3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
b'GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting/DNA response regulator
publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Dna binding protein
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
2CVRA 2DE7A 2K01A 1DOKA 4BXXI 2MJ8A 4IUUA 4NBAA 4CJ2C 2HCCA 1EQTA 5E4WC 4XDXA 1I6HI 1G2SA 3GTOI 5CMDA 2FJ2A 3FKII 5CORA 2HDMA 1J9OA 2E2II 1X32A 3H91A 2J6AA 1JE4A 3MWYW 5FLMI 5D14A 1SFOI 4BBSI 2JR6A 5E4XA 1IKMA 4ZKCB 2JA7I 2J7ZA 1JICA 1MGSA 2NWGA 1VLAA 1RHPA 1I3QI 3H0GI 4XX2A 3HOXI 4IURA 1X3ZA 3GTMS 5IP9I 2B63I 1NR2A 5AFWA 4RA8A 4BY1I 1BNZA 4BY7I 2BDNA 1WW9A 5C3EI 1EL0A 4XT3B 1RLYA 4A3II 3GV3A 2KECA 1C8CA 3PO3S 1SDFA 2B2UC 1ICWA 2X69A 1NCVA 1MSGA 5JJZA 2R92I 4A3LI 2AKLA 3GTQI 1EOTA 3S1MI 2VUMI 1HFGA 4HAEA 2DY7A 4HEDA 3R93A 3DEOA 3S1RI 4NBFA 2L1BA 1RJTA 1F9RA 1WTWA 1WTRA 3SVMA 3Q6SA 2MP1A 1L1OC 1HUMA 3HOYI 2NYZD 2F4MA 1TWGI 4NBHA 3VB9A 3HP3A 4HCSA 2RSNA 2NZ1D 4U68A 2B2TC 1CA5A 3U50C 1NR4A 3GV6A 3LWEA 5CBEE 4OIKA 1XX8A 4NW2A 3LUSA 2F4OA 1EIHA 1VMPA 2R3ZA 1WVLA 2KUMA 1U4MA 1RTOA 2RVLA 2IL8A 2X6LA 3HOUI 4A93I 1ZB9A 2KPIA 2KOLA 1USPA 1QG7A 1U4RA 1QYPA 1ILPA 5C4XI 1F9QA 1AP0A 1I50I 2HCIA 1LV9A 5C44I 1PFNA 4R8IA 2KEDA 5C4JI 2JYOA 1CA6A 5EKIA 3M4OI 2RBLA 3RZDI 2N88A 4A3MI 2B2VC 2MGSA 4IUPA 3S15I 5EQ0A 2PK7A 1WCMI 5COYA 1ESRA 3GTPI 3KUPA 4A3BI 2B2WC 1R9TI 1HFNA 2JS4A 5IP7I 1HUNA 2FMMA 2Q8TA 3CQZI 1TFIA 3GTKI 2HUGA 3H3VJ 2FFKB 2JA8I 1X3PA 2K05A 2E2HI 4DN4M 4NB8A 3HOVI 2L9HA 3G7LA 4O42A 1WD1A 3S2DI 4OIJA 5T1IA 2HDLA 1F9PA 4RAUC 3ONAB 1SAPA 1F9SA 4X3SA 2M2LA 1ILQA 1G91A 3S1QI 1BBXC 2B2YC 1BO0A 1DL6A 3GTLI 1PFTA 1O7YA 3UI2A 3I07A 3GTJI 3ESWA 1HHVA 4NB9A 2D9UA 3S2HI 2L4NA 1X3QA 2KVMA 1NUIA 4NBEA 1WTVA 1WTOA 2K04A 1S4ZA 5EPJA 1WTXA 5CBAE 3VMIA 4IUQA 3MTSA 2NVXI 1G6ZA 2JNYA 3TZDA 3FPUB 1U4PA 2L11A 5EPKA 1Y1VI 2NVQI 4Y52I 