2A74C 2M6NA 4A3IH 3S1QB 2NVXH 3T1YQ 1DONA 4JI6Q 1YHAA 4JOIC 4JI1Q 2B2UA 4BY1G 4IOAA 3S14B 1PRTC 4N9PA 4BY1B 4YCVA 3P5JB 3A55A 3NP8A 5IT9E 3K0XA 2IL8A 5FO9B 2ES2A 4A3LG 2DJFC 4PNYA 3RLFA 2HU9A 4DK6C 1OXUA 2UUCQ 4KV6A 1RNIA 1U4LA 4IPDA 1VQ8Z 1PYWD 1VQ6Z 3J7A4 1AE3A 3HOWH 5IT9f 3NENA 1H9SA 4AQYQ 3LUSA 4QIWB 1VMPA 4DU9A 3I90A 4MH4A 4RV9A 1CZWA 1VQ5A 1X56A 3K81C 4QUFA 2D0OA 2G5DA 1YJ9Z 4RKLA 1WYDA 2WAQG 2VPXA 3KDFB 1C7YA 4A3BB 1A2UA 3VMHA 4E31A 1WI5A 2RDGA 3C2PA 1CI3M 1QUQB 4LFAQ 1ZYRC 1A2TA 3CCLA 1SFOI 2DUDA 2E7ZA 1RIPA 2N49A 3T1YL 2JEBI 1ENCA 4JI6L 4JI1L 1SYBA 4IFDG 4XQJA 1GM5A 3CCSZ 1Y1VS 5FLMG 2EJMA 1JCKB 3MXGA 3GDEA 2JA5G 3Q24A 1YNJD 5LMNL 4JVZA 5JVH3 3I561 2JA5B 2AQ3B 1WTHA 2FFKB 2VUMB 3M3YI 3CC2Z 3R2IA 3TP6A 2UXBQ 1YJW1 1O7LA 3M4PA 3AMUA 1VQO1 1EY9A 4A4IA 1K73C 2RHBA 1JJCB 3PGZA 3CCQ1 1AH9A 1VQPA 2B3GA 1R9TB 4AQYL 2B2VC 4K8IA 4HSPA 3S1RH 4GS3A 5G3LD 3EIVA 4CGYB 5D14A 2MPMA 5IP7G
chains in the Genus database with same CATH topology
4F87A 5EKKA 3OMCA 2OEOA 4A3II 2NVXI 2L12A 1YUKA 4XIGS 1E0BA 1RDPD 4EVOA 1Q1EA 3Q0AA 3R93A 4FF2A 4E2XA 3D9XA 4KHZA 1RO0A 1L1OC 1S5BD 5DNFA 3HG9A 2W03A 5CM2M 1ML8A 2F3VA 1S721 2O5IC 5DAUA 3HOWI 4GZYC 1SXTA 3NUCA 4NBFA 1LTID 4ZRZA 1K8A2 4MXUA 2MP1A 1WTWA 3NH4A 3NBHA 4RHSA 5FLXE 1F9SA 4ODGA 3EEDA 1BNZA 2K04A 2NBFA 2WKDA 3VTNA 1QJOA 1Q821 1A3VA 1O7ZA 2JXMB 2A6HD 3SXHA 1WTXA 3BDLA 3PO2B 1CA5A 3OW2Z 4DNRB 2MUYA 3K6OA 4XDXA 5FLXf 4FXDA 2RT9A 1S7MA 2J6AA 3RMHA 4NB9A 3CU7A 1Q812 4DF7A 4LJZC 1T5EA 1SAPA 1V1OA 1STEA 2B8GA 5G3LF 2E75C 2XRQD 1J9OA 2RSOA 2F4IA 3SVMA 1YUAA 3NTIA 4IQZA 3CCU1 4XT3B 3L9AX 4IZ8A 3QWUA 3EERA 1KC81 5M5WB 1VQ71 3CC7Z 3I70A 1JQYD 4M1UB 3FQMA 4QMGA 1F2ZA 3HGBA 3S1RI 3W3AA 2X6LA 3U50C 2O4HA 4G7OC 2PK7A 1S5DD 5J1ZA 3MZLB 1GUGA 3KF8A 2H1EA 3M7NA 3FMCA 2BA1A 4Y52I 5C0XG 1Y1VI 4E2YA 2BA0A 4XTCS 1Y8OB 3CCLZ 1O78A 5CV7A 4FO2A 1FNVA 2VXWA 4DAPA 4Y7NB 4MIUA 4M8AA 3S2DI 5COYA 1DJRD 3DUZA 1MGSA 1JOOA 1Z6HA 1QNUA 3M4YA 2QA41 3CME1 1ENAA 4S1TA 5CYUA 1WTVA 2V8KA 1N8R2 1YJ91 3SK6A 3TMEA 1D6EC 1TWAB 3K59A 3GV6A 3TZUA 5LL6S 2KQ3A 4FVMA 2JUBA 5I6YA 5NUCA 3MXPA 4QF4A 2RQXA 2NVQB 4YIJA 1UEAB 4FP5D 3HEJA 1TY2A 1VQKZ 3Q87A 4CKBA 3K0YA 1KD11 1SEBD 2F0HA 2KECA 4R8IA 3SK5A 5JJZA 4LMQD 1I6HI 3CC21 2FMMA 5EGTA 1K83B 1S5ED 3KLSX 3WOEA 3D4DA 5IOCA 3GV3A 1TS4A 1BOSA 3K7AB 1Q8IA 3EFXD 5CV4A 1DZ1A 1X0TA 4IUPA 2B2TA 4J6HA 4KJNA 3GTKB 3G7LA 5EPKA 2F0IA 2A6EC 4I7ZC 4RFBA 5DM73 4NW2A 1JB3A 3J7YW 1LQLA 2KVMA 1A6XA 2JEAI 4WRDA 1PFBA 1YJNZ 3SR1A 3CCM1 3NWTA 1W2BY 2JS4A 1EEID 2EGTA 5D3DA 1X32A 1BO0A 3CRKC 3KBXA 1KLGD 4OO1G 4JK1C 1HUNA 3HOUB 3CCJZ 5ELEA 3A8KE 4KY6A 2NVTB 4KD3A 1LO5D 1SE2A 2K05A 3HZXA 2BCOA 2J4XA 4QTTA 2K6AA 3GO5A 4BBRI 1G6ZA 1ILQA 4C2MB 1VQLZ 2O53A 1NJI1 1RCVD 3GTOB 1FGBD 2KJXA 2B63B 2ZXRA 3RUZA 2HF1A 3JAML 1SYFA 2Q51A 3S15I 4KMUC 2HDMA 3F2UA 5JEAH 1WD0A 1HCZA 2WACA 4A3GB 4NBGA 1SNMA 3P75A 3K57A 1KNAA 2JA7I 3QOLA 4HGYA 1ZB8A 1PFNA 4FF1A 4C3HG 3PUZA 5LHY1 4C3HB 2E2II 2KI7B 2OXPA 1C48A 3MFGA 2Q8IB 3OIPA 1KQSZ 1LTBD 2JYOA 2BE5D 3I4NI 3MONA 4TNUA 1QVGZ 3D6CA 3HOXI 2G2KA 3PO3I 2MHVA 3CCL1 1JORA 2Q4ZA 1AZQA 4WJWA 4X3TA 5CC4A 5CV6A 1K732 2RA4A 3PIP3 2WB1B 3QO2A 5KNDA 4RCNA 3CCVZ 3I3CA 3GTJB 2IWHA 1FNWA 2R61A 1I3QB 2FINB 3L3OC 4IUUA 1FR3A 3S17B 1G291 3VR6A 4DAYA 4H0LC 1Y8NB 3J80b 1U9RA 1SMYC 2V4DA 4MHEA 2JSOA 2R92I 4BY7B 3JAMb 2XIWA 2AUKA 5T6BA 1SE3A 3HRZC 1B3AA 2HCIA 1K9M1 1C4QA 1PMRA 2J7ZA 3HOZB 2N88A 3H0GI 1E2WA 1VDZA 2Y0SA 2DE7A 3CC4Z 1I4RA 4E6IA 3VA7A 4ZUJA 3DXJC 4F88A 2ZXOA 2E2JB 2F0VA 1WTQA 4B08A 3TBIB 3NTKA 1X3ZA 2VUGA 2B2UC 4OIKA 1NR2A 1OXSC 2WV6D 2KEDA 2NUCA 2OT2A 3S16B 3I8ZA 1RTOA 1BQQT 1EZ6A 1PTOC 1Y8PB 4PMWA 5CV8A 2EYLA 3VR4A 3S1QI 2WP8J 2A5HA 1B9NA 2LFNA 1EY5A 1USPA 3CQZB 3S14I 4DA2A 2ZAEB 4TRDA 4BY1I 4E33A 1EY7A 3TE5B 4MRIA 1LT4D 5KRUA 1SNOA 3TDQA 1YHQZ 2F0JA 4G7ZC 4A3LI 4UAIA 1QILA 1Q7Y1 2SEBD 1ET6A 2ICEC 5C3WA 5I4DA 1RJTA 3D31A 1I4XA 1DCZA 2R93I 2EPBA 1ZH1A 2SOBA 3K5NA 3NSWA 1PZID 1VQL1 4A3BI 4OL7A 3PIO3 2D2CC 2GTHA 2NN6G 3NHHA 1VCIA 4RGOS 1TWGB 3EQLC 2H85A 2Q8RE 3NWSA 1STAA 3GTMB 1ZEQX 1QYPA 1RD9D 3DWAA 4DK0A 1H9JA 2KA7A 5FLMI 1BXTA 4OIJA 2JA5I 2VUMI 4RH6A 1O80A 2JMOA 1KRLA 4RGMA 3MXNA 3NPPA 1TIID 5IGBA 2EDGA 5C4XB 1MSGA 4HCSA 3DWPA 1SDFA 2JP1A 1R9TI 1EEFD 2PW7A 4F8MA 1KNEA 1A3UA 5J39A 1BCPD 2K01A 2F0QA 2A6HC 1EWHA 5A2QL 1YIJZ 1CQVA 1Q822 3TP8A 3BZDB 3GD7A 1TR5A 5C0XH 2RKSA 4KN7C 3J81b 3AB9A 2WAQB 4I65A 2X69A 4CJ2C 3DHQA 2M2LA 1IKMA 4QTUA 1G2TA 2NZ1D 1I4GA 3S1NB 3FDTA 2XN9C 1GHJA 3CD61 5CV9A 4NBAA 1TFIA 4A3EB 2K28A 5T1GA 3OHXC 4NBDA 1C8CA 3A8IE 1KC82 2K5RA 1D1KA 1QNKA 2WAQA 4G4KA 1WTOA 1LTAD 2E76C 2IX0A 3G4S1 3PO2I 4HTHA 3ZYYX 4DN4M 1GHKA 1EQTA 1AW7A 5CORA 1LTGD 2HUGA 1MBYA 4U673 4CL1A 5I9OA 5M5YB 1PRTB 5C4ZA 3HOYB 4DQYB 5D1PA 3M7GA 1YNND 1HTPA 2K33A 3CCE1 4WORA 3MAQA 1BCPF 3GTLB 1ZB9A 1CTMA 1LV9A 4V0BA 2LMCB 1RO4A 5BN4A 1EYCA 4K6DA 3S2HB 2QF7A 2QRCB 1IW7D 3IL8A 1B4OA 2PPBC 5A2Qb 2OOYB 2LFUA 2A69D 3SK4A 1FNUA 4O42A 3IAYA 2A68D 5IT9L 1JE4A 2EYFA 2AQ1B 3ESWA 2PZUA 2RBMA 1YHQ1 1SYEA 3D3RA 1G2SA 5C0XI 4IURA 2YU9B 2V8JA 1FYCA 5C6AA 2E2HB 4KTAA 3NH8A 4Y7NI 1L0YB 4MONA 4OO1H 5K5PA 1QE6A 1L0XB 4O1NA 3CCRZ 1PRTD 2F0WA 3UI2A 1HPCA 3X3MA 3NTHA 1VF5C 1VQ41 1UUPA 3TZDA 1DOMA 2G9DA 1TWAI 2FJ2A 2L0CA 3QB3A 3T4AC 1CT1D 2GU2A 2E9HA 3K5OA 3VR5A 4G57A 5E4XA 4EQNA 1PDQA 3C1EA 1VQ91 1WIIA 2NVQI 1LACA 2VB3X 2FHTA 2PCFB 2CW0C 1Y1WB 4B9XA 5I9PA 2F1MA 1EIHA 3OOCA 1QF8A 4K8JA 3BVGA 1W6JA 1HTLD 3E5SA 1K83I 1PZKD 1ZYRD 1PFTA 1PZJD 1YI2Z 2WKCA 4S3SA 1KLUD 5EPJA 1I50B 5T67A 1CM9A 4OGQC 3K7AI 2QEJC 4KKTA 3MXUA 4MD9A 1RLYA 3MVVA 5ISRA 1ESFA 3I07A 3H3VC 1QWYA 2OTLZ 1VQ81 2ZXPA 3GTKI 1VQ61 1XX8A 1LTSD 4KHVA 4RA8A 1EY0A 3WOFA 3NFZA 1YIJ1 5IT9b 3H3VJ 1UNSA 4CKCA 3BDCA 3MZKB 1LT6D 1ENFA 1KQSY 4ILWA 4IN3A 2R6MA 1OO9B 2AQ2B 2PW5A 1NJI2 3FQQA 1QVGY 5ELDA 2OOXB 2QLVB 1SYGA 1HA5A 1PRTF 1SBBB 3CMAZ 1SSOA 2K5WA 5IGDA 1JC7A 2F03A 4XQNA 1GUTA 3A56A 1EOTA 4UDUC 2R7ZB 4XQQA 1SNQA 3DWQA 2NVYB 4NKLA 2QREB 3I72A 3E6ZX 4OO1I 3HOUI 1F2LA 2IX1A 3CCS1 3PO3S 3F3PC 2NVTI 2J0TD 3JAME 1M901 3T53B 4A3FI 1LTRD 1NAPA 1JJ2Y 5D3IB 3SEBA 4MD7A 2BOSA 2KOLA 3C46A 3MHBA 2BE5C 1K8A1 2F0EA 3HOVB 1GUSA 4IALA 3GTOI 2JA8B 3JAMf 1BF4A 5E4WC 2B63I 2I46A 1QCBD 2EY1A 2F0OA 5LL6X 1CFMA 1MD2D 2DE5A 1STGA 3ITPA 5EBDA 3KIFA 1DYQA 3BG3A 3I55Z 3A54A 3DEPA 1WVLA 5JAVA 1GUNA 4IUQA 3GTQB 1KAAA 3EVQA 5CGKA 3Q22A 2O2LD 4U68A 1OXTA 3VR3A 1GJXA 5DM63 3G71Z 3T13A 1AFPA 5IGEA 1CHQD 5LL6f 2XWBB 2Z4IA 4FXGC 3D6WA 1TWFB 2O5JC 2KPIA 2IZ3A 4A3MB 1JWHC 2F0DA 2IW3A 2F0NA 5C3XA 3GTGB 1K9M2 5JVG3 3P20A 1IYUA 2DNCA 1D1IA 3CCR1 3J80L 3AU7A 2ZT9C 5KNBA 3K5MA 3S1MB 1VQMZ 2K03A 3PUVA 3GTJI 4ZQ3A 4XX2A 2EY5A 3BG1B 3ONAB 1BDOA 1I3QI 5JOBA 1ILPA 2HCCA 3S17I 1J8IA 3OWEB 4AYBB 1Z7TA 5KYLA 2F4MA 4CBVA 2NN6H 3T16A 2EVBA 4BY7I 3CXCZ 1ML0D 2K5QA 3CC71 1QG7A 3MTSA 1EQVA 3VA5A 1N2FA 2M9VA 2XSCA 3R3OA 1EU4A 5I2XA 2DNEA 3U9OA 5CBEE 3J7AF 1CHPD 2K7VA 1YI21 3HOZI 1H9RA 2K1BA 4K14A 4FYDA 2EOTA 3BS1A 4KY7A 5IP9I 2C9OA 3MEHA 2GTIA 3FKIB 1SJED 1XXGA 2E2JI 3O13A 2OF1A 4K5WA 1Q7Y2 2OTL1 1D5XC 2R6GA 5IODA 4RCOA 2DY8A 3S16I 4MD8A 4DNTB 3RZOB 1AZPA 4DAVA 2PQEA 3CMA1 1H9MA 3CQZI 3SK8A 5C44B 1HHVA 2YADA 1JJ2Z 3MWYW 2NB0A 4E2WA 3BYTB 4L8JA 2I3CA 2F0MA 3GTPB 4ZUIA 3M85A 3CPWY 5ELFA 2EYMA 2WB1A 3M4OB 1ONLA 5I6WA 2D9UA 3OSOA 4HAEA 2LIYA 1VQK1 3DM1A 1QB5D 5KIXA 5J22A 3HKZB 1A15A 4RVDA 1RHPA 2H4OA 1TWHB 4ZYSA 4IFDH 2D62A 3BVZA 1VLAA 2L4NA 1BCPC 1UAPA 3P7JA 4ABNA 2I07B 1TS5A 5EJWA 4ZKBB 4XYQA 4E32A 3T4NB 3V2TA 5D65A 1DM0B 3HP3A 2QRDB 2F0FA 5K36G 1VQOZ 3NQTA 1TWGI 1QOHA 2NN6I 1X3WA 3GTMI 4NBBA 1Q90A 1TWCB 5JEAJ 5E1FA 4KN4C 3I551 3KLSA 4DXGA 2CHBD 3FRPB 4DGLA 3OMGA 1YJN1 3RZDB 5KYIA 2QKIC 3A8JE 3IF8A 1YNJC 4FXKC 2QCPX 1B1ZA 1I6VC 3IKJA 5M3FB 2K32A 1DOKA 3J81L 4PMBA 1ET9A 2CQAA 3VMGA 3CCJ1 3PV0A 4KK7A 2PMZB 1S72Z 1TY0A 4NH1C 5A35A 2B2YA 1NSNS 1RKNA 2IT1A 2C5CA 3URYA 3GCFA 4RWSC 4Q0FA 4C3JG 1H9KA 3VYRA 