4RWSC 1X3WA 1HA6A 1B3AA 4ZKBB 3HOZI 3IL8A 3VMGA 2JA6I 2RSOA 2H1EA 1MSHA 4X3KA 4LMQD 1M8AA 4IUTA 1G2TA 1DONA 2XIWA 3P7JA 2SDFA 3EERA 3S17I 1CM9A 1AZQA 1WTPA 2NVYI 2HF1A 1RODA 2EOTA 1E0BA 1QE6A 3KBXA 4NBDA 4X3TA 4NOZA 1PDQA 1GUWA 1B2TA 1F2LA 2K03A 1RO4A 2EPBA 1BF4A 3RZOI 4BBRI 4NBCA 3PO2I 1K83I 2KEEA 3S14I 2L12A 2MPMA 2B2VA 3GTGI 3Q87A 1SSOA 4NBBA 4QTTA 1AZPA 3I8ZA 1PLFA 4IUVA 1KNEA 2DE6A 1LQLA 4XT1B 1TWHI 2B2WA 3FDTA 3S1NI 1Y1VS 2Q8RE 4UAIA 3TN2A 1TWCI 1TWFI 1YUAA 4Y7NI 2NVTI 3I91A 1Y1WI 5T1GA 1PFBA 1B4OA 1EIGA 3IFDA 2EE1A 1XYIA 5EPLA 4A3DI 5CM2M 4X3UA 2B2UA 1KNAA 4QUFA 1MI2A 1A15A 4MHEA 1IKLA 1TVXA 3DEPA 3M3YI 3F2UA 4MN3A 2B2YA 1U4LA 2VXWA 2RA4A 1B50A 3K7AI 4A3CI 1IL8A 1PFMA 4ZK9B 1N2FA 4ZLTF 3I4MI 2YU9I 2N55A 5DNFA 5D65A 4HSVA 4A3GI 2BJOA 3QO2A 2DY8A 4CJ1B 2JA5I 1USPB 3DM1A 1NAPA 1ML8A 2X6GA 2B2TA 2DE5A 3S16I 1WTQA 1RTNA 4QUCA 4X6AI 3D6WA 1DOLA 4A3KI 5EJWA 1VMCA 1B53A 2K1BA 3GCFA 1HRJA 4NBGA 1QNKA 4A3EI 1ZXTA 1J8IA 3GKQA 2FHTA 4MH4A 2R7ZI 1WD0A 4R9WA 1O7ZA 3N52A 4A3JI 3GTMI 1DZ1A 3VMHA 2K28A 4ZAIA 1DOMA 4CJ0B 2P3YA 3HOWI 3I90A 4A3FI 4QTUA 1O80A 2R93I 3I3CA 1ML0D 3PO3I 3I4NI 2JP1A 1Q3LA 1TWAI 2FINB 1ZB8A 2E2JI 2K5RA
chains in the Genus database with same CATH superfamily
2F0SA 4DUYQ 3W2DA 2EYFA 4AQYQ 4IUUA 1J6QA 1DOKA 4CJ2C 3G71Z 1PZKD 1GKHA 1EQTA 1Q46A 5IP7H 1YJWZ 3I4NG 1II3A 3S1NH 2K33A 3CXCZ 1M1K2 1I6HI 1JQYD 1CI3M 4Y7NH 3GTOI 2UUAL 5CMDA 2FJ2A 1YNNC 1Y1WH 1S5FD 2HD3A 1BBUA 1X32A 3K5OA 3JAMf 2ENBA 1VQAA 3PF4A 5C0XH 5D14A 3CPFA 1BCPB 4DR4L 1OXSC 1EEID 3SGIA 3PGZA 3JAML 5IIFA 2JA7I 2ZM6L 2L15A 3D31A 1JICA 2YYZA 3CC7A 4JOIA 4P71A 5FLMG 1PH4A 2QA41 4HH4A 2Q2UA 2KCCA 2Z6KC 4NXML 2A1AA 2Z4IA 1M1KC 4IURA 5F2DA 4XQNA 1PH9A 1VQO1 4OELB 3W1BA 1DCZA 3PF5A 4L5RC 1NR2A 3K7AH 1OXUA 4XQQA 1EYAA 4RA8A 2JEAI 1JJGA 4J15A 1VQJA 1N34Q 1GXDC 1VQ81 1STNA 2F0GA 4XT3B 1SYFA 1SE4A 4C3HB 4DV2Q 