1JOQA 4NBHA 4G7HC 5JPMC 2HDLA 2VF1A 3S1NI 1VQNZ 3IX0A 1BUVT 1SNPA 4DXFA 4QCLA 4IFDI 3CHBD 3MZ5A 4A3EI 2A69C 1A3TA 3HS0C 4PQXA 4H7BA 4A3DB 2F0LA 1SNDA 3Q6SA 4A3KB 1PTOB 4IUNA 3U9SA 1KDCA 1M1K1 5C4JB 2JNYA 1HQMC 2B2WA 3KBGA 1TQOA 2N55A 5C5LA 3HOYI 1H9SB 2RDFA 1SMYD 3KK7A 1B9MA 4FNFA 3I4MB 5C4HA 5IP7I 4K2LA 3FVQA 5FO7B 4KI0A 1TS2A 2PNRC 1HFGA 3KIHA 1W6KA 3GTLI 4N9TA 1GUOA 4RHRA 1RO2A 1TT2A 5HURA 2NYZD 4A3JB 4EQPA 1EIGA 1JWSD 2JR6A 3CCV1 3S2HI 1KDAA 5IGFA 3CPWZ 2ID0A 1QVFY 4BBSB 4J8QA 1HQRD 5C3EB 4KKUA 3KLRA 4HMJA 1LT5D 2QA4Z 3CMEZ 1O7YA 2EYOA 2IJ0A 3PMFA 4RAUC 5KEEA 2R93B 4IUVA 3PUWA 4NP5A 2YYZA 1B44D 4A93B 2PZWA 1D2BA 1PTOD 4XXEA 2YU9I 1M4VA 2E2DC 2E2HI 1RTNA 1JR0D 2V8IA 2XNAC 2JA6B 1I4PA 2X6GA 1CK1A 3EJIA 1EY4A 2AWNA 1R4QB 4MN3A 2FMCA 1WCMB 2RIQA 1EWCA 1LTTD 4DFAA 1SJHD 3E0JA 4RS4A 2OTJZ 3C1FA 2L11A 3CC41 1KDBA 3OPOA 4ME5A 5E3FA 1B53A 2KCCA 2F0GA 1WTPA 3WDNA 5M3MB 2O4XA 3D8GA 3MFYA 3H91A 1Y1WI 4X3KA 1LLRD 4KJOA 1Q861 3R8BA 1SYDA 3NE5B 2MGSA 4NOZA 1I50I 2JE6I 4CHTB 2K5DA 3I91A 2PO4A 3CCMZ 3VYSA 1XWEA 3I4LA 4RGTA 5TSSA 1SFOB 1KD12 2RDHA 1M902 3R2TA 5C5MA 4X3SA 1LABA 4F7XA 2XVSA 1PTOF 2RSNA 5C0XJ 1CA6A 4EGVA 3Q23A 2QR1B 4RVFA 3M3YB 1EZ8A 4L6TB 1STYA 2B39A 2SNMA 3CRLC 4K6LA 4R8NA 5M5XB 3EROA 3I73A 1WW9A 3LWEA 2DE6A 3J7AV 4BA1I 2R7ZI 3H6MA 2EYJA 3ND8A 2NVYI 1VQN1 3FEWX 4C3IG 3T51B 3CKIB 3IFDA 4C3IB 3H09A 4RVGA 2B2TC 4DK1A 1RODA 2F0PA 4A3IB 2NVXB 4NB8A 2L5TA 3DMUA 1HXYD 4C1NK 2DY7A 1Z02A 2B2VA 3HOVI 2WIIB 4NMZA 2JA8I 4NBEA 1NCVA 1EU3A 1STNA 1IYVA 3CXCY 1D5MC 1TU2B 1QVFZ 3BDOA 4X6AI 5M9OA 4HR7B 4ZAIA 1I4HA 2CVRA 4J1MA 1VQ5Z 4K2KA 2Z1CA 4IUTA 1XYIA 3HOWB 5ELBA 2P3YA 5FK9C 3RD4A 2OZKA 3GKQA 1KTKA 3GTQI 3VYUA 3L7ZC 2F3WA 3A7AB 1I4QA 3VYTA 3QIAA 1M8AA 5AFWA 4BS9A 4ID6A 1WTRA 1T5XD 5CBAE 1NUCA 2F4OA 4CJ1B 5JPNC 4H44C 1Z47A 1U4RA 3J80E 5FLXL 3N6RA 1DD2A 1EYDA 1TWFI 3VMIA 1Y69U 2M48A 4LAAA 4A3MI 2EY2A 4E30A 1U4MA 4R9WA 2NTTA 2L9HA 1E2ZA 1VQPZ 3TDHB 3GTGI 3J80f 3BG0B 2EJGC 2MJ8A 3NDIA 2BDNA 3LNNA 1G91A 2EYHA 4H13C 1YITZ 1HFNA 3S1MI 3A7LA 4B9WA 5BN3A 2KEEA 2RVLA 2A73B 3S1RB 4EWCA 2OTJ1 1EL0A 3GQBA 2PYKA 4HMIA 1F9QA 2DN8A 2AWOA 3F3FC 4PMCA 2AUJD 5DEHA 4QUCA 1F77A 5EBCA 1Q811 5K36H 1Y1VB 4A3GI 2SDFA 3TSSA 4Q5VA 1LT3D 4TQUS 4ZLTF 2PZTA 2PM9A 2ENBA 2K3RA 3S2DB 2KHSA 4NFRA 3OIQA 1PXUA 1F9PA 1NUIA 1HRJA 4HSVA 1SYCA 3OW7A 4LK1C 3D4WA 4KY5A 1S5CD 3FKII 4BA2I 2D5DA 2CW0D 1AEXA 4Z9CB 2BDOA 3GTMS 4TKOB 4HGZA 3TN2A 2L55A 3X3NA 1TS3A 1WD1A 2QDBA 2VB2X 3BYYB 1TKWB 5FLXb 2SNSA 3PUXA 4NDXA 1F2YA 3RZOI 3SHLA 1JICA 1I6HB 3BVMA 4A3FB 2NWGA 5KGUA 1S4ZA 3QOJA 5AN9F 4XT1B 5C44I 2F0SA 1N8R1 1Z03A 1X3QA 3TP5A 2EXZA 4XYOA 3GTPI 1U4PA 1PLFA 3NH5A 4KKSA 3M4OI 1S5FD 3NK9A 3KUPA 3N52A 2QKDA 3NXWA 3EA6A 1G8ZD 2QEXZ 3G6EZ 4V190 2EYPA 1CZGA 3FPPA 1TWHI 1NP6A 4X3UA 2XRSD 2LY7A 2B8FA 4QB4A 2P28A 3P1HA 4DGZA 3GP7A 3LX0A 4ZKCB 4WFN3 4RGNA 1ESRA 1SNCA 5CR3A 1DXMA 3V05A 1PTOH 3DEOA 4AYBA 1EY6A 2XWJB 2Q8TA 1AN8A 1ICWA 3MC0B 5HGTA 1VQ51 2LS01 2EJFC 3QWNA 4CJ0B 2EZVA 1EY8A 1TWCI 1SE4A 3K58A 3NQIA 3J81E 3K5LA 1JWMD 1TVXA 4FF3A 3FPUB 1OXXK 1ZKOA 2G9HD 4ULLA 3RZDI 3QJYA 4BWGB 1KABA 5FO8B 5F2DA 4BBRB 3NDJA 2B2YC 3J81f 5T1IA 1BR9A 4EQOA 4RKBA 4JBWA 2A6ED 1HA6A 1V1PB 4CKEA 1NR4A 1MSHA 1Q12A 3S15B 5EKLA 1II3A 2Y0SB 5EKIA 5FOBB 3CD6Z 2VNUD 1GXDC 2F0UA 1VQP1 5IIFA 1M1K2 3I56Z 3G6JB 2W04A 3D4RA 1R4PB 2QILA 5CMDA 2JA7B 1YJWZ 2RPRA 1YIT1 3H94A 4L63B 1XTCD 5BN5A 3G4SZ 1STBA 1B2TA 1V1PA 2KUMA 2NTSA 3CCQZ 2E2IB 2Z8LA 1D5ZC 2LKVA 2WINB 3HKZA 1F2MA 1EFID 2B2WC 5I2YA 1E2VA 1DL6A 3ERQA 2Z4HA 1AP0A 4ZK9B 1FD7D 1USPB 3CCEZ 1CQFA 3I4NB 2TSSA 5IGGA 3HOXB 3T56B 1DOLA 3PO3B 5A2QE 1IHZA 1V43A 4C1NI 3VR2A 3C3LA 4A3DI 4HEDA 2IX3A 5D1OB 1W2BZ 4A3KI 4A3CI 3IFTA 1STHA 2R3ZA 3V96A 1VMCA 5C4JI 4HCEA 5C4XI 3S9WA 2IZ4A 2AKLA 1Q3LA 2M00A 5IGCA 1V8QA 2HQEA 5A2Qf 3W2DA 3G711 4NBCA 1IKLA 1Q1BA 5EPLA 3I4MI 3SDZA 2F0TA 1VF7A 5KNCA 1IL8A 3OWFA 4HN7A 4TSSA 2ICIA 4BXXI 5D1OA 4OHJA 1YNNC 3VB9A 1GOZA 4A3JI 4C56C 1F9RA 2R92B 2BJOA 3IFUA 4BBSI 1BCPB 1JWUD 1VQM1 1B50A 4C3JB 5C3EI 1RF2D 1K731 3LWUA 3NBIA 4E2ZA 3PUYA 4PV1C 4P2CB 2RBLA 5ELCA 1HUMA 3QG1A 1BBXC 2L1BA 3H0GB 2PMZA 1IW7C 1P9NA 1VQ4Z 5CV5A 3MA2B 4K5XA 4KD4A 5JEAG 4RVHA 2GA4B 1ZXTA 2TMPA 4A93I 1K8MA 3SE0A 1OXVA 2IPKD 1K8OA 2EY6A 3TP7A 2A68C 5EQ0A 4FF4A 1PFMA 1Q862 5FKAC 4HH4A 1VQ9Z 3OW2Y 2QEX1 2JA6I 1X3PA 1MI2A 3G6E1 4K5VA 2EE1A 5T64A 3CCUZ 3ND9A 2F0KA 1EYAA 4IFDJ 1WCMI 1RQFA 1GUWA 1Z01A 1JOKA 1VQ7Z 2E74C 2KCNA 2A74C 2M6NA 3S1QB 1DONA 2B2UA 3S14B 1PRTC 4N9PA 4BY1B 3P5JB 3A55A 3NP8A 5IT9E 2IL8A 5FO9B 4PNYA 3RLFA 2HU9A 1OXUA 4KV6A 1RNIA 1U4LA 1VQ8Z 1PYWD 1VQ6Z 3J7A4 5IT9f 1H9SA 3LUSA 4QIWB 1VMPA 4DU9A 3I90A 4MH4A 4RV9A 1CZWA 4QUFA 1YJ9Z 4RKLA 4A3BB 1A2UA 2RDGA 3VMHA 4E31A 3C2PA 1CI3M 1ZYRC 1A2TA 1SFOI 2JEBI 1ENCA 1SYBA 4IFDG 4XQJA 3CCSZ 1Y1VS 2EJMA 1JCKB 3MXGA 3Q24A 1YNJD 5JVH3 3I561 2JA5B 2AQ3B 2FFKB 2VUMB 3M3YI 3CC2Z 3R2IA 3TP6A 1YJW1 1O7LA 3AMUA 1VQO1 1EY9A 2RHBA 3CCQ1 1R9TB 2B2VC 4K8IA 4HSPA 5G3LD 4CGYB 5D14A 2MPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4R A;  1RJT A;  3HOZ I;  2K1B A;  2EOT A;  5IP9 I;  2EPB A;  2R93 I;  4A3I I;  1TWF I;  3VMI A;  2NVX I;  2L12 A;  2E2J I;  4A3M I;  1E0B A;  4R9W A;  1U4M A;  4A3B I;  2L9H A;  3R93 A;  3GTG I;  2MJ8 A;  2BDN A;  1G91 A;  2DY8 A;  2Q8R E;  1HFN A;  3S16 I;  1L1O C;  3S1M I;  5DNF A;  2KEE A;  1QYP A;  2RVL A;  5CM2 M;  1ML8 A;  1EL0 A;  3HOW I;  1AZP A;  5FLM I;  1F9Q A;  4OIJ A;  4NBF A;  2JA5 I;  2VUM I;  2MP1 A;  1WTW A;  1O80 A;  3CQZ I;  1HHV A;  4QUC A;  1F9S A;  3MWY W;  1BNZ A;  2K04 A;  4A3G I;  2SDF A;  1O7Z A;  1MSG A;  4HCS A;  1WTX A;  4ZLT F;  1SDF A;  1CA5 A;  2JP1 A;  1R9T I;  2D9U A;  4HAE A;  1KNE A;  4XDX A;  2K01 A;  1F9P A;  3DM1 A;  1NUI A;  2J6A A;  1HRJ A;  1A15 A;  4NB9 A;  1RHP A;  4HSV A;  1VLA A;  2L4N A;  3P7J A;  1SAP A;  3FKI I;  5EJW A;  4ZKB B;  5D65 A;  1J9O A;  3HP3 A;  2RSO A;  3GTM S;  3SVM A;  3TN2 A;  1YUA A;  1TWG I;  2X69 A;  4XT3 B;  4CJ2 C;  1WD1 A;  3EER A;  1X3W A;  3GTM I;  4NBB A;  2M2L A;  1IKM A;  4QTU A;  1G2T A;  2NZ1 D;  3RZO I;  3S1R I;  3FDT A;  1JIC A;  2X6L A;  3U50 C;  2NWG A;  1S4Z A;  2PK7 A;  4NBA A;  1TFI A;  4XT1 B;  5C44 I;  2K28 A;  5T1G A;  4NBD A;  1C8C A;  2H1E A;  4Y52 I;  2K5R A;  1Y1V I;  1X3Q A;  1QNK A;  3GTP I;  1U4P A;  1WTO A;  1PLF A;  3PO2 I;  2VXW A;  4DN4 M;  3M4O I;  1EQT A;  3S2D I;  3KUP A;  3N52 A;  5COY A;  5COR A;  1DOK A;  1MGS A;  2HUG A;  3VMG A;  1TWH I;  4X3U A;  1WTV A;  4ZKC B;  1ESR A;  2B2Y A;  3GV6 A;  1ZB9 A;  3DEO A;  1LV9 A;  3GCF A;  2Q8T A;  4RWS C;  1RO4 A;  1ICW A;  3IL8 A;  1B4O A;  4NBH A;  2HDL A;  4CJ0 B;  3Q87 A;  1TWC I;  2KEC A;  4O42 A;  3S1N I;  4R8I A;  5JJZ A;  4LMQ D;  1I6H I;  1TVX A;  1JE4 A;  2FMM A;  4A3E I;  3ESW A;  3FPU B;  3GV3 A;  3RZD I;  1G2S A;  3Q6S A;  4IUR A;  2B2Y C;  1DZ1 A;  4Y7N I;  4IUP A;  2B2T A;  5T1I A;  2JNY A;  2B2W A;  1HA6 A;  1QE6 A;  2N55 A;  1NR4 A;  3G7L A;  3UI2 A;  3HOY I;  1MSH A;  5EPK A;  5IP7 I;  3TZD A;  5EKI A;  1DOM A;  1TWA I;  2FJ2 A;  1HFG A;  4NW2 A;  3GTL I;  1LQL A;  2KVM A;  1PFB A;  5E4X A;  2NYZ D;  5CMD A;  1PDQ A;  1EIG A;  2JS4 A;  2JR6 A;  3S2H I;  2NVQ I;  1X32 A;  1BO0 A;  1B2T A;  3KBX A;  2KUM A;  2FHT A;  1HUN A;  1O7Y A;  4RAU C;  1EIH A;  2B2W C;  1DL6 A;  4IUV A;  1K83 I;  1AP0 A;  4ZK9 B;  1USP B;  1PFT A;  2K05 A;  1DOL A;  4QTT A;  5EPJ A;  1CM9 A;  3K7A I;  4A3D I;  4HED A;  4BBR I;  4A3K I;  2YU9 I;  4A3C I;  1ILQ A;  1G6Z A;  1RLY A;  2R3Z A;  2E2H I;  1RTN A;  1VMC A;  5C4J I;  5C4X I;  3I07 A;  2AKL A;  1Q3L A;  2X6G A;  3GTK I;  1XX8 A;  2HF1 A;  4MN3 A;  4RA8 A;  4NBC A;  1IKL A;  3H3V J;  3S15 I;  2HDM A;  5EPL A;  3I4M I;  1IL8 A;  3F2U A;  2L11 A;  1WD0 A;  1B53 A;  4NBG A;  4BXX I;  1SSO A;  3VB9 A;  4A3J I;  2JA7 I;  1F9R A;  1KNA A;  1WTP A;  1ZB8 A;  2BJO A;  1PFN A;  4BBS I;  1EOT A;  1B50 A;  3H91 A;  5C3E I;  1Y1W I;  2E2I I;  4X3K A;  3HOU I;  1F2L A;  2RBL A;  3PO3 S;  1HUM A;  2NVT I;  2JYO A;  1BBX C;  2L1B A;  3I4N I;  2MGS A;  4A3F I;  1NAP A;  3HOX I;  4NOZ A;  1ZXT A;  3PO3 I;  1I50 I;  4A93 I;  2KOL A;  1AZQ A;  4X3T A;  3I91 A;  2RA4 A;  3GTO I;  5EQ0 A;  1PFM A;  1BF4 A;  5E4W C;  3QO2 A;  2JA6 I;  1X3P A;  1MI2 A;  2B63 I;  3I3C A;  2EE1 A;  4X3S A;  1WCM I;  1GUW A;  2RSN A;  1DON A;  2FIN B;  4IUU A;  2DE5 A;  1CA6 A;  2B2U A;  3DEP A;  1WVL A;  4IUQ A;  2IL8 A;  1WW9 A;  4MHE A;  3LWE A;  2R92 I;  2DE6 A;  2XIW A;  4U68 A;  2R7Z I;  1U4L A;  1B3A A;  2NVY I;  2HCI A;  3IFD A;  2J7Z A;  2N88 A;  2B2T C;  3H0G I;  3LUS A;  1VMP A;  1ROD A;  3I90 A;  4MH4 A;  3D6W A;  4QUF A;  4NB8 A;  2DE7 A;  2KPI A;  1WTQ A;  2DY7 A;  3VMH A;  2B2V A;  3HOV I;  1X3Z A;  2JA8 I;  4NBE A;  1NCV A;  2B2U C;  4OIK A;  1NR2 A;  1SFO I;  2KED A;  3I8Z A;  4X6A I;  2K03 A;  1RTO A;  4ZAI A;  2CVR A;  3GTJ I;  4XX2 A;  3ONA B;  1Y1V S;  4IUT A;  3S1Q I;  1XYI A;  1I3Q I;  1ILP A;  2HCC A;  3S17 I;  2P3Y A;  1J8I A;  2FFK B;  1USP A;  3M3Y I;  3GKQ A;  3S14 I;  4BY1 I;  3GTQ I;  2F4M A;  1M8A A;  4BY7 I;  4A3L I;  5AFW A;  4UAI A;  1WTR A;  1ML0 D;  5CBA E;  1QG7 A;  3MTS A;  1N2F A;  2F4O A;  2B2V C;  4CJ1 B;  5D14 A;  2MPM A;  5CBE E; 
#chains in the Genus database with same CATH topology
 4F87 A;  4I7A A;  5EKK A;  3OMC A;  3E3X A;  1A0I A;  2OEO A;  4DV3 L;  3H3V H;  4DR6 Q;  4A3I I;  2NVX I;  4Y52 H;  4LFA L;  1KXL A;  2E5L Q;  1Y1V H;  2L12 A;  1YUK A;  3NBH B;  4XIG S;  1E0B A;  1RDP D;  4EVO A;  2R7D A;  1Q1E A;  3Q0A A;  3R93 A;  4FF2 A;  3ICE A;  4E2X A;  3D9X A;  1MHW C;  1N36 Q;  4KHZ A;  3S2D H;  1RO0 A;  4JG2 A;  1L1O C;  1S5B D;  5DNF A;  2KCT A;  1IBL L;  1Y8C A;  3HG9 A;  3QR8 A;  2W03 A;  5CM2 M;  1ML8 A;  2F3V A;  1S72 1;  2O5I C;  1YZ6 A;  5DAU A;  3HOW I;  4GZY C;  1SXT A;  3NUC A;  4NBF A;  1LTI D;  4NPS A;  1SN8 A;  4ZRZ A;  5IY0 A;  1K8A 2;  5BR8 L;  4MXU A;  2MP1 A;  1WTW A;  3NH4 A;  3NBH A;  4RHS A;  5FLX E;  1F9S A;  4ODG A;  2DJG C;  3EED A;  1BNZ A;  1HH2 P;  2K04 A;  2NBF A;  2JIM A;  2WKD A;  3VTN A;  2PI2 E;  1QJO A;  1Q82 1;  1A3V A;  1O7Z A;  2JXM B;  3PO2 G;  2BH2 A;  2A6H D;  4NB3 A;  3SXH A;  3J81 i;  3BDL A;  1WTX A;  3PO2 B;  1CA5 A;  3OW2 Z;  4DNR B;  4NXN Q;  2MUY A;  3K6O A;  4XDX A;  3IR7 A;  5FLX f;  3F1Z A;  4FXD A;  2RT9 A;  1S7M A;  2J6A A;  3RMH A;  2E5L L;  4NB9 A;  2MO1 A;  1I6H H;  3CU7 A;  4AH6 A;  4A3F H;  1V1Q A;  1Q81 2;  2CH4 W;  1SIW A;  4DF7 A;  3FHW A;  4LJZ C;  1T5E A;  1Z9F A;  1SAP A;  2NAP A;  2A19 A;  1V1O A;  1STE A;  4OX9 L;  2B8G A;  1IL2 A;  4UP7 A;  5G3L F;  2E75 C;  2XRQ D;  1J9O A;  2RSO A;  1SRU A;  1H95 A;  2F4I A;  3D0F A;  1NTG A;  5IYD G;  3SVM A;  1YUA A;  3NTI A;  4IQZ A;  3CCU 1;  4XT3 B;  3L9A X;  4IZ8 A;  3QWU A;  1Y1W G;  1VQL A;  3EER A;  1KC8 1;  3PSI A;  5M5W B;  1A63 A;  1VQ7 1;  3CC7 Z;  2Q2U A;  2HIX A;  3I70 A;  1JQY D;  4M1U B;  3FQM A;  4QMG A;  1F2Z A;  3HGB A;  1X65 A;  3S1R I;  3W3A A;  2X6L A;  4UHV A;  5GRO A;  3U50 C;  2QEX A;  4GOP B;  2O4H A;  4G7O C;  2PK7 A;  1S5D D;  2P5Z X;  5J1Z A;  3MZL B;  1PHJ A;  3H3V I;  1GUG A;  4B3T Q;  2CWA A;  3KF8 A;  1XNR Q;  2H1E A;  4JI3 Q;  3FMC A;  2LXJ A;  3M7N A;  2BA1 A;  4Y52 I;  1VQJ A;  3UE0 A;  5C0X G;  1Y1V I;  4NXN L;  4E2Y A;  2BA0 A;  4XTC S;  1Y8O B;  3CCL Z;  1T9H A;  1O78 A;  5CV7 A;  2LSS A;  4FO2 A;  4LF8 L;  1FNV A;  2VXW A;  4DAP A;  4Y7N B;  4MIU A;  5HGQ A;  4M8A A;  3S2D I;  5COY A;  1DJR D;  3DUZ A;  1MGS A;  2CWP A;  1JOO A;  4DV7 Q;  1Z6H A;  4L5T A;  1QNU A;  4R4Q A;  3M4Y A;  2QA4 1;  3CME 1;  1ENA A;  3ER0 A;  4IJH A;  4S1T A;  5CYU A;  1WTV A;  2V8K A;  4GOP A;  1N8R 2;  1YJ9 1;  3SK6 A;  3TME A;  1D6E C;  3KF6 B;  1TWA B;  1K8G A;  3K59 A;  3GV6 A;  2VPW A;  3TZU A;  5LL6 S;  2KQ3 A;  4LF5 Q;  4FVM A;  4BBR H;  2JUB A;  5I6Y A;  5NUC A;  2WB1 E;  2R7Z G;  3MXP A;  2VS1 A;  4QF4 A;  2RQX A;  2NVQ B;  4YIJ A;  1UEA B;  4FP5 D;  3HEJ A;  1TY2 A;  1VQK Z;  1EUJ A;  3Q87 A;  3S15 H;  4CKB A;  3VDY A;  3K0Y A;  1KD1 1;  4B3T L;  1SEB D;  2F0H A;  2KEC A;  4R8I A;  3SK5 A;  5JJZ A;  4X66 L;  4LMQ D;  1PH9 A;  1I6H I;  3CC2 1;  2FMM A;  5EGT A;  1K83 B;  3KF6 A;  1S5E D;  1Q82 C;  3KLS X;  3WOE A;  3D4D A;  5IOC A;  3GV3 A;  3HOV G;  2ZJP A;  3HFZ B;  1TS4 A;  2JA8 G;  1BOS A;  3K7A B;  2JA7 H;  1WJ2 A;  3A0J A;  2YTY A;  3CD6 A;  1Q8I A;  3EFX D;  5CV4 A;  1DZ1 A;  4DUZ L;  1X0T A;  3I56 A;  2UXC Q;  4IUP A;  2B2T A;  4JV5 Q;  1JT8 A;  1SMX A;  4J6H A;  2E2I H;  2HD3 A;  4KJN A;  3GTK B;  4X64 L;  1YJW A;  2KHI A;  2YTX A;  4JI5 Q;  3G7L A;  4L5R C;  5EPK A;  3EN2 A;  3G4S A;  2F0I A;  4LF5 L;  3I4N H;  1VQG A;  2A6E C;  4I7Z C;  3HOX H;  4RFB A;  2FXQ A;  5DM7 3;  3PO3 H;  2NZH A;  2JQO A;  1NY4 A;  4NW2 A;  1JB3 A;  3J7Y W;  1LQL A;  1B70 B;  2KVM A;  1A6X A;  2JEA I;  4WRD A;  1PFB A;  1YJN Z;  3SR1 A;  3J80 c;  1KC8 C;  3CCE A;  4DR4 Q;  3CCM 1;  3NWT A;  1C0A A;  1W2B Y;  2JS4 A;  1EEI D;  2EGT A;  5D3D A;  1E24 A;  1X3G A;  1X32 A;  1BO0 A;  2IHE A;  3KFU A;  3CRK C;  3KBX A;  1W2B A;  1KLG D;  3F8T A;  4OO1 G;  1NMG A;  4JK1 C;  3CF5 A;  1PV4 A;  4JYA L;  1HUN A;  2Z6K A;  3HOU B;  3CCJ Z;  5ELE A;  3A8K E;  4KY6 A;  1VQE A;  2NVT B;  4KD3 A;  1LO5 D;  4A3M G;  1SE2 A;  4DR5 Q;  2K05 A;  3CW2 C;  3HZX A;  2BCO A;  2J4X A;  4QTT A;  2XGT A;  4JV5 L;  2K6A A;  1LUZ A;  3GO5 A;  2R92 H;  4BBR I;  1PYB A;  1ILQ A;  4C2M B;  1G6Z A;  1VQL Z;  3DLL A;  2O53 A;  1NJI 1;  1RCV D;  3GTO B;  1FGB D;  2KJX A;  4C3J H;  2B63 B;  2ZXR A;  3RUZ A;  2HF1 A;  3JAM L;  2ZTE A;  1SYF A;  4ME3 A;  2Q51 A;  2OWO A;  4OON A;  2KCM A;  3H0G H;  3S15 I;  4KMU C;  2HDM A;  3K80 C;  4J15 A;  4DR4 L;  3F2U A;  5JEA H;  1WD0 A;  3RLO A;  2ZJR A;  4A3G G;  1HCZ A;  2WAC A;  4P72 A;  4HJ7 A;  4B3R L;  4A3G B;  4NBG A;  1SNM A;  3ULP A;  1VQ4 A;  4DR1 L;  3P75 A;  2VQF Q;  3K57 A;  1KNA A;  2JA7 I;  3QOL A;  4HGY A;  1ZB8 A;  1XNQ Q;  1PFN A;  1LM0 A;  4LUO A;  3STB C;  4FF1 A;  4C3H G;  3PUZ A;  5LHY 1;  4CDE C;  4C3H B;  2E2I I;  4DR5 L;  1PH8 A;  2KI7 B;  2OXP A;  1C48 A;  1VQ9 A;  3S1Q H;  3MFG A;  2Q8I B;  3OIP A;  1KQS Z;  1LTB D;  1PVO A;  2JYO A;  2BE5 D;  4DV5 Q;  1Q81 C;  3I4N I;  1AA6 A;  3S14 H;  3MON A;  4TNU A;  1QVG Z;  3D6C A;  1VQ7 A;  4BY1 H;  3HOX I;  5JJL A;  2G2K A;  3PO3 I;  2MHV A;  3CCL 1;  1JOR A;  2Q4Z A;  4X62 Q;  1AZQ A;  4WJW A;  4X3T A;  1BBU A;  4JI8 L;  5CC4 A;  2ALY B;  1ASY A;  4A3L H;  5CV6 A;  3M9B A;  1K73 2;  2RA4 A;  3PIP 3;  4LF9 L;  2WB1 B;  1X6O A;  3QO2 A;  5KND A;  4RCN A;  3CCV Z;  1UE7 A;  3I3C A;  2XTI A;  1GVP A;  3GTJ B;  2B29 A;  2UUA Q;  2IWH A;  5C44 G;  1QZH A;  1VQ8 A;  1FNW A;  2R61 A;  1I3Q B;  2FIN B;  3L3O C;  4IUU A;  3RLN A;  1VQ6 A;  4WJ4 A;  1FR3 A;  5GAG C;  1G29 1;  2AHO B;  3S17 B;  1YIJ A;  4A3B H;  3VR6 A;  4DAY A;  2N3S A;  4B3M Q;  1HNZ Q;  1EQR A;  4H0L C;  1Y8N B;  1SR3 A;  1NBW A;  3J80 b;  1U9R A;  1SMY C;  2WAQ E;  2V45 A;  2V4D A;  4MHE A;  3M4Q A;  2V1C C;  1Y14 B;  2JSO A;  2R92 I;  4BY7 B;  3JAM b;  2XIW A;  2AUK A;  3HKZ G;  5T6B A;  1SE3 A;  4UP8 A;  3HRZ C;  1B3A A;  4DV5 L;  2HCI A;  1EFW A;  2VZA A;  4JI2 Q;  4DV0 Q;  1K9M 1;  1C4Q A;  3G48 A;  5FLM H;  4GNX B;  1PMR A;  2J7Z A;  2JA5 H;  5IP9 G;  3HOZ B;  2N88 A;  3H0G I;  2VUM H;  1E2W A;  3U4V A;  1VDZ A;  1PFS A;  2Y0S A;  1NJI C;  2ASB A;  2MFI A;  2DE7 A;  3CC4 Z;  1I4R A;  3CCS A;  4E6I A;  3VA7 A;  4ZUJ A;  3DXJ C;  4F88 A;  2ZXO A;  4LF7 Q;  2E2J B;  2F0V A;  1WTQ A;  4B08 A;  3J81 c;  3TBI B;  3NTK A;  1X3Z A;  2VUG A;  2B2U C;  1R9T H;  4OIK A;  1NR2 A;  1OXS C;  2WV6 D;  2KED A;  4AIM A;  2NUC A;  2OT2 A;  3S16 B;  3I8Z A;  4R4O A;  1RTO A;  1BQQ T;  1EZ6 A;  2RHS B;  1PTO C;  1Y8P B;  4PMW A;  