4A3II 2C35B 5IP9G 1PYBA 1B1ZA 1N36L 4RKLA 1W2BY 3TP8A 2VNUD 3MVVA 2B2UC 1HTPA 4G7ZC 1GOZA 2CW0D 1CK1A 2JA5H 5C3EG 4UP8A 2HIXA 4KHVA 5JJZA 4DUZL 2ZJQA 1TS3A 4M1UB 4GLXA 3MXGA 4GKJQ 1EOTA 3MXPA 4IUNA 4GOPC 2DJFC 3S1MI 1HPCA 2ZXPA 1H9MA 4HAEA 4ZYSA 1VQ5A 1XNQL 4A3KH 4HEDA 1Q862 3DEOA 3S1RI 2R92G 4JCVE 1PTOC 1WTWA 2WAQB 1V1OA 3NENA 4R4IA 1KIXA 1JJ2Z 3HOYI 2DNEA 2PQEA 2QGQA 1UE5A 1Y14B 1VQ61 3J81i 2R6MA 2E2JB 2F4MA 1HNXQ 5GAHC 5FJ8G 3I561 3KDFA 3HP3A 2GU2A 4HCSA 4LFCQ 3GTMH 2OTLA 4CDFC 2RSNA 4KHZA 4LUVA 4OXPA 5GADC 1QILA 4TQUS 3WWVA 2XTIA 1UUPA 3NTIA 2CWPA 2M00A 1D1IA 3LWEA 1Q1BA 1Q86C 3T51B 3IFUA 2SNSA 3LUSA 2ICEC 1UEAB 2CCZA 4BBRH 2R3ZA 1TWAH 2IW3A 1SMXA 1OTCA 1W3SA 1U4MA 2F0LA 5M3MH 3CME1 3PUYA 2KPIA 1I4QA 1H9SB 4LUZA 3J81b 1I3QB 1Q12A 4FNFA 4O0AA 1HR0Q 1QG7A 1U4RA 3HOWG 3H0GB 4HJ8A 1VDZA 4NH1C 3CCJ1 3H6MA 5TSSA 5M9OA 1T5EA 1ILPA 2LIYA 2B8FA 3EFXD 4TVAB 3HOXB 5C4XI 5IGCA 1LTLA 3FKIH 1I50I 3PO3G 4DV0Q 1RKNA 2EYHA 2EYLA 4DV3L 1C7YA 2E2IH 1R4QB 3M3YB 4BY7B 2VW9A 4IJLA 4B08A 1SFOH 4QJFA 3H3VI 4LF6L 2H5XA 1FDOA 1SEBD 1CA6A 2B8GA 5EBCA 2VPYA 2A73B 3M4OI 3QB3A 5CYUA 2GVAA 4X66L 1E2WA 4IUPA 3QWUA 3VA5A 5EQ0A 2IJ0A 2RCFA 4LF5Q 1EFWA 4BS9A 1S72A 1WFQA 1SJHD 1Q822 3GTPI 1SMYD 2A6ED 4APVA 3KUPA 4A3MG 1R9TI 1YBYA 4C3IG 4DPGA 4BY1H 2JS4A 5IP7I 4RHRA 4DNTB 5FOBB 1VQM1 4DV6Q 4PQXA 1VQ9Z 1TFIA 3I55Z 2IY5B 4POFA 2AQ3B 5IGDA 2HUGA 1DD2A 2FFKB 4ODGA 2K05A 2E2HI 3K5NA 4G7OC 3EROA 3NK9A 1YVCA 4A3LH 2PNRC 4O42A 3GTQH 5M5XH 3K57A 2GVBA 1Q81C 4LF7L 2A68D 1ENCA 4QGUA 4RVHA 1F9PA 1Z9FA 2QKIC 4RAUC 3ONAB 1PH5A 2JA8G 3CCEZ 5JVH3 2A8VA 1Z03A 2BE5D 1STAA 4KJOA 2WB1G 4MNOA 1G91A 1BO0A 2G9DA 3QIAA 1DL6A 3NDIA 3CCUA 2PQAA 3IKJA 4C1NI 3MZLB 4X6AH 1Q8KA 3NBHB 2QR1B 2JIRA 3MFYA 4F87A 1TT2A 2BA0A 4KI0A 3UI2A 3I07A 3EEDA 3GTJI 1K28A 2WINB 1TWGH 2ZXOA 4EWCA 3W1GA 1PA6A 3HOUB 3F3PC 3CHBD 1CSQA 3MXUA 5AJ3Q 4KHPQ 2KJXA 2D9UA 4CDEC 3S2HI 2EJFC 1NSNS 4NKLA 3Q0AA 1VQCA 1PMRA 3URYA 3VMIA 4IUQA 3MTSA 4DXGA 1G6ZA 2JNYA 3CPWA 3MA2B 1B9MA 2H4OA 2D5DA 1XMOL 5EPKA 4IPCA 5C4JB 1IBMQ 4XIGS 3TDQA 1G51A 3J7A4 1P8LA 4ZKBB 1RQFA 3IL8A 1W2BZ 4X64Q 2H1EA 3A74A 2UXCL 4DK0A 5M3FH 4RVFA 1WCMB 5IYDG 3NPPA 3K81C 1E2VA 1K8A2 1SNPA 3NE5B 3P7JA 1PH8A 3TRZA 1LT3D 3HOZG 3KLRA 4DF7A 1JOQA 2R7DA 1AZQA 1GO3E 2W03A 1KLGD 2O5IC 2E76C 5IE8A 3M9BA 4DV1Q 1EWCA 3JC66 5ELDA 3KBXA 3VYSA 3CU7A 1RO2A 4RVGA 1PRTB 2EJMA 3GTKB 3BVZA 1VQP1 1F2LA 2K03A 2E8GA 1YNND 2EPBA 3D4RA 4PMWA 2F0DA 5M5YB 4PMBA 3HOVB 4S1TA 1PH1A 4DR6Q 2ICIA 4BBRI 3V96A 4NBCA 4L5QA 2GA4B 3CCR1 2CHBD 2VS1A 1QXFA 1TXYA 4KV6A 4KKTA 4Q5VA 5IGBA 3S2DB 5FLXf 4EVOA 2B2VA 4A3BH 3Q87A 1I3QH 3H0GH 1O7LA 2IV2X 5CV9A 3K58A 1KNEA 2N78A 3S1QB 4MD7A 3D4WA 5FLXL 2QA4Z 4WRDA 3VA7A 3CCQA 1I94Q 4XT1B 2EYPA 1E7ZA 2VPWA 3BZDB 1XJVA 3PCOB 3CC4A 4BY7H 4IFDG 3BYTB 5G3LD 1YI2Z 3WDNA 4UAIA 4NXNL 3OW7A 1TWFI 1YUAA 1YJ9Z 1A6XA 2QW7A 2JQOA 3A7LA 3CCS1 3G6JB 4JBWA 5JJIA 4XQJA 3PIP3 1TQOA 5T1GA 2SEBD 2MHVA 2K75A 3J81E 1PZJD 5K36H 2RDFA 3SDZA 3J81c 2F4VQ 1QVGA 1XYIA 4FF1A 1TU2B 1YIJA 4LFAL 1L0XB 5ELCA 4RG1A 3L2PA 4IFDJ 1FJGL 1AW7A 1E24A 1K0RA 2N49A 2VUMH 3DHQA 3KDFB 1BUVT 1KLUD 1PFSA 2F0OA 3I4LA 1NMGA 2QEXA 1D7QA 2VB3X 1IKLA 2F52A 1KC82 4CKBA 1XTCD 1VQEA 3DEPA 4JYAL 1Q821 2AWNA 3AEVA 2JA6B 1U4LA 2ZTEA 4JG2A 4ME5A 5LMUL 1PTOD 1N9WA 1IL8A 2EDGA 4A4IA 1BR9A 3CCU1 1LLRD 4DR3Q 1N2FA 2E9HA 4OL7A 1K732 1GUTA 4GLVB 4WFN3 1VQ6Z 1UE7A 2N55A 3VR3A 1JWMD 4A75A 2F0JA 2NBFA 1GHKA 4GN4B 1FDIA 5D65A 1S7MA 1XPOA 4QL5A 3CKIB 4OO1I 5BN3A 5C4XB 2KHJA 5C6AA 4CJ1B 4HIKA 3WOEA 1BCPC 3CD61 1HR0W 1N32L 1NAPA 1STEA 1KC8C 1MJCA 2B2TA 3CCMZ 1EYDA 1Y8CA 3RZOB 1A2TA 1WTQA 5I6YA 1MHWC 4X6AI 1STHA 3CXCY 4UDUC 1SLJA 2XGTA 1AEXA 1SE3A 5EJWA 3PO2B 3D2LA 1VMCA 1B53A 3C1EA 2NZHA 3S14B 1GUSA 1HRJA 1SYEA 1I4RA 1GVPA 1ZXTA 2JUBA 