5CV8 A;  4DR7 Q;  2EYL A;  3VR4 A;  4B3M L;  3S1Q I;  2WP8 J;  2A5H A;  1B9N A;  2LFN A;  1EY5 A;  1USP A;  1X54 A;  3CQZ B;  3S14 I;  4DA2 A;  2ZAE B;  4TRD A;  5LMU Q;  4BY1 I;  4E33 A;  1EY7 A;  3TE5 B;  4MRI A;  4GLX A;  1LT4 D;  5KRU A;  4K0K L;  1JB7 A;  3PQI A;  2HT1 A;  4KHP Q;  2JJQ A;  1SNO A;  3TDQ A;  1YHQ Z;  4DV0 L;  4JI2 L;  2F0J A;  4LF6 Q;  4HIK A;  4G7Z C;  4A3L I;  4UAI A;  2PQA A;  3CP0 A;  4ALP A;  1QIL A;  5L37 A;  1Q7Y 1;  2SEB D;  1KAW A;  1ET6 A;  2ICE C;  2OQK A;  5C3W A;  5I4D A;  4LF7 L;  4LUZ A;  1RJT A;  1OTC A;  3D31 A;  1I4X A;  1DCZ A;  2R93 I;  2EPB A;  1ZH1 A;  1MIU A;  2SOB A;  3K5N A;  4POG A;  3NSW A;  4LWC A;  1PZI D;  3S24 A;  4LNQ A;  1UE5 A;  2I5L X;  1VQL 1;  4A3B I;  4OL7 A;  3PIO 3;  4GKJ L;  3PO2 H;  2D2C C;  2GTH A;  1B7Y B;  2NN6 G;  3NHH A;  1VCI A;  3K8A A;  4RGO S;  1TWG B;  4DR7 L;  3EQL C;  2H85 A;  1PH7 A;  2Q8R E;  3NWS A;  1STA A;  3GTM B;  1ZEQ X;  1QYP A;  1FJG L;  1RD9 D;  3DWA A;  4DK0 A;  3BZC A;  1H9J A;  4CDF C;  2KA7 A;  3CCR A;  5FLM I;  1BXT A;  1C9O A;  4OIJ A;  2JA5 I;  4KHP L;  4A3D G;  2VUM I;  4RH6 A;  1O80 A;  4LF6 L;  3BZK A;  2JMO A;  1KRL A;  4RGM A;  3MXN A;  5C4X G;  5IYD H;  3NPP A;  1TII D;  5IGB A;  2EDG A;  5C4X B;  5LMN Q;  1K9M C;  1MSG A;  4MZ9 A;  5M5W H;  4HCS A;  3DWP A;  1SDF A;  2JP1 A;  1R9T I;  1EEF D;  2PW7 A;  4MTN A;  4F8M A;  1KNE A;  1A3U A;  1XMQ L;  5J39 A;  1BCP D;  2K01 A;  2F0Q A;  2A6H C;  1EWH A;  5A2Q L;  1J5E Q;  3CC7 A;  1YIJ Z;  2N8N A;  1CQV A;  1Q82 2;  4BXX G;  3TP8 A;  3I4O A;  2VPZ A;  3RN2 A;  3BZD B;  3GD7 A;  1TR5 A;  5C0X H;  2RKS A;  4KN7 C;  3UDF A;  3PIP A;  1CKM A;  3J81 b;  4Y7N H;  3AB9 A;  2WAQ B;  4DV3 Q;  4I65 A;  2X69 A;  4CJ2 C;  2JIO A;  3DHQ A;  2M2L A;  1IKM A;  4QTU A;  2OTL A;  1G2T A;  2NZ1 D;  1I4G A;  3T1H Q;  1FVI A;  3S1N B;  3FDT A;  2F3I A;  2XN9 C;  1I5F A;  1TWA H;  1GHJ A;  4A3E G;  3CD6 1;  4OWX B;  4DR3 Q;  5CV9 A;  4NBA A;  1TFI A;  4A3E B;  2K28 A;  5T1G A;  3OHX C;  1IBL Q;  4NBD A;  1C8C A;  2D0P A;  3A8I E;  3UDX A;  1KC8 2;  2K5R A;  1HZ9 A;  1D1K A;  3KDF A;  1QNK A;  1Q7Y C;  2WAQ A;  4G4K A;  5FJ8 G;  1WTO A;  2NVQ H;  3CMA A;  1QUQ A;  1LTA D;  2E76 C;  2IX0 A;  3G4S 1;  5BR8 Q;  3PO2 I;  4HTH A;  3ZYY X;  4DN4 M;  1J5E L;  1WCM G;  1GHK A;  1EQT A;  1AW7 A;  2LXK A;  1LTG D;  5COR A;  2HUG A;  3HOY G;  1MBY A;  4U67 3;  5IT9 c;  4CL1 A;  5I9O A;  2OQ0 A;  5M5Y B;  1PRT B;  5C4Z A;  3HOY B;  2Z6B A;  4DQY B;  1K83 H;  5D1P A;  1S40 A;  3M7G A;  1YNN D;  1HTP A;  3HKS A;  3K7U C;  2K33 A;  1I94 L;  3CCE 1;  1P8L A;  1VQK A;  2F4V Q;  4WOR A;  3MAQ A;  3ULL A;  1BCP F;  3K7A H;  3J7A 5;  1NMF A;  3AFQ A;  1ZB9 A;  3GTL B;  1CTM A;  2K5V A;  1LV9 A;  2ZM6 L;  1KIX A;  1PH2 A;  4V0B A;  2LMC B;  3W5O A;  1RO4 A;  5BN4 A;  1EYC A;  3T1H L;  4K6D A;  5GAE C;  3S2H B;  3GTK H;  2QF7 A;  2QRC B;  4OX9 Q;  1IW7 D;  3IL8 A;  1B4O A;  1YBY A;  2PPB C;  5A2Q b;  2OOY B;  4DR3 L;  2LFU A;  2A69 D;  1VQB A;  3SK4 A;  1FNU A;  4O42 A;  3IAY A;  2A68 D;  5IT9 L;  1JE4 A;  2VQE L;  2EYF A;  2AQ1 B;  3ESW A;  2AKW B;  2PZU A;  2RBM A;  1EOV A;  1YHQ 1;  4LW1 A;  1SYE A;  1B8A A;  2JIR A;  1G2S A;  3D3R A;  4IPG A;  5C0X I;  4IUR A;  2YU9 B;  5LMN W;  2V8J A;  1FYC A;  2Z0S A;  5C6A A;  1HNX Q;  2E2H B;  4KTA A;  3NH8 A;  4Y7N I;  1YJN A;  1L0Y B;  4MON A;  4OO1 H;  3HOU H;  5K5P A;  1QE6 A;  2F4V L;  1L0X B;  4O1N A;  3CCR Z;  1PRT D;  2F0W A;  3UI2 A;  1HPC A;  2NVT H;  2JIQ A;  3ERS X;  3X3M A;  5IYC G;  3NTH A;  4LF4 Q;  4IPH A;  4LF8 Q;  1VF5 C;  1VQ4 1;  1UUP A;  3B6Y A;  3TZD A;  4DAM A;  3RN5 A;  2RCN A;  1DOM A;  2G9D A;  1TWA I;  2FJ2 A;  3CCJ A;  2HIV A;  2L0C A;  3QB3 A;  3T4A C;  1CT1 D;  3PIO A;  2GU2 A;  3ULJ A;  2E9H A;  4C2M H;  3K5O A;  3VR5 A;  3GTO H;  4G57 A;  5E4X A;  1N34 Q;  4EQN A;  1PDQ A;  4PZ8 A;  3C1E A;  1VQ9 1;  1B3Q A;  2B63 H;  4JI4 L;  1IBM L;  1WII A;  2NVQ I;  4QGU A;  4HJA A;  4DV6 L;  1LAC A;  4O0A A;  2VB3 X;  2FHT A;  3L0O A;  2PCF B;  2CW0 C;  1Y1W B;  4B9X A;  5I9P A;  1YNX A;  1XPR A;  2F1M A;  4A3I G;  1EIH A;  3OOC A;  1QF8 A;  4K8J A;  3BVG A;  1W6J A;  1HTL D;  3E5S A;  1K83 I;  1PZK D;  5HY6 A;  1ZYR D;  1PFT A;  1PZJ D;  1YI2 Z;  1N32 Q;  4A3G H;  2WKC A;  1HNX L;  4S3S A;  4AYB E;  1KLU D;  1HZB A;  5EPJ A;  1I50 B;  5T67 A;  1CM9 A;  4OGQ C;  1L1O B;  3K7A I;  4ZCK A;  2QEJ C;  4KKT A;  4X66 Q;  4MD9 A;  1KRS A;  3MXU A;  1RLY A;  3TQY A;  3MVV A;  5ISR A;  4YCU A;  1ESF A;  3I07 A;  3H3V C;  1QWY A;  3D2L A;  4GN5 A;  4LF4 L;  4C3H H;  2OTL Z;  1VQ8 1;  5FLX c;  2JK8 A;  2K5H A;  2ZXP A;  3GTK I;  1VQ6 1;  1XX8 A;  1LTS D;  4KHV A;  4RA8 A;  1EY0 A;  3WOF A;  3HOW G;  3NFZ A;  1YIJ 1;  5IT9 b;  3H3V J;  1UNS A;  4CKC A;  3BDC A;  3MZK B;  4DUZ Q;  1LT6 D;  1ENF A;  4A75 A;  4DPG A;  4DUY L;  1KQS Y;  4ILW A;  4IN3 A;  2R6M A;  1N34 L;  1OO9 B;  2AQ2 B;  2PW5 A;  1NJI 2;  3FQQ A;  2Z6K C;  1QVG Y;  4X64 Q;  1KQS A;  5ELD A;  2OOX B;  2QLV B;  1SYG A;  3UE1 A;  1HZA A;  1L1O A;  1HA5 A;  1PRT F;  1SBB B;  3U58 A;  3CMA Z;  1QVG A;  1SSO A;  2K5W A;  5IGD A;  3J7Z C;  1JC7 A;  4GN4 B;  2F03 A;  4XQN A;  4GKK Q;  1GUT A;  3GTJ H;  3A56 A;  1EOT A;  4UDU C;  2R7Z B;  4XQQ A;  1SNQ A;  3DWQ A;  2NVY B;  4NKL A;  4DR2 L;  2QRE B;  3EBE A;  3I72 A;  3J81 j;  1N32 L;  3E6Z X;  4OO1 I;  3HOU I;  1F2L A;  4QJF A;  2IX1 A;  3CCS 1;  3CCV A;  1I3Q H;  3PO3 S;  3F3P C;  2NVT I;  2J0T D;  3JAM E;  3S17 H;  1M90 1;  5IYB H;  1Q46 A;  3T53 B;  4A3F I;  1LTR D;  1NAP A;  4JYA Q;  1JJ2 Y;  5D3I B;  3SEB A;  4MD7 A;  2BOS A;  2KOL A;  3C46 A;  3MHB A;  2BE5 C;  1K8A 1;  2F0E A;  4BY7 H;  1JJ2 A;  1EIY B;  1GUS A;  1L2F A;  4IAL A;  3HOV B;  3GTO I;  2JA8 B;  4PZ6 A;  3JAM f;  1BF4 A;  5E4W C;  4POF A;  2B63 I;  1E7Z A;  1KHI A;  4IPC A;  2I46 A;  1QCB D;  3TS2 A;  1BKB A;  2EY1 A;  2F0O A;  3HKZ E;  5LL6 X;  1U0L A;  1L0W A;  3HOZ H;  1CSQ A;  5IP9 H;  1CFM A;  1MD2 D;  2DE5 A;  4OWW B;  1STG A;  3ITP A;  2E2J H;  5EBD A;  3KIF A;  1DYQ A;  1Y1V G;  3BG3 A;  3I55 Z;  4N8X 1;  1Q16 A;  3A54 A;  3DEP A;  1WVL A;  5JAV A;  4GKK L;  4H02 A;  1GUN A;  3E9I A;  1KRT A;  4IUQ A;  1XMO Q;  3GTQ B;  1FGU A;  1KAA A;  3EVQ A;  3CC4 A;  1VQF A;  1K3R A;  5CGK A;  3Q22 A;  2O2L D;  3S16 H;  4U68 A;  1G51 A;  1OXT A;  4RG1 A;  3SGI A;  4B3R Q;  4DNI A;  4B3S Q;  3VR3 A;  3L2P A;  4DR1 Q;  1GJX A;  5DM6 3;  3G71 Z;  1E3P A;  3T13 A;  1AFP A;  5IGE A;  1CHQ D;  4DV4 Q;  4LFC Q;  5LL6 f;  2XWB B;  3CQZ H;  2Z4I A;  4FXG C;  3D6W A;  1TWF B;  4YWK A;  2O5J C;  4IJL A;  4DKA C;  2AYD A;  2KPI A;  2IZ3 A;  4A3M B;  1JWH C;  2F52 A;  2F0D A;  2IW3 A;  2F0N A;  5C3X A;  3GTG B;  1K9M 2;  5JVG 3;  3P20 A;  2PI2 A;  1IYU A;  2DNC A;  4WJ3 M;  4JW0 A;  1D1I A;  3CCR 1;  4KLK A;  3AU7 A;  3J80 L;  2VW9 A;  1TXY A;  2ZT9 C;  5KNB A;  3K5M A;  3S1M B;  1VQM Z;  2K03 A;  3PUV A;  1YHQ A;  3GTJ I;  4ZQ3 A;  4XX2 A;  4JI8 Q;  2EY5 A;  3BG1 B;  5E7N A;  3ONA B;  2PMZ E;  4LF9 Q;  3BJU A;  1BDO A;  2Z9H A;  1I3Q I;  5JOB A;  1XMO L;  1ILP A;  2HCC A;  3S17 I;  2QDL A;  1J8I A;  3OWE B;  3H15 A;  4AYB G;  1JJG A;  2MO0 A;  4AYB B;  1D7Q A;  2K75 A;  1Z7T A;  5KYL A;  2F4M A;  1KL9 A;  1TWG H;  4B3S L;  4CBV A;  2NN6 H;  3T16 A;  2EVB A;  4BY7 I;  4YHH L;  3GTM H;  1PA6 A;  3CXC Z;  1ML0 D;  2K5Q A;  1KD1 C;  3CC7 1;  1QG7 A;  3MTS A;  1EQV A;  2K52 A;  4LFC L;  3VA5 A;  1N2F A;  4DV4 L;  1M90 C;  2M9V A;  2XSC A;  1XTD A;  1EU4 A;  3R3O A;  5I2X A;  2DNE A;  4CDD C;  3U9O A;  3KYH C;  5CBE E;  3J7A F;  1HJP A;  4HIM A;  1CHP D;  2K7V A;  1YI2 1;  3HOZ I;  1H9R A;  2K1B A;  4K14 A;  2A8V A;  4FYD A;  2EOT A;  2L15 A;  3BS1 A;  4KY7 A;  5IP9 I;  2C9O A;  1VQN A;  3FKI G;  3MEH A;  3A5U A;  2GTI A;  3FKI B;  4MNO A;  1SJE D;  1XXG A;  2E2J I;  3O13 A;  1UE6 