4J8QA 4HJ7A 5LMNQ 1J8IA 1VQ41 2NVYH 4DR7L 1FGUA 2E5LQ 2Z1CA 3OHXC 3NHHA 1O7ZA 2O4XA 3B6YA 1I4XA 3RN2A 4RS4A 2CQAA 5C4ZA 1DZ1A 4ULLA 5JPMC 3S1NB 3JAMi 3F3FC 5C44H 2JIMA 1YJNA 3GO5A 3CCLA 4CGYB 5CC4A 4Y7NB 2R7ZG 2D2CC 2JN4A 1KABA 3RNUA 3I90A 3RLFA 1Y1WB 1K83H 4HCEA 2K5HA 2XNAC 4A3JG 3CCVA 3CMAA 1NTGA 4R4QA 2J4XA 1ASZA 1HJPA 1V9PA 2F3IA 3TZUA 1RIPA 1ML0D 1MJEA 1SXTA 2MFIA 1FL0A 2XRSD 3HGBA 2E2JI 1WJ2A 4A3FG 2K5RA 3Q22A 3TBIB 2JSOA 1X55A 2CVRA 1VQIA 1VQ71 2K01A 3UDIA 4BXXI 5LL6f 1DM0B 4JI6Q 2HCCA 2E7ZA 1K8A1 2VZAA 5A2QE 2LFNA 4L8JA 3WOFA 5A35A 2NVTH 3CC7Z 3AMUA 3JAMb 4FVMA 5CORA 3NSWA 2IX3A 3K7AB 1NNXA 5H1SE 1PH6A 4JI1L 1RNIA 4JI0L 3OMCA 1ZH1A 3MC0B 5M5YH 3H91A 3VR2A 1W6JA 2K5DA 3OIPA 3MWYW 2KENA 1NJIC 2PQAB 1WOCA 3E0JA 4KY5A 1U5KA 4IPHA 3FP9A 5JEAG 2CH4A 4E2WA 4E2YA 1VQK1 1PYWD 2J7ZA 4B9WA 1UNSA 1MGSA 4H02A 2JA5B 5C5MA 1I3QI 1VQOA 1B9NA 3H0GI 2HHHL 1QZHA 3S1QH 4DUYL 1L2FA 2V3VA 3HOXI 4IOAA 3GTMS 4LF9Q 4OWWB 1YIJ1 1QUQA 3LGJA 3HEJA 3SK4A 1LO5D 1VQ8A 4A3CH 4A3KB 1T5XD 3NWSA 3SXHA 4BY7I 2BDNA 5JEAJ 3I4MH 2QEX1 2YU9H 3OWEB 1LTSD 1VQ5Z 1CQVA 1Z02A 1SNOA 2GN5A 3AFPA 2Y0SG 3T1YQ 2HU9A 3PO3S 1FR3A 1ICWA 3TSSA 3J7YW 4C1NK 2R7FA 2NVXH 4AYBG 3GTMB 1AN8A 3NDJA 2K52A 3ICEA 2HIVA 3DWPA 5JVG3 4A3IG 2R61A 3PUWA 5IT9f 2NVQH 3ULLA 4Y52H 1SYBA 2OOYB 2VUMI 2PYKA 4RKBA 3PUXA 3S16H 5C4HA 2B29A 2OTLZ 3R93A 2NN6I 4E30A 1C4QA 5IT9L 2LXKA 4ABNA 1U9RA 5I6WA 2PI2A 1M901 2KBNA 1WTRA 1N8R2 2PPBC 4A3GG 3Q6SA 2MP1A 1TWAB 3I56A 1FGBD 2V8IA 5M5WB 1YHBA 3NXWA 4DR5Q 2AQ1B 4QB4A 5M3MB 1HXYD 3VB9A 4DV5L 1YHQA 1F2ZA 1TS4A 3KF6A 5IYCG 3HOYG 3QWNA 2OWOA 1XMQL 3F8TA 1K731 3TS0A 3GV6A 3KJOA 3OYYA 3FKIB 1CKMA 4A3EG 1BXTA 1VF7A 5CBEE 4OIKA 2E2IB 4GKJL 1H9RA 2ZT9C 1EEFD 3KIHA 4ZUIA 4NW2A 1EZ8A 1SFOB 2ATWA 3I4NH 1VMPA 3CMEA 4C2MH 3G4SA 1VS0A 3HKSA 1YJN1 3PIOA 3K6OA 2PCFB 2RVLA 2IL8A 2X6LA 3NTKA 3HOUI 3CCJA 1KAWA 2WKCA 3BDLA 4I65A 2YTVA 3CCV1 3CMA1 1JMCA 3EA6A 2EYMA 3AB9A 4DK3C 2MO1A 1HNXL 1KD11 2R93G 1NBWA 4LFCL 5KEEA 1AP0A 2F0VA 1LUZA 4AIMA 2HCIA 1S72Z 3CRLC 4BY1B 1JWSD 3BU2A 4ZRZA 1UEBA 5C44I 3GQBA 4RGTA 5J22A 5FLMH 2KHIA 4UHVA 1CUKA 4K0KQ 2KEDA 5C4JI 4AH6A 1LT5D 3G6E1 5EKIA 2L5TA 2K50A 5NUCA 2N3SA 1NUCA 4IPDA 3DMUA 5CGKA 3HS0C 2GTIA 3I2ZA 1B44D 1WCMI 3A55A 4X65L 1PZID 4ZCKA 5D1OA 4NFRA 4PMCA 5M5XB 3GTQB 2KCNA 3J80f 3QOJA 1YITZ 1VQN1 2HQEA 4PZ7A 4YY3Q 1VQMA 4YCWA 1K8OA 5IP9H 2UXBL 1HR0L 1L1OB 5CV7A 3VYTA 1HFNA 2ZAEB 1EQVA 4BBSG 3KLSX 1HZBA 4TKOB 3X3NA 3J80L 5C3EH 5CV8A 1ENFA 2I5HA 3HKZA 3NH4A 2Q8TA 5BR8Q 5G3LF 3A7AB 2K5NA 1BQQT 4LAAA 4DV0L 4RCNA 3GTKI 1H9JA 4MD9A 3H3VJ 2EXDA 1TWGB 2PW5A 1A8VA 2JA9A 3HOVI 3CCUZ 1EZ6A 1WZNA 1KDCA 4B3TQ 4OX9L 2R92H 1PRTC 2Y0SA 4N8X1 1GD7A 2B63G 1W6KA 3MXNB 4LFBL 4CL1A 4FDBA 4JI4Q 3P75A 3S2DI 4CKEA 1EYGA 4Z9CB 1JB3A 5GAEC 2IT1A 2PNHA 5LMNW 1SAPA 2YADA 1F9SA 2IHFA 1XNRL 4X3SA 5FJ8H 4K2LA 3EBEA 1ILQA 1KXLA 3S1QI 4GOPA 1QF8A 2B2YC 3SK5A 3JAME 1CZGA 4RH6A 2WP8J 3JAMc 3FQQA 1VCIA 3CPWZ 2OTJ1 1FNUA 4QIWE 5LHY1 1O7YA 2EJGC 3OSOA 2MUYA 5K5PA 1PTOF 3BG1B 4NB9A 3RLOA 1SJED 4E31A 4LWCA 5M3FB 2L4NA 4K2KA 2KVMA 4QMGA 1NUIA 4NBEA 1A3UA 4LF4L 3IR7A 2EIFA 2I5MX 2OEOA 1WTOA 4FXGC 2VL6A 4JBKA 2VY3A 1WTXA 2JE6I 4OHJA 3RD4A 1I4GA 2NVXI 4XYOA 1TS5A 5CR3A 3FPUB 1U4PA 3PUZA 1YHQ1 1SNCA 2Q4ZA 5FO9B 2NVQI 2K5WA 3HOWH 3PV0A 4Y52I 2SOBA 2XWBB 1KRLA 3AQQA 4B9XA 1HA6A 1E1OA 3D4DA 3VMGA 4JBMA 2JA6I 3PO3H 1LACA 5J1ZA 5BN4A 3UDGA 3D9XA 3MEHA 3T13A 2E74C 4ZUJA 4LMQD 4RGNA 4IUTA 2WIIB 5M5WH 2I0QA 1N8R1 4G7HC 3G4S1 4LF8L 1CM9A 5AJ3L 4KHPL 2PMZE 4A3BB 2P5ZX 1HA5A 2HF1A 4POGA 1EOVA 1HZ9A 4MZ9A 2OCEA 3RLNA 5KYLA 1VQPA 1GUGA 1QE6A 5I4DA 1CKNB 4DK1A 4A93G 2AUJD 1FVIA 2F03A 1D6EC 3I73A 1GUWA 4HIMA 4RHSA 3RZDH 3CCRA 4A3MH 4GNXA 3TEHB 3CCQZ 1IBML 3RZOI 1XTDA 1QVFA 4C3IH 3S15H 1QUQB 4E33A 5FLXb 