A;  4JPB W;  2OF1 A;  5C4X H;  4K5W A;  4O2D A;  1Q7Y 2;  2HQL A;  3OYY A;  2OTL 1;  1VQA A;  1D5X C;  2R6G A;  5IOD A;  1PH6 A;  4RCO A;  2DY8 A;  2KEN A;  3S16 I;  4MD8 A;  4JBK A;  4DNT B;  3RZO B;  4LFB L;  1PYS B;  1AZP A;  4DAV A;  1P16 A;  2PQE A;  1IBK Q;  3CMA 1;  1H9M A;  3CQZ I;  3SK8 A;  5C44 B;  1HHV A;  4BBR G;  2YAD A;  1JJ2 Z;  3MWY W;  2NB0 A;  4E2W A;  3BYT B;  4L8J A;  2I3C A;  2F0M A;  3GTP B;  4OXP A;  4ZUI A;  3M85 A;  3CPW Y;  5ELF A;  2EYM A;  2WB1 A;  3M4O B;  1ONL A;  5I6W A;  2D9U A;  3OSO A;  4HAE A;  2LIY A;  1VQK 1;  3AFP A;  3DM1 A;  3CPW A;  3S1N H;  2EXD A;  1CKO A;  1QB5 D;  5KIX A;  5J22 A;  3HKZ B;  4K0K Q;  1A15 A;  4RVD A;  1RHP A;  2H4O A;  1TWH B;  4ZYS A;  4JC0 A;  4IFD H;  2D62 A;  3BVZ A;  5GQO A;  1VLA A;  1QXF A;  4A3E H;  2L4N A;  2GN5 A;  1BCP C;  1UAP A;  3P7J A;  4ABN A;  2I07 B;  1TS5 A;  5GAD C;  5EJW A;  4ZKB B;  4XYQ A;  4E32 A;  3T4N B;  3BU2 A;  3V2T A;  2Q2H A;  5D65 A;  1DM0 B;  3HP3 A;  2QRD B;  2F0F A;  3WWV A;  5K36 G;  2I5H A;  5FJ8 H;  1VQO Z;  4P73 A;  3NQT A;  1TWG I;  2GVA A;  1QOH A;  2NN6 I;  1X3W A;  3GTM I;  5M5Y H;  4NBB A;  3HOY H;  1IBK L;  1K0S A;  4IO9 A;  1Q90 A;  4GKJ Q;  1TWC B;  5IP7 H;  5JEA J;  5E1F A;  4GNX A;  4NXM Q;  3HOX G;  4KN4 C;  3I55 1;  3KLS A;  4DXG A;  1SLJ A;  3GTL H;  2CHB D;  3FRP B;  4DGL A;  3OMG A;  1D8L A;  1FJG Q;  1YJN 1;  2OTJ A;  3RZD B;  4DV2 Q;  5KYI A;  3U4Z A;  2QKI C;  3A8J E;  3IF8 A;  1YNJ C;  4FXK C;  3S2H H;  2QCP X;  2NZO A;  1PH4 A;  5M3F G;  2OCE A;  1B1Z A;  1I6V C;  3CAM A;  3IKJ A;  5M3F B;  2K32 A;  1DOK A;  3J81 L;  4PMB A;  1ET9 A;  1VQH A;  2CQA A;  2N78 A;  3VMG A;  3CCJ 1;  3PV0 A;  1X9N A;  4KK7 A;  2ZTD A;  1GD7 A;  4A76 A;  2PMZ B;  1S72 Z;  1TY0 A;  4NH1 C;  3KJP A;  5A35 A;  2B2Y A;  2K5N A;  3NEL A;  1XMQ Q;  1VQC A;  4CDC C;  1XJV A;  1NSN S;  1RKN A;  2YU9 H;  4R4C A;  2IT1 A;  2C5C A;  2E2H H;  3URY A;  3GCF A;  2KBN A;  4RWS C;  4HJ8 A;  3TRE A;  4YY3 Q;  4Q0F A;  2Q2I A;  4C3J G;  2K14 A;  1H9K A;  1CKN B;  4NXM L;  3VYR A;  1HR0 Q;  1JOQ A;  4NBH A;  4G7H C;  2E8G A;  5JPM C;  2HDL A;  5GAH C;  2ZJQ A;  4DK3 C;  2VF1 A;  3S1N I;  5IYC H;  1VQN Z;  3IX0 A;  1BUV T;  1SNP A;  4DXF A;  4DV2 L;  4QCL A;  4IFD I;  3CHB D;  3MZ5 A;  4A3E I;  2A69 C;  3KOJ A;  1A3T A;  2JA9 A;  4YCW A;  3HS0 C;  4HIO A;  4PQX A;  4H7B A;  1QZG A;  4GLV B;  4A3D B;  1V9P A;  2F0L A;  4A3K G;  4A3C G;  1SND A;  3Q6S A;  4A3K B;  1PTO B;  4IUN A;  1IXR A;  1KDC A;  1M1K 1;  3U9S A;  5C4J B;  1JMC A;  2JNY A;  3JAM i;  1HQM C;  2B2W A;  1Y1W H;  1Q8K A;  3KBG A;  1TQO A;  2N55 A;  5C5L A;  4EQ5 A;  1EQQ A;  2CQO A;  3HOY I;  3I4M G;  1H9S B;  2RDF A;  1SMY D;  3KK7 A;  1B9M A;  4FNF A;  3I4M B;  5C4H A;  4DV1 Q;  1IYJ B;  3A74 A;  5IP7 I;  4K2L A;  3FVQ A;  4P74 A;  5FO7 B;  4KI0 A;  1I50 H;  1TS2 A;  2PNR C;  1HFG A;  3KIH A;  1W6K A;  4YY3 L;  3GTL I;  4N9T A;  1GUO A;  4RHR A;  1RO2 A;  1WOC A;  1TT2 A;  1HR0 L;  5HUR A;  5H1S E;  2ZTC A;  4A3J G;  1MJE A;  1YI2 A;  4OWT B;  2R7F A;  2NYZ D;  2UU9 Q;  1LTL A;  4A3J B;  1I94 Q;  4EQP A;  1EIG A;  1JWS D;  2JR6 A;  4N8F A;  3CCV 1;  3S2H I;  3NEM A;  1KDA A;  4BBS G;  5IGF A;  3CPW Z;  2ID0 A;  1QVF Y;  4BBS B;  5C3E G;  4J8Q A;  2IY5 B;  1K28 A;  1HQR D;  2ZM6 Q;  5C3E B;  4KKU A;  3KLR A;  4HMJ A;  1QVF A;  1LT5 D;  2QA4 Z;  3CME Z;  1O7Y A;  2EYO A;  2IJ0 A;  3PMF A;  4RAU C;  2R93 G;  5KEE A;  2R93 B;  2KHJ A;  4IUV A;  1XPO A;  3PUW A;  4NP5 A;  1NNX A;  4A3B G;  4A93 G;  4JI0 L;  2YYZ A;  3A5Z B;  3KJO A;  4JCV E;  1B44 D;  4A93 B;  1S3O A;  2PZW A;  1D2B A;  1PTO D;  4XXE A;  2YU9 I;  2RF4 A;  1M4V A;  2E2D C;  2WFW A;  2E2H I;  1FL0 A;  1RTN A;  2VQE Q;  2JA6 G;  2R7Z H;  1JR0 D;  2V8I A;  2NVY H;  2XNA C;  2JA6 B;  1I4P A;  2X6G A;  1CK1 A;  4DV1 L;  3EJI A;  1EY4 A;  2C35 B;  2AWN A;  4PZ7 A;  1R4Q B;  4MN3 A;  2FMC A;  1WCM B;  1PH3 A;  1UWV A;  2RIQ A;  1EWC A;  4HJ5 A;  1LTT D;  2VUM G;  4DFA A;  1X3E A;  1SJH D;  3E0J A;  1QVC A;  2UU9 L;  4RS4 A;  2OTJ Z;  3C1F A;  2L11 A;  3CC4 1;  1KDB A;  3OPO A;  4ME5 A;  5E3F A;  1B53 A;  2VL6 A;  2UUC L;  2KCC A;  2HHH Q;  3IRB A;  4EX5 A;  3HOV H;  2JA8 H;  5M3M G;  4GN3 B;  2F0G A;  1WTP A;  3WDN A;  5M3M B;  2O4X A;  1HNW Q;  4X6A H;  1HR0 W;  3D8G A;  3MFY A;  3H91 A;  1RL2 A;  3CPF A;  1Y1W I;  4X3K A;  1LLR D;  1LYL A;  4JOI A;  4KJO A;  3MEF A;  1Q86 1;  1YIT A;  3R8B A;  1SYD A;  3NE5 B;  4JI4 Q;  1IBM Q;  1K3B C;  2K50 A;  4DV6 Q;  2MGS A;  4NOZ A;  3OTO Q;  1M1K C;  1I50 I;  3GTQ H;  2EIF A;  2JE6 I;  4CHT B;  2PNH A;  1MKH A;  2K5D A;  3I91 A;  4GOP C;  4QY7 A;  2PO4 A;  3CCM Z;  3VYS A;  3I55 A;  1XWE A;  3I4L A;  1UEB A;  4RGT A;  5TSS A;  1SFO B;  1KD1 2;  1WJJ A;  2RDH A;  1M90 2;  3R2T A;  5C5M A;  1EIF A;  4X3S A;  1LAB A;  4F7X A;  2XVS A;  1IZ6 A;  2UXB L;  1PTO F;  2HHH L;  2LEX A;  1TWF H;  3AQQ A;  2RSN A;  5C0X J;  1CA6 A;  4EGV A;  1SE8 A;  3G71 A;  3Q23 A;  4A3M H;  2QR1 B;  4RVF A;  3M3Y B;  1EZ8 A;  4L6T B;  1STY A;  2B39 A;  2SNM A;  1HNW L;  3CRL C;  4K6L A;  3GTG H;  4R8N A;  5M5X B;  3ERO A;  3I73 A;  4DUY Q;  1WW9 A;  3F2C A;  3LWE A;  2DE6 A;  3S1M H;  3J7A V;  4BA1 I;  2R7Z I;  2EYJ A;  3H6M A;  3Q8D A;  3ND8 A;  2NVY I;  1VQN 1;  2QGQ A;  3FEW X;  3T51 B;  4C3I G;  3CKI B;  3IFD A;  3OTO L;  4C3I B;  3H09 A;  3PCO B;  2RCF A;  4RMF A;  4RVG A;  2B2T C;  4DK1 A;  1YEZ A;  1VQM A;  1G6P A;  1ROD A;  2F0P A;  2CH4 A;  1N36 L;  4A3I B;  3KF8 B;  2NVX B;  4NB8 A;  4DR2 Q;  2L5T A;  3DMU A;  1X3F A;  1GO3 E;  3UDG A;  1HXY D;  4C1N K;  1GKH A;  1O7I A;  2DY7 A;  1Z02 A;  2B2V A;  3HOV I;  2WII B;  4NMZ A;  2JA8 I;  4NBE A;  1NCV A;  1EU3 A;  1STN A;  2RHQ B;  3TRZ A;  3PF4 A;  1IYV A;  3CXC Y;  1D5M C;  1TU2 B;  1QVF Z;  3BDO A;  4X6A I;  4QL5 A;  5M9O A;  4HR7 B;  2ATW A;  4ZAI A;  1I4H A;  2CVR A;  4J1M A;  1VQ5 Z;  3CXC A;  4K2K A;  2H5X A;  2Z1C A;  1HZC A;  4IUT A;  3G6E A;  1XYI A;  3I2Z A;  4OEL B;  3HOW B;  3FKI H;  4JBJ A;  5ELB A;  2P3Y A;  4PG3 A;  5FK9 C;  3RD4 A;  2OZK A;  3GKQ A;  1CSP A;  1KTK A;  3GTQ I;  1BBW A;  3L7Z C;  3VYU A;  2F3W A;  4YWL A;  5J3B A;  3A7A B;  1I4Q A;  3VYT A;  3QIA A;  1Q86 C;  1M8A A;  5AFW A;  4BS9 A;  4ID6 A;  1WTR A;  1T5X D;  1A8V A;  1X55 A;  5CBA E;  1NUC A;  2F4O A;  4CJ1 B;  5JPN C;  4H44 C;  3RZO H;  4JBM A;  1Z47 A;  1U4R A;  1PH5 A;  3J80 E;  5FLX L;  3N6R A;  1DD2 A;  5C44 H;  1EYD A;  1TWF I;  3VMI A;  2VY3 A;  1Y69 U;  2M48 A;  4LAA A;  4A3M I;  2EY2 A;  4E30 A;  1U4M A;  4R9W A;  2NTT A;  4UPA A;  1YVC A;  2L9H A;  1E2Z A;  1VQP Z;  3GTP H;  3TDH B;  3GTG I;  1UE1 A;  3J80 f;  3M4O H;  3BG0 B;  2GVB A;  2EJG C;  1CUK A;  2MJ8 A;  3NDI A;  1A62 A;  2BDN A;  3LNN A;  2EYH A;  4GLA C;  4H13 C;  1G91 A;  1YIT Z;  1HFN A;  3S1M I;  2YV5 A;  2CCZ A;  3A7L A;  2JN4 A;  2I0Q A;  4B9W A;  1XNR L;  1TWH H;  5BN3 A;  2KEE A;  2RVL A;  4JI3 L;  4TVA B;  2A73 B;  3RNU A;  3S1R B;  4EWC A;  2OTJ 1;  1EL0 A;  3GQB A;  2Y0S E;  3ZJY C;  2PYK A;  4HMI A;  1F9Q A;  2DN8 A;  2AWO A;  3F3F C;  4PMC A;  4P75 A;  2AUJ D;  1N9W A;  5DEH A;  4QUC A;  4DV7 L;  1F77 A;  5EBC A;  1Q81 1;  5K36 H;  1Y1V B;  4A3G I;  2SDF A;  4YWM A;  3TSS A;  4Q5V A;  1WFQ A;  1ASZ A;  1LT3 D;  3FP9 A;  4TQU S;  4ZLT F;  2PZT A;  2PM9 A;  2ENB A;  2K3R A;  5IE8 A;  3S2D B;  2KHS A;  4R4T A;  4NFR A;  3OIQ A;  1TWC H;  3DM3 A;  1PXU A;  1F9P A;  1VQO A;  4MTK A;  1NUI A;  1HRJ A;  4X65 Q;  2AMC B;  4HSV A;  1SYC A;  3CCQ A;  1K0R A;  3OW7 A;  4YHH Q;  4LK1 C;  1N33 Q;  3D4W A;  4KY5 A;  1S5C D;  3FKI I;  3RZD H;  3I7F A;  4BA2 I;  2D5D A;  3JC6 6;  2CW0 D;  1AEX A;  4Z9C B;  2BDO A;  3GTM S;  4TKO B;  3JAM c;  4HGZ A;  3TN2 A;  3LGJ A;  5M3F H;  2L55 A;  3X3N A;  1TS3 A;  1WD1 A;  3HOU G;  2QDB A;  2VB2 X;  3BYY B;  4LUV A;  3RR5 A;  