1KDBA 4E6IA 3VTNA 3CC4Z 3PO2I 2KEEA 1KQSY 3S14I 4JPBW 2L12A 4JBJA 1E1TA 3H3VC 3DM3A 2EY6A 5L37A 1Q812 2PMZA 1EQRA 4JK1C 1ICFB 1QJOA 4I7ZC 5I9PA 1LQLA 4C3JG 2VUMB 2HQLA 3CQZH 3PQIA 1QVGZ 1QNUA 3S1NI 4DV1L 5ISRA 1YIJZ 1K9MC 3CCSA 1Y1VS 2Q8RE 2IHEA 2JA8H 1VQLA 4Y7NI 3BVMA 3I91A 1C48A 2QEXZ 1SBBB 1Y1WI 1M1K1 1STBA 1B4OA 3H94A 1EIGA 5ELEA 1JOOA 4DR6L 2K5VA 3RUZA 4YCVA 5C0XI 4PG3A 1XNQQ 4DFAA 3ER0A 4L63B 4X3UA 3V05A 3QOLA 4J6HA 1Y1VB 2I46A 3T1HQ 1KNAA 2K32A 1A15A 5DM63 2F0IA 3KF6B 1I4HA 2UUBQ 3FQMA 4MN3A 2IZ3A 1I94L 1ZEQX 2VXWA 3K7AI 5IY0A 1PFMA 5IYBG 2QDLA 2UUCL 1AE2A 1X6OA 3N6RA 1HQRD 2NVYB 3CD6A 3OMGA 4P73A 3QO2A 1YUKA 2F4VL 5IYDH 4TRDA 2JA5I 1F2MA 3OTOQ 2LKVA 2O5JC 1NY4A 3HOZH 5C44B 2AUKA 1Q7YC 5A2Qb 1EY5A 4KN4C 1PYSB 3OPOA 4OO1G 4QUCA 1KRTA 1SNQA 2F0FA 1EY9A 4KK7A 1DOLA 4A3KI 1E3PA 2JK8A 2RBMA 4IJHA 4TSSA 1HTLD 1K83B 1ZYRC 1VQ4A 3GCFA 3S17H 3CCLZ 1F2YA 2AKWB 4JVZA 1Q861 5KNCA 3P1HA 4EGVA 1WIIA 1IYUA 1WD0A 3CCVZ 4R9WA 4DV3Q 4DXFA 4R4CA 2C5CA 4KKUA 3N52A 2F4IA 4B3RQ 1JWUD 3GTMI 1JJ2A 3LX0A 1NP6A 4A76A 4C3HG 5D1OB 4V190 2F0NA 4ID6A 2ZTCA 2K28A 1IBKQ 2NVTB 4CJ0B 2UXDQ 3HOWI 3QJYA 1I6VC 4QTUA 4B3MQ 4FF3A 3SE0A 3M4YA 3HKZB 3GTGH 4MXUA 3PO3I 3NEMA 4IFDH 1Q3LA 1TWAI 4PZ6A 1Z01A 2QREB 1VQ7A 2FINB 4NB3A 2WKDA 4DQYB 1LYLA 1TWHH 3FRPB 5LMNL 1A3TA 2WAQG 2RHBA 4DAMA 5FK9C 4X62Q 5D3DA 5E4WC 3ERQA 4XDXA 3NWTA 1TWCH 1G2SA 1QZGA 2G9HD 3OW2A 4KTAA 3FKII 2VF1A 3Q24A 1VQOZ 3E9HA 3C2PA 4BXXG 4CDCC 1HNZQ 2E2II 2Q2IA 2O4HA 4GN5A 5EKKA 1S40A 3I4MB 1JE4A 3O13A 2YU9B 1X3EA 1SFOI 1VQKA 2PZUA 1VQ8Z 2JR6A 2YTYA 1VQL1 2ID0A 3BJUA 5DM73 4A3GB 3G711 1PRTD 2WFWA 1CHQD 1IBLL 1YJW1 1A63A 2NWGA 3U9SA 1RHPA 2NVXB 2F0QA 2LY7A 2EXZA 4DNIA 2XWJB 1LM0A 1UAPA 4JI7Q 4JC0A 3GTLH 2NVQB 3KYHC 4CKCA 3S16B 3U58A 4JI6L 4WJ3M 3AU7A 5AFWA 1X3FA 1Q811 4G4KA 2WB1A 4BY1I 4A3DG 1N33L 1EWHA 1CSPA 1WW9A 1KQSZ 2I3CA 1EL0A 4E2XA 1TS2A 