1TKW B;  5FLX b;  2SNS A;  3PUX A;  4NDX A;  2MNA A;  1WZN A;  1F2Y A;  3RZO I;  3SHL A;  1E1O A;  1JIC A;  4A3F G;  1I6H B;  3BVM A;  4A3F B;  1FDO A;  2NWG A;  5KGU A;  1S4Z A;  2UXC L;  3QOJ A;  5AN9 F;  2CFM A;  5C44 I;  4XT1 B;  1NE3 A;  2F0S A;  1S72 A;  4L5S A;  1PH1 A;  1N8R 1;  1Z03 A;  1X3Q A;  4JI5 L;  4LFB Q;  3TP5 A;  2B63 G;  2EXZ A;  4XYO A;  3GTP I;  1U4P A;  1PLF A;  4X65 L;  2A1A A;  3NH5 A;  1ICF B;  4KKS A;  3M4O I;  1S5F D;  3NK9 A;  3KUP A;  3N52 A;  1N33 L;  2QKD A;  2JIP A;  3NXW A;  3EA6 A;  1G8Z D;  1BVS A;  2QEX Z;  2VPY A;  1JE5 A;  3G6E Z;  4V19 0;  2EYP A;  1CZG A;  3FPP A;  1TWH I;  1NP6 A;  4X3U A;  2XRS D;  2LY7 A;  5EAY A;  2B8F A;  4QB4 A;  2P28 A;  4QQB X;  3P1H A;  4DGZ A;  3GP7 A;  3LX0 A;  4ZKC B;  4WFN 3;  4RGN A;  1ESR A;  1SNC A;  5CR3 A;  1K8A C;  1DXM A;  4A3D H;  3V05 A;  3UDI A;  4GNX C;  4A3K H;  1PTO H;  3DEO A;  4A3C H;  4AYB A;  1EY6 A;  2XWJ B;  2Q8T A;  5C4J H;  1AN8 A;  4R4I A;  5AJ3 Q;  1ICW A;  3E9H A;  3F2D A;  4JI7 Q;  2BH8 A;  3MC0 B;  5HGT A;  1VQ5 1;  2LS0 1;  2EJF C;  3QWN A;  4CJ0 B;  2EZV A;  1EY8 A;  3I4M H;  1TWC I;  3CCU A;  1SE4 A;  3K58 A;  3NQI A;  3J81 E;  3K5L A;  1JWM D;  1TVX A;  4FF3 A;  4DAY B;  3FPU B;  3AEV A;  4BXX H;  1OXX K;  1ZKO A;  2G9H D;  4ULL A;  3RZD I;  2K4K A;  3QJY A;  4BWG B;  1KAB A;  2WB1 G;  4A3J H;  2CKZ B;  5FO8 B;  5F2D A;  2Q2T A;  4BBR B;  2V3V A;  3NDJ A;  2B2Y C;  3J81 f;  5IWA Q;  4BBS H;  5T1I A;  1BR9 A;  5C3E H;  2IHF A;  4EQO A;  4RKB A;  4JBW A;  2A6E D;  3W1G A;  1HA6 A;  1V1P B;  1E1T A;  4CKE A;  1NR4 A;  1U5K A;  2R93 H;  1MSH A;  1VS0 A;  1Q12 A;  4QIW E;  3S15 B;  2VQF L;  5EKL A;  1II3 A;  2Y0S G;  3TEH B;  5IYB G;  1XNQ L;  2Y0S B;  5EKI A;  5FOB B;  4A93 H;  3CD6 Z;  5AJ3 L;  2VNU D;  2QA4 A;  1GXD C;  2F0U A;  1VQP 1;  3CME A;  5IIF A;  1M1K 2;  4JI7 L;  3I56 Z;  3G6J B;  4IOC A;  4BY7 G;  2JA7 G;  2W04 A;  1YJ9 A;  3D4R A;  1R4P B;  3TS0 A;  2QIL A;  5CMD A;  2JA7 B;  1YJW Z;  2JA6 H;  2RPR A;  1YIT 1;  3H94 A;  2QW7 A;  4L63 B;  1XTC D;  4R1J A;  5BN5 A;  3G4S Z;  1STB A;  1B2T A;  1WCM H;  1V1P A;  2KUM A;  2NTS A;  3CCQ Z;  4P71 A;  3HOZ G;  2E2I B;  2Z8L A;  1D5Z C;  4X62 L;  2LKV A;  2WIN B;  3HKZ A;  1F2M A;  1EFI D;  2B2W C;  5I2Y A;  1N8R C;  1E2V A;  1DL6 A;  3I4N G;  3ERQ A;  2Z4H A;  1AP0 A;  4ZK9 B;  1FD7 D;  1USP B;  3CCE Z;  1CQF A;  1MJC A;  3I4N B;  3PO3 G;  2TSS A;  5IGG A;  5IWA L;  4HJ9 A;  3T56 B;  3HOX B;  1DOL A;  2UUB Q;  3PO3 B;  4OEM B;  5A2Q E;  1IHZ A;  1V43 A;  4C1N I;  3VR2 A;  3C3L A;  4A3D I;  5M3M H;  4HED A;  3CC2 A;  2IX3 A;  1XPU A;  5D1O B;  1W2B Z;  1STH A;  4A3K I;  4A3C I;  3IFT A;  4L5Q A;  2UUA L;  2R3Z A;  5JJI A;  1VQD A;  3V96 A;  1VMC A;  5C4J I;  2PQA B;  5C4X I;  4HCE A;  3S9W A;  4APV A;  2IZ4 A;  2AKL A;  1Q3L A;  5ELO A;  2M00 A;  5IGC A;  4HID A;  1V8Q A;  2HQE A;  5A2Q f;  3W2D A;  3G71 1;  5DLQ E;  4NBC A;  1IKL A;  1Q1B A;  5ELN A;  1HNZ L;  1EWI A;  5EPL A;  3I4M I;  2UXD Q;  2EQS A;  2I5M X;  3SDZ A;  2F0T A;  1VF7 A;  1EYG A;  5KNC A;  1IL8 A;  3OWF A;  2MQH A;  4HN7 A;  4TSS A;  1AE2 A;  2ICI A;  3STB D;  4BXX I;  4FDB A;  5D1O A;  4OHJ A;  4UY8 C;  1YNN C;  3VB9 A;  1GOZ A;  4A3J I;  4C56 C;  1F9R A;  1FDI A;  2R92 G;  1SFO H;  2R92 B;  2BJO A;  3KLW A;  5JJK A;  3F2B A;  3IFU A;  4BBS I;  1BCP B;  1DGS A;  1VQM 1;  1JWU D;  1B50 A;  3PF5 A;  3CCM A;  4C3J B;  5C3E I;  1RF2 D;  1K73 1;  3LWU A;  4DR6 L;  3NBI A;  4E2Z A;  3PUY A;  4PV1 C;  4UP9 A;  4P2C B;  2UUB L;  2RBL A;  3H0G G;  5ELC A;  1HUM A;  3QG1 A;  1BBX C;  2L1B A;  3H0G B;  2PMZ A;  3M3Y H;  1IW7 C;  1P9N A;  1VQ4 Z;  5CV5 A;  3MA2 B;  1VQI A;  4K5X A;  4KD4 A;  5JEA G;  4RVH A;  2GA4 B;  1ZXT A;  2TMP A;  5M5X H;  4A93 I;  3MXN B;  1K8M A;  3SE0 A;  1OXV A;  2IPK D;  1K8O A;  2EY6 A;  1W3S A;  3TP7 A;  3W1B A;  2A68 C;  1J6Q A;  5EQ0 A;  4FF4 A;  3J80 i;  1E22 A;  1PFM A;  1Q86 2;  3AYH B;  5FKA C;  4HH4 A;  1VQ9 Z;  1SRO A;  3OW2 Y;  2QEX 1;  2JA6 I;  2DGY A;  1X3P A;  1MI2 A;  3G6E 1;  4JI0 Q;  2UXD L;  4K5V A;  2EE1 A;  1CKN A;  5T64 A;  4C3I H;  3CCU Z;  3ND9 A;  2F0K A;  3OW2 A;  1EYA A;  4IFD J;  1WCM I;  1YHB A;  1RQF A;  5LMU L;  1GUW A;  1Z01 A;  1JOK A;  2YTV A;  3E0E A;  1VQ7 Z;  2E74 C;  2KCN A;  2IV2 X;  2A74 C;  2M6N A;  4A3I H;  3S1Q B;  2NVX H;  3T1Y Q;  1DON A;  4JI6 Q;  1YHA A;  4JOI C;  4JI1 Q;  2B2U A;  4BY1 G;  4IOA A;  3S14 B;  1PRT C;  4N9P A;  4BY1 B;  4YCV A;  3P5J B;  3A55 A;  3NP8 A;  5IT9 E;  3K0X A;  2IL8 A;  5FO9 B;  2ES2 A;  4A3L G;  2DJF C;  4PNY A;  3RLF A;  2HU9 A;  4DK6 C;  1OXU A;  2UUC Q;  4KV6 A;  1RNI A;  1U4L A;  4IPD A;  1VQ8 Z;  1PYW D;  1VQ6 Z;  3J7A 4;  1AE3 A;  3HOW H;  5IT9 f;  3NEN A;  1H9S A;  4AQY Q;  3LUS A;  4QIW B;  1VMP A;  4DU9 A;  3I90 A;  4MH4 A;  4RV9 A;  1CZW A;  1VQ5 A;  1X56 A;  3K81 C;  4QUF A;  2D0O A;  2G5D A;  1YJ9 Z;  4RKL A;  1WYD A;  2WAQ G;  2VPX A;  3KDF B;  1C7Y A;  4A3B B;  1A2U A;  3VMH A;  4E31 A;  1WI5 A;  2RDG A;  3C2P A;  1CI3 M;  1QUQ B;  4LFA Q;  1ZYR C;  1A2T A;  3CCL A;  1SFO I;  2DUD A;  2E7Z A;  1RIP A;  2N49 A;  3T1Y L;  2JEB I;  1ENC A;  4JI6 L;  4JI1 L;  1SYB A;  4IFD G;  4XQJ A;  1GM5 A;  3CCS Z;  1Y1V S;  5FLM G;  2EJM A;  1JCK B;  3MXG A;  3GDE A;  2JA5 G;  3Q24 A;  1YNJ D;  5LMN L;  4JVZ A;  5JVH 3;  3I56 1;  2JA5 B;  2AQ3 B;  1WTH A;  2FFK B;  2VUM B;  3M3Y I;  3CC2 Z;  3R2I A;  3TP6 A;  2UXB Q;  1YJW 1;  1O7L A;  3M4P A;  3AMU A;  1VQO 1;  1EY9 A;  4A4I A;  1K73 C;  2RHB A;  1JJC B;  3PGZ A;  3CCQ 1;  1AH9 A;  1VQP A;  2B3G A;  1R9T B;  4AQY L;  2B2V C;  4K8I A;  4HSP A;  3S1R H;  4GS3 A;  5G3L D;  3EIV A;  4CGY B;  5D14 A;  2MPM A;  5IP7 G; 
#chains in the Genus database with same CATH homology
 4F87 A;  5EKK A;  3OMC A;  2OEO A;  4A3I I;  2NVX I;  2L12 A;  1YUK A;  4XIG S;  1E0B A;  1RDP D;  4EVO A;  1Q1E A;  3Q0A A;  3R93 A;  4FF2 A;  4E2X A;  3D9X A;  4KHZ A;  1RO0 A;  1L1O C;  1S5B D;  5DNF A;  3HG9 A;  2W03 A;  5CM2 M;  1ML8 A;  2F3V A;  1S72 1;  2O5I C;  5DAU A;  3HOW I;  4GZY C;  1SXT A;  3NUC A;  4NBF A;  1LTI D;  4ZRZ A;  1K8A 2;  4MXU A;  2MP1 A;  1WTW A;  3NH4 A;  3NBH A;  4RHS A;  5FLX E;  1F9S A;  4ODG A;  3EED A;  1BNZ A;  2K04 A;  2NBF A;  2WKD A;  3VTN A;  1QJO A;  1Q82 1;  1A3V A;  1O7Z A;  2JXM B;  2A6H D;  3SXH A;  1WTX A;  3BDL A;  3PO2 B;  1CA5 A;  3OW2 Z;  4DNR B;  2MUY A;  3K6O A;  4XDX A;  5FLX f;  4FXD A;  2RT9 A;  1S7M A;  2J6A A;  3RMH A;  4NB9 A;  3CU7 A;  1Q81 2;  4DF7 A;  4LJZ C;  1T5E A;  1SAP A;  1V1O A;  1STE A;  2B8G A;  5G3L F;  2E75 C;  2XRQ D;  1J9O A;  2RSO A;  2F4I A;  3SVM A;  1YUA A;  3NTI A;  4IQZ A;  3CCU 1;  4XT3 B;  3L9A X;  4IZ8 A;  3QWU A;  3EER A;  1KC8 1;  5M5W B;  1VQ7 1;  3CC7 Z;  3I70 A;  1JQY D;  4M1U B;  3FQM A;  4QMG A;  1F2Z A;  3HGB A;  3S1R I;  3W3A A;  2X6L A;  3U50 C;  2O4H A;  4G7O C;  2PK7 A;  1S5D D;  5J1Z A;  3MZL B;  1GUG A;  3KF8 A;  2H1E A;  3M7N A;  3FMC A;  2BA1 A;  4Y52 I;  5C0X G;  1Y1V I;  4E2Y A;  2BA0 A;  4XTC S;  1Y8O B;  3CCL Z;  1O78 A;  5CV7 A;  4FO2 A;  1FNV A;  2VXW A;  4DAP A;  4Y7N B;  4MIU A;  4M8A A;  3S2D I;  5COY A;  1DJR D;  3DUZ A;  1MGS A;  1JOO A;  1Z6H A;  1QNU A;  3M4Y A;  2QA4 1;  3CME 1;  1ENA A;  4S1T A;  5CYU A;  1WTV A;  2V8K A;  1N8R 2;  1YJ9 1;  3SK6 A;  3TME A;  1D6E C;  1TWA B;  3K59 A;  3GV6 A;  3TZU A;  5LL6 S;  2KQ3 A;  4FVM A;  2JUB A;  5I6Y A;  5NUC A;  3MXP A;  4QF4 A;  2RQX A;  2NVQ B;  4YIJ A;  1UEA B;  4FP5 D;  3HEJ A;  1TY2 A;  1VQK Z;  3Q87 A;  4CKB A;  3K0Y A;  1KD1 1;  1SEB D;  2F0H A;  2KEC A;  4R8I A;  3SK5 A;  5JJZ A;  4LMQ D;  1I6H I;  3CC2 1;  2FMM A;  5EGT A;  1K83 B;  1S5E D;  3KLS X;  3WOE A;  3D4D A;  5IOC A;  3GV3 A;  1TS4 A;  1BOS A;  3K7A B;  1Q8I A;  3EFX D;  5CV4 A;  1DZ1 A;  1X0T A;  4IUP A;  2B2T A;  4J6H A;  4KJN A;  3GTK B;  3G7L