5FLXE 3HOXG 5FLXc 2F0TA 1GM5A 2NTSA 1RLYA 1CQFA 4LJZC 3PIO3 2JIPA 3KF8A 2ES2A 4DV4Q 2PW7A 2WACA 3NELA 1C8CA 3NH8A 4QIWB 3OWFA 2X69A 3T4NB 5IT9b 2K14A 1ASYA 3I56Z 1DJRD 3VDYA 3IF8A 2VQEQ 4A3LI 3EIVA 2EGTA 4QY7A 4RGMA 5EBDA 2Q2TA 1QVFY 3GTQI 5GROA 4JI5Q 3KFUA 1Y1VH 5E7NA 1HFGA 4FXDA 1YHQZ 1D8LA 2QRDB 2I07B 3K80C 2DY7A 1BCPF 3KIFA 1FYCA 4NBFA 4BA1I 1A2UA 2DGYA 2R93B 2L1BA 4DA2A 1F9RA 2RCNA 4L5TA 5EGTA 4LF9L 3SVMA 3I4NB 1L1OC 1HUMA 4DV7Q 4O2DA 4C2MB 1Y69U 2CW0C 2R7ZH 2OOXB 2BOSA 2NN6G 1TWGI 2V4DA 4GNXB 2V8KA 4A3JH 3CMEZ 3G4SZ 4I7AA 1KHIA 3T1YL 2YV5A 5JOBA 1H9KA 5C3XA 2XRQD 2NZ1D 2B2TC 1CA5A 3CCJZ 1QVCA 3U50C 3D8GA 3NP8A 4HGYA 4A3FH 3I7FA 1XX8A 2PMZB 1X56A 3RMHA 3P5JB 2UXBQ 3M7NA 1EIHA 4FXKC 3BYYB 1Q1EA 1ET9A 2ASBA 2OZKA 2KUMA 3J80i 3U9OA 1VQDA 4DR1L 2UU9L 1NJI2 2L55A 1ZB9A 1Q16A 4FO2A 2ZXRA 2KOLA 1BKBA 1FNVA 1USPA 3SR1A 3A0JA 3MZ5A 2IZ4A 1I6HH 1QYPA 4F8MA 4DR5L 1MD2D 1W2BA 1F9QA 1KDAA 3HOUG 5JEAH 3DUZA 4CBVA 4C56C 1T9HA 1J5EQ 1LV9A 4MONA 2G2KA 3G6EA 4JI8Q 5CV6A 3E5SA 5C3EB 1PXUA 2R6GA 4R8IA 1VQMZ 4JI3Q 1RD9D 2VQFQ 3ND8A 5KRUA 3L0OA 4G57A 4LFAQ 1UE6A 2LMCB 5CV5A 2ZJPA 1FJGQ 3CPWY 3J80b 1VQNA 2R92B 4Q0FA 5COYA 1FD7D 2QKDA 1ESRA 3LNNA 4DR2Q 4YIJA 4JYAQ 1G6PA 4A3BI 2B2WC 2H85A 1E22A 5LMUQ 2DJGC 4JW0A 2LXJA 1HUNA 1WCMG 3CC2A 1LTRD 4K5VA 4KD3A 2FMMA 4AQYL 4KY7A 2JA7G 1E2ZA 3Q8DA 4A3IH 2PI2E 3E0EA 1X0TA 1EYCA 4K0KL 1SNMA 3E9IA 2L9HA 2KA7A 4UP7A 3HFZB 4QCLA 3G7LA 1D2BA 1SMYC 3BZKA 1L0WA 1N32Q 4YWLA 4A3GH 1PTOH 1WD1A 2HT1A 3S1MH 4OIJA 2HDLA 4KD4A 4DKAC 3SEBA 3TE5B 3L9AX 3HOVG 3S1RH 2M2LA 1VQ91 4WJWA 1BBXC 4YY3L 2OTJA 2QILA 3I551 2DNCA 4HSPA 3GTLI 5IYCH 2FXQA 3HOWB 2M6NA 3HOYH 3U4ZA 4H44C 3FVQA 5HY6A 4KMUC 5IWAQ 2D0PA 5BR8L 4A3EH 4A93B 2F0MA 4HTHA 2D0OA 3PO3B 2ZTDA 1ZYRD 3MEFA 4ALPA 1YZ6A 1KC81 4K14A 4R4TA 3U4VA 4GKKQ 1N34L 1WTVA 4GLAC 3BDCA 3D0FA 3EQLC 3HZXA 4QF4A 4CHTB 1S4ZA 3CCE1 