A;  5EPK A;  2F0I A;  2A6E C;  4I7Z C;  4RFB A;  5DM7 3;  4NW2 A;  1JB3 A;  3J7Y W;  1LQL A;  2KVM A;  1A6X A;  2JEA I;  4WRD A;  1PFB A;  1YJN Z;  3SR1 A;  3CCM 1;  3NWT A;  1W2B Y;  2JS4 A;  1EEI D;  2EGT A;  5D3D A;  1X32 A;  1BO0 A;  3CRK C;  3KBX A;  1KLG D;  4OO1 G;  4JK1 C;  1HUN A;  3HOU B;  3CCJ Z;  5ELE A;  3A8K E;  4KY6 A;  2NVT B;  4KD3 A;  1LO5 D;  1SE2 A;  2K05 A;  3HZX A;  2BCO A;  2J4X A;  4QTT A;  2K6A A;  3GO5 A;  4BBR I;  1G6Z A;  1ILQ A;  4C2M B;  1VQL Z;  2O53 A;  1NJI 1;  1RCV D;  3GTO B;  1FGB D;  2KJX A;  2B63 B;  2ZXR A;  3RUZ A;  2HF1 A;  3JAM L;  1SYF A;  2Q51 A;  3S15 I;  4KMU C;  2HDM A;  3F2U A;  5JEA H;  1WD0 A;  1HCZ A;  2WAC A;  4A3G B;  4NBG A;  1SNM A;  3P75 A;  3K57 A;  1KNA A;  2JA7 I;  3QOL A;  4HGY A;  1ZB8 A;  1PFN A;  4FF1 A;  4C3H G;  3PUZ A;  5LHY 1;  4C3H B;  2E2I I;  2KI7 B;  2OXP A;  1C48 A;  3MFG A;  2Q8I B;  3OIP A;  1KQS Z;  1LTB D;  2JYO A;  2BE5 D;  3I4N I;  3MON A;  4TNU A;  1QVG Z;  3D6C A;  3HOX I;  2G2K A;  3PO3 I;  2MHV A;  3CCL 1;  1JOR A;  2Q4Z A;  1AZQ A;  4WJW A;  4X3T A;  5CC4 A;  5CV6 A;  1K73 2;  2RA4 A;  3PIP 3;  2WB1 B;  3QO2 A;  5KND A;  4RCN A;  3CCV Z;  3I3C A;  3GTJ B;  2IWH A;  1FNW A;  2R61 A;  1I3Q B;  2FIN B;  3L3O C;  4IUU A;  1FR3 A;  3S17 B;  1G29 1;  3VR6 A;  4DAY A;  4H0L C;  1Y8N B;  3J80 b;  1U9R A;  1SMY C;  2V4D A;  4MHE A;  2JSO A;  2R92 I;  4BY7 B;  3JAM b;  2XIW A;  2AUK A;  5T6B A;  1SE3 A;  3HRZ C;  1B3A A;  2HCI A;  1K9M 1;  1C4Q A;  1PMR A;  2J7Z A;  3HOZ B;  2N88 A;  3H0G I;  1E2W A;  1VDZ A;  2Y0S A;  2DE7 A;  3CC4 Z;  1I4R A;  4E6I A;  3VA7 A;  4ZUJ A;  3DXJ C;  4F88 A;  2ZXO A;  2E2J B;  2F0V A;  1WTQ A;  4B08 A;  3TBI B;  3NTK A;  1X3Z A;  2VUG A;  2B2U C;  4OIK A;  1NR2 A;  1OXS C;  2WV6 D;  2KED A;  2NUC A;  2OT2 A;  3S16 B;  3I8Z A;  1RTO A;  1BQQ T;  1EZ6 A;  1PTO C;  1Y8P B;  4PMW A;  5CV8 A;  2EYL A;  3VR4 A;  3S1Q I;  2WP8 J;  2A5H A;  1B9N A;  2LFN A;  1EY5 A;  1USP A;  3CQZ B;  3S14 I;  4DA2 A;  2ZAE B;  4TRD A;  4BY1 I;  4E33 A;  1EY7 A;  3TE5 B;  4MRI A;  1LT4 D;  5KRU A;  1SNO A;  3TDQ A;  1YHQ Z;  2F0J A;  4G7Z C;  4A3L I;  4UAI A;  1QIL A;  1Q7Y 1;  2SEB D;  1ET6 A;  2ICE C;  5C3W A;  5I4D A;  1RJT A;  3D31 A;  1I4X A;  1DCZ A;  2R93 I;  2EPB A;  1ZH1 A;  2SOB A;  3K5N A;  3NSW A;  1PZI D;  1VQL 1;  4A3B I;  4OL7 A;  3PIO 3;  2D2C C;  2GTH A;  2NN6 G;  3NHH A;  1VCI A;  4RGO S;  1TWG B;  3EQL C;  2H85 A;  2Q8R E;  3NWS A;  1STA A;  3GTM B;  1ZEQ X;  1QYP A;  1RD9 D;  3DWA A;  4DK0 A;  1H9J A;  2KA7 A;  5FLM I;  1BXT A;  4OIJ A;  2JA5 I;  2VUM I;  4RH6 A;  1O80 A;  2JMO A;  1KRL A;  4RGM A;  3MXN A;  3NPP A;  1TII D;  5IGB A;  2EDG A;  5C4X B;  1MSG A;  4HCS A;  3DWP A;  1SDF A;  2JP1 A;  1R9T I;  1EEF D;  2PW7 A;  4F8M A;  1KNE A;  1A3U A;  5J39 A;  1BCP D;  2K01 A;  2F0Q A;  2A6H C;  1EWH A;  5A2Q L;  1YIJ Z;  1CQV A;  1Q82 2;  3TP8 A;  3BZD B;  3GD7 A;  1TR5 A;  5C0X H;  2RKS A;  4KN7 C;  3J81 b;  3AB9 A;  2WAQ B;  4I65 A;  2X69 A;  4CJ2 C;  3DHQ A;  2M2L A;  1IKM A;  4QTU A;  1G2T A;  2NZ1 D;  1I4G A;  3S1N B;  3FDT A;  2XN9 C;  1GHJ A;  3CD6 1;  5CV9 A;  4NBA A;  1TFI A;  4A3E B;  2K28 A;  5T1G A;  3OHX C;  4NBD A;  1C8C A;  3A8I E;  1KC8 2;  2K5R A;  1D1K A;  1QNK A;  2WAQ A;  4G4K A;  1WTO A;  1LTA D;  2E76 C;  2IX0 A;  3G4S 1;  3PO2 I;  4HTH A;  3ZYY X;  4DN4 M;  1GHK A;  1EQT A;  1AW7 A;  5COR A;  1LTG D;  2HUG A;  1MBY A;  4U67 3;  4CL1 A;  5I9O A;  5M5Y B;  1PRT B;  5C4Z A;  3HOY B;  4DQY B;  5D1P A;  3M7G A;  1YNN D;  1HTP A;  2K33 A;  3CCE 1;  4WOR A;  3MAQ A;  1BCP F;  3GTL B;  1ZB9 A;  1CTM A;  1LV9 A;  4V0B A;  2LMC B;  1RO4 A;  5BN4 A;  1EYC A;  4K6D A;  3S2H B;  2QF7 A;  2QRC B;  1IW7 D;  3IL8 A;  1B4O A;  2PPB C;  5A2Q b;  2OOY B;  2LFU A;  2A69 D;  3SK4 A;  1FNU A;  4O42 A;  3IAY A;  2A68 D;  5IT9 L;  1JE4 A;  2EYF A;  2AQ1 B;  3ESW A;  2PZU A;  2RBM A;  1YHQ 1;  1SYE A;  3D3R A;  1G2S A;  5C0X I;  4IUR A;  2YU9 B;  2V8J A;  1FYC A;  5C6A A;  2E2H B;  4KTA A;  3NH8 A;  4Y7N I;  1L0Y B;  4MON A;  4OO1 H;  5K5P A;  1QE6 A;  1L0X B;  4O1N A;  3CCR Z;  1PRT D;  2F0W A;  3UI2 A;  1HPC A;  3X3M A;  3NTH A;  1VF5 C;  1VQ4 1;  1UUP A;  3TZD A;  1DOM A;  2G9D A;  1TWA I;  2FJ2 A;  2L0C A;  3QB3 A;  3T4A C;  1CT1 D;  2GU2 A;  2E9H A;  3K5O A;  3VR5 A;  4G57 A;  5E4X A;  4EQN A;  1PDQ A;  3C1E A;  1VQ9 1;  1WII A;  2NVQ I;  1LAC A;  2VB3 X;  2FHT A;  2PCF B;  2CW0 C;  1Y1W B;  4B9X A;  5I9P A;  2F1M A;  1EIH A;  3OOC A;  1QF8 A;  4K8J A;  3BVG A;  1W6J A;  1HTL D;  3E5S A;  1K83 I;  1PZK D;  1ZYR D;  1PFT A;  1PZJ D;  1YI2 Z;  2WKC A;  4S3S A;  1KLU D;  5EPJ A;  1I50 B;  5T67 A;  1CM9 A;  4OGQ C;  3K7A I;  2QEJ C;  4KKT A;  3MXU A;  4MD9 A;  1RLY A;  3MVV A;  5ISR A;  1ESF A;  3I07 A;  3H3V C;  1QWY A;  2OTL Z;  1VQ8 1;  2ZXP A;  3GTK I;  1VQ6 1;  1XX8 A;  1LTS D;  4KHV A;  4RA8 A;  1EY0 A;  3WOF A;  3NFZ A;  1YIJ 1;  5IT9 b;  3H3V J;  1UNS A;  4CKC A;  3BDC A;  3MZK B;  1LT6 D;  1ENF A;  1KQS Y;  4ILW A;  4IN3 A;  2R6M A;  1OO9 B;  2AQ2 B;  2PW5 A;  1NJI 2;  3FQQ A;  1QVG Y;  5ELD A;  2OOX B;  2QLV B;  1SYG A;  1HA5 A;  1PRT F;  1SBB B;  3CMA Z;  1SSO A;  2K5W A;  5IGD A;  1JC7 A;  2F03 A;  4XQN A;  1GUT A;  3A56 A;  1EOT A;  4UDU C;  2R7Z B;  4XQQ A;  1SNQ A;  3DWQ A;  2NVY B;  4NKL A;  2QRE B;  3I72 A;  3E6Z X;  4OO1 I;  3HOU I;  1F2L A;  2IX1 A;  3CCS 1;  3PO3 S;  3F3P C;  2NVT I;  2J0T D;  3JAM E;  1M90 1;  3T53 B;  4A3F I;  1LTR D;  1NAP A;  1JJ2 Y;  5D3I B;  3SEB A;  4MD7 A;  2BOS A;  2KOL A;  3C46 A;  3MHB A;  2BE5 C;  1K8A 1;  2F0E A;  3HOV B;  1GUS A;  4IAL A;  3GTO I;  2JA8 B;  3JAM f;  1BF4 A;  5E4W C;  2B63 I;  2I46 A;  1QCB D;  2EY1 A;  2F0O A;  5LL6 X;  1CFM A;  1MD2 D;  2DE5 A;  1STG A;  3ITP A;  5EBD A;  3KIF A;  1DYQ A;  3BG3 A;  3I55 Z;  3A54 A;  3DEP A;  1WVL A;  5JAV A;  1GUN A;  4IUQ A;  3GTQ B;  1KAA A;  3EVQ A;  5CGK A;  3Q22 A;  2O2L D;  4U68 A;  1OXT A;  3VR3 A;  1GJX A;  5DM6 3;  3G71 Z;  3T13 A;  1AFP A;  5IGE A;  1CHQ D;  5LL6 f;  2XWB B;  2Z4I A;  4FXG C;  3D6W A;  1TWF B;  2O5J C;  2KPI A;  2IZ3 A;  4A3M B;  1JWH C;  2F0D A;  2IW3 A;  2F0N A;  5C3X A;  3GTG B;  1K9M 2;  5JVG 3;  3P20 A;  1IYU A;  2DNC A;  1D1I A;  3CCR 1;  3J80 L;  3AU7 A;  2ZT9 C;  5KNB A;  3K5M A;  3S1M B;  1VQM Z;  2K03 A;  3PUV A;  3GTJ I;  4ZQ3 A;  4XX2 A;  2EY5 A;  3BG1 B;  3ONA B;  1BDO A;  1I3Q I;  5JOB A;  1ILP A;  2HCC A;  3S17 I;  1J8I A;  3OWE B;  4AYB B;  1Z7T A;  5KYL A;  2F4M A;  4CBV A;  2NN6 H;  3T16 A;  2EVB A;  4BY7 I;  3CXC Z;  1ML0 D;  2K5Q A;  3CC7 1;  1QG7 A;  3MTS A;  1EQV A;  3VA5 A;  1N2F A;  2M9V A;  2XSC A;  3R3O A;  1EU4 A;  5I2X A;  2DNE A;  3U9O A;  5CBE E;  3J7A F;  1CHP D;  2K7V A;  1YI2 1;  3HOZ I;  1H9R A;  2K1B A;  4K14 A;  4FYD A;  2EOT A;  3BS1 A;  4KY7 A;  5IP9 I;  2C9O A;  3MEH A;  2GTI A;  3FKI B;  1SJE D;  1XXG A;  2E2J I;  3O13 A;  2OF1 A;  4K5W A;  1Q7Y 2;  2OTL 1;  1D5X C;  2R6G A;  5IOD A;  4RCO A;  2DY8 A;  3S16 I;  4MD8 A;  4DNT B;  3RZO B;  1AZP A;  4DAV A;  2PQE A;  3CMA 1;  1H9M A;  3CQZ I;  3SK8 A;  5C44 B;  1HHV A;  2YAD A;  1JJ2 Z;  3MWY W;  2NB0 A;  4E2W A;  3BYT B;  4L8J A;  2I3C A;  2F0M A;  3GTP B;  4ZUI A;  3M85 A;  3CPW Y;  5ELF A;  2EYM A;  2WB1 A;  3M4O B;  1ONL A;  5I6W A;  2D9U A;  3OSO A;  4HAE A;  2LIY A;  1VQK 1;  3DM1 A;  1QB5 D;  5KIX A;  5J22 A;  3HKZ B;  1A15 A;  4RVD A;  1RHP A;  2H4O A;  1TWH B;  4ZYS A;  4IFD H;  2D62 A;  3BVZ A;  1VLA A;  2L4N A;  1BCP C;  1UAP A;  3P7J A;  4ABN A;  2I07 B;  1TS5 A;  5EJW A;  4ZKB B;  4XYQ A;  4E32 A;  3T4N B;  3V2T A;  5D65 A;  1DM0 B;  3HP3 A;  2QRD B;  2F0F A;  5K36 G;  1VQO Z;  3NQT A;  1TWG I;  1QOH A;  2NN6 I;  1X3W A;  3GTM I;  4NBB A;  1Q90 A;  1TWC B;  5JEA J;  5E1F A;  4KN4 C;  3I55 1;  3KLS A;  4DXG A;  2CHB D;  3FRP B;  4DGL A;  3OMG A;  1YJN 1;  3RZD B;  5KYI A;  2QKI C;  3A8J E;  3IF8 A;  1YNJ C;  4FXK C;  2QCP X;  1B1Z A;  1I6V C;  3IKJ A;  5M3F B;  2K32 A;  1DOK A;  3J81 L;  4PMB A;  1ET9 A;  2CQA A;  3VMG A;  3CCJ 1;  3PV0 A;  4KK7 A;  2PMZ B;  1S72 Z;  1TY0 A;  4NH1 C;  5A35 A;  2B2Y A;  1NSN S;  1RKN A;  2IT1 A;  2C5C A;  3URY A;  3GCF A;  4RWS C;  4Q0F A;  4C3J G;  1H9K A;  3VYR A;  1JOQ A;  4NBH A;  4G7H C;  5JPM C;  2HDL A;  2VF1 A;  3S1N I;  1VQN Z;  3IX0 A;  1BUV T;  1SNP A;  4DXF A;  4QCL A;  4IFD I;  3CHB D;  3MZ5 A;  4A3E I;  2A69 C;  1A3T A;  3HS0 C;  4PQX A;  4H7B A;  4A3D B;  2F0L A;  1SND A;  3Q6S A;  4A3K B;  1PTO B;  4IUN A;  3U9S A;  1KDC A;  1M1K 1;  5C4J B;  2JNY A;  1HQM C;  2B2W A;  3KBG A;  1TQO A;  2N55 A;  5C5L A;  3HOY I;  1H9S B;  2RDF A;  1SMY D;  3KK7 A;  1B9M A;  4FNF A;  3I4M B;  5C4H A;  5IP7 I;  4K2L A;  3FVQ A;  5FO7 B;  4KI0 A;  1TS2 A;  2PNR C;  1HFG A;  3KIH A;  1W6K A;  3GTL I;  4N9T A;  1GUO A;  4RHR A;  1RO2 A;  1TT2 A;  5HUR A;  2NYZ D;  4A3J B;  4EQP A;  1EIG A;  1JWS D;  2JR6 A;  3CCV 1;  3S2H I;  1KDA A;  5IGF A;  3CPW Z;  2ID0 A;  1QVF Y;  4BBS B;  4J8Q A;  1HQR D;  5C3E B;  4KKU A;  3KLR A;  4HMJ A;  1LT5 D;  2QA4 Z;  3CME Z;  1O7Y A;  2EYO A;  2IJ0 A;  3PMF A;  4RAU C;  5KEE A;  2R93 B;  4IUV A;  3PUW A;  4NP5 A;  2YYZ A;  1B44 D;  4A93 B;  2PZW A;  1D2B A;  1PTO D;  4XXE A;  2YU9 I;  1M4V A;  2E2D C;  2E2H I;  1RTN A;  1JR0 D;  2V8I A;  2XNA C;  2JA6 B;  1I4P A;  2X6G A;  1CK1 A;  3EJI A;  1EY4 A;  2AWN A;  1R4Q B;  4MN3 A;  2FMC A;  1WCM B;  2RIQ A;  1EWC A;  1LTT D;  4DFA A;  1SJH D;  3E0J A;  4RS4 A;  2OTJ Z;  3C1F A;  2L11 A;  3CC4 1;  1KDB A;  3OPO A;  4ME5 A;  5E3F A;  1B53 A;  2KCC A;  2F0G A;  1WTP A;  3WDN A;  5M3M B;  2O4X A;  3D8G A;  3MFY A;  3H91 A;  1Y1W I;  4X3K A;  1LLR D;  4KJO A;  1Q86 1;  3R8B A;  1SYD A;  3NE5 B;  2MGS A;  4NOZ A;  1I50 I;  2JE6 I;  4CHT B;  2K5D A;  3I91 A;  2PO4 A;  3CCM Z;  3VYS A;  1XWE A;  3I4L A;  4RGT A;  5TSS A;  1SFO B;  1KD1 2;  2RDH A;  1M90 2;  3R2T A;  5C5M A;  4X3S A;  1LAB A;  4F7X A;  2XVS A;  1PTO F;  2RSN A;  5C0X J;  1CA6 A;  4EGV A;  3Q23 A;  2QR1 B;  4RVF A;  3M3Y B;  1EZ8 A;  4L6T B;  1STY A;  2B39 A;  2SNM A;  3CRL C;  4K6L A;  4R8N A;  5M5X B;  3ERO A;  3I73 A;  1WW9 A;  3LWE A;  2DE6 A;  3J7A V;  4BA1 I;  2R7Z I;  3H6M A;  2EYJ A;  3ND8 A;  2NVY I;  1VQN 1;  3FEW X;  4C3I G;  3T51 B;  3CKI B;  3IFD A;  4C3I B;  3H09 A;  4RVG A;  2B2T C;  4DK1 A;  1ROD A;  2F0P A;  4A3I B;  2NVX B;  4NB8 A;  2L5T A;  3DMU A;  1HXY D;  4C1N K;  2DY7 A;  1Z02 A;  2B2V A;  3HOV I;  2WII B;  4NMZ A;  2JA8 I;  4NBE A;  1NCV A;  1EU3 A;  1STN A;  1IYV A;  3CXC Y;  1D5M C;  1TU2 B;  1QVF Z;  3BDO A;  4X6A I;  5M9O A;  4HR7 B;  4ZAI A;  1I4H A;  2CVR A;  4J1M A;  1VQ5 Z;  4K2K A;  2Z1C A;  4IUT A;  1XYI A;  3HOW B;  5ELB A;  2P3Y A;  5FK9 C;  3RD4 A;  2OZK A;  3GKQ A;  1KTK A;  3GTQ I;  3VYU A;  3L7Z C;  2F3W A;  3A7A B;  1I4Q A;  3VYT A;  3QIA A;  1M8A A;  5AFW A;  4BS9 A;  4ID6 A;  1WTR A;  1T5X D;  5CBA E;  1NUC A;  2F4O A;  4CJ1 B;  5JPN C;  4H44 C;  1Z47 A;  1U4R A;  3J80 E;  5FLX L;  3N6R A;  1DD2 A;  1EYD A;  1TWF I;  3VMI A;  1Y69 U;  2M48 A;  4LAA A;  4A3M I;  2EY2 A;  4E30 A;  1U4M A;  4R9W A;  2NTT A;  2L9H A;  1E2Z A;  1VQP Z;  3TDH B;  3GTG I;  3J80 f;  3BG0 B;  2EJG C;  2MJ8 A;  3NDI A;  2BDN A;  3LNN A;  1G91 A;  2EYH A;  4H13 C;  1YIT Z;  1HFN A;  3S1M I;  3A7L A;  4B9W A;  5BN3 A;  2KEE A;  2RVL A;  2A73 B;  3S1R B;  4EWC A;  2OTJ 1;  1EL0 A;  3GQB A;  2PYK A;  4HMI A;  1F9Q A;  2DN8 A;  2AWO A;  3F3F C;  4PMC A;  2AUJ D;  5DEH A;  4QUC A;  1F77 A;  5EBC A;  1Q81 1;  5K36 H;  1Y1V B;  4A3G I;  2SDF A;  3TSS A;  4Q5V A;  1LT3 D;  4TQU S;  4ZLT F;  2PZT A;  2PM9 A;  2ENB A;  2K3R A;  3S2D B;  2KHS A;  4NFR A;  3OIQ A;  1PXU A;  1F9P A;  1NUI A;  1HRJ A;  4HSV A;  1SYC A;  3OW7 A;  4LK1 C;  3D4W A;  4KY5 A;  1S5C D;  3FKI I;  4BA2 I;  2D5D A;  2CW0 D;  1AEX A;  4Z9C B;  2BDO A;  3GTM S;  4TKO B;  4HGZ A;  3TN2 A;  2L55 A;  3X3N A;  1TS3 A;  1WD1 A;  2QDB A;  2VB2 X;  3BYY B;  1TKW B;  5FLX b;  2SNS A;  3PUX A;  4NDX A;  1F2Y A;  3RZO I;  3SHL A;  1JIC A;  1I6H B;  3BVM A;  4A3F B;  2NWG A;  5KGU A;  1S4Z A;  3QOJ A;  5AN9 F;  4XT1 B;  5C44 I;  2F0S A;  1N8R 1;  1Z03 A;  1X3Q A;  3TP5 A;  2EXZ A;  4XYO A;  3GTP I;  1U4P A;  1PLF A;  3NH5 A;  4KKS A;  3M4O I;  1S5F D;  3NK9 A;  3KUP A;  3N52 A;  2QKD A;  3NXW A;  3EA6 A;  1G8Z D;  2QEX Z;  3G6E Z;  4V19 0;  2EYP A;  1CZG A;  3FPP A;  1TWH I;  1NP6 A;  4X3U A;  2XRS D;  2LY7 A;  2B8F A;  4QB4 A;  2P28 A;  3P1H A;  4DGZ A;  3GP7 A;  3LX0 A;  4ZKC B;  4WFN 3;  4RGN A;  1ESR A;  1SNC A;  5CR3 A;  1DXM A;  3V05 A;  1PTO H;  3DEO A;  4AYB A;  1EY6 A;  2XWJ B;  2Q8T A;  1AN8 A;  1ICW A;  3MC0 B;  5HGT A;  1VQ5 1;  2LS0 1;  2EJF C;  3QWN A;  4CJ0 B;  2EZV A;  1EY8 A;  1TWC I;  1SE4 A;  3K58 A;  3NQI A;  3J81 E;  3K5L A;  1JWM D;  1TVX A;  4FF3 A;  3FPU B;  1OXX K;  1ZKO A;  2G9H D;  4ULL A;  3RZD I;  3QJY A;  4BWG B;  1KAB A;  5FO8 B;  5F2D A;  4BBR B;  3NDJ A;  2B2Y C;  3J81 f;  5T1I A;  1BR9 A;  4EQO A;  4RKB A;  4JBW A;  2A6E D;  1HA6 A;  1V1P B;  4CKE A;  1NR4 A;  1MSH A;  1Q12 A;  3S15 B;  5EKL A;  1II3 A;  2Y0S B;  5EKI A;  5FOB B;  3CD6 Z;  2VNU D;  1GXD C;  2F0U A;  1VQP 1;  5IIF A;  1M1K 2;  3I56 Z;  3G6J B;  2W04 A;  3D4R A;  1R4P B;  2QIL A;  5CMD A;  2JA7 B;  1YJW Z;  2RPR A;  1YIT 1;  3H94 A;  4L63 B;  1XTC D;  5BN5 A;  3G4S Z;  1STB A;  1B2T A;  1V1P A;  2KUM A;  2NTS A;  3CCQ Z;  2E2I B;  2Z8L A;  1D5Z C;  2LKV A;  2WIN B;  3HKZ A;  1F2M A;  1EFI D;  2B2W C;  5I2Y A;  1E2V A;  1DL6 A;  3ERQ A;  2Z4H A;  1AP0 A;  4ZK9 B;  1FD7 D;  1USP B;  3CCE Z;  1CQF A;  3I4N B;  2TSS A;  5IGG A;  3HOX B;  3T56 B;  1DOL A;  3PO3 B;  5A2Q E;  1IHZ A;  1V43 A;  4C1N I;  3VR2 A;  3C3L A;  4A3D I;  4HED A;  2IX3 A;  5D1O B;  1W2B Z;  4A3K I;  4A3C I;  3IFT A;  1STH A;  2R3Z A;  3V96 A;  1VMC A;  5C4J I;  4HCE A;  5C4X I;  3S9W A;  2IZ4 A;  2AKL A;  1Q3L A;  2M00 A;  5IGC A;  1V8Q A;  2HQE A;  5A2Q f;  3W2D A;  3G71 1;  4NBC A;  1IKL A;  1Q1B A;  5EPL A;  3I4M I;  3SDZ A;  2F0T A;  1VF7 A;  5KNC A;  1IL8 A;  3OWF A;  4HN7 A;  4TSS A;  2ICI A;  4BXX I;  5D1O A;  4OHJ A;  1YNN C;  3VB9 A;  1GOZ A;  4A3J I;  4C56 C;  1F9R A;  2R92 B;  2BJO A;  3IFU A;  4BBS I;  1BCP B;  1JWU D;  1VQM 1;  1B50 A;  4C3J B;  5C3E I;  1RF2 D;  1K73 1;  3LWU A;  3NBI A;  4E2Z A;  3PUY A;  4PV1 C;  4P2C B;  2RBL A;  5ELC A;  1HUM A;  3QG1 A;  1BBX C;  2L1B A;  3H0G B;  2PMZ A;  1IW7 C;  1P9N A;  1VQ4 Z;  5CV5 A;  3MA2 B;  4K5X A;  4KD4 A;  5JEA G;  4RVH A;  2GA4 B;  1ZXT A;  2TMP A;  4A93 I;  1K8M A;  3SE0 A;  1OXV A;  2IPK D;  1K8O A;  2EY6 A;  3TP7 A;  2A68 C;  5EQ0 A;  4FF4 A;  1PFM A;  1Q86 2;  5FKA C;  4HH4 A;  1VQ9 Z;  3OW2 Y;  2QEX 1;  2JA6 I;  1X3P A;  1MI2 A;  3G6E 1;  4K5V A;  2EE1 A;  5T64 A;  3CCU Z;  3ND9 A;  2F0K A;  1EYA A;  4IFD J;  1WCM I;  1RQF A;  1GUW A;  1Z01 A;  1JOK A;  1VQ7 Z;  2E74 C;  2KCN A;  2A74 C;  2M6N A;  3S1Q B;  1DON A;  2B2U A;  3S14 B;  1PRT C;  4N9P A;  4BY1 B;  3P5J B;  3A55 A;  3NP8 A;  5IT9 E;  2IL8 A;  5FO9 B;  4PNY A;  3RLF A;  2HU9 A;  1OXU A;  4KV6 A;  1RNI A;  1U4L A;  1VQ8 Z;  1PYW D;  1VQ6 Z;  3J7A 4;  5IT9 f;  1H9S A;  3LUS A;  4QIW B;  1VMP A;  4DU9 A;  3I90 A;  4MH4 A;  4RV9 A;  1CZW A;  4QUF A;  1YJ9 Z;  4RKL A;  4A3B B;  1A2U A;  2RDG A;  3VMH A;  4E31 A;  3C2P A;  1CI3 M;  1ZYR C;  1A2T A;  1SFO I;  2JEB I;  1ENC A;  1SYB A;  4IFD G;  4XQJ A;  3CCS Z;  1Y1V S;  2EJM A;  1JCK B;  3MXG A;  3Q24 A;  1YNJ D;  5JVH 3;  3I56 1;  2JA5 B;  2AQ3 B;  2FFK B;  2VUM B;  3M3Y I;  3CC2 Z;  3R2I A;  3TP6 A;  1YJW 1;  1O7L A;  3AMU A;  1VQO 1;  1EY9 A;  2RHB A;  3CCQ 1;  1R9T B;  2B2V C;  4K8I A;  4HSP A;  5G3L D;  4CGY B;  5D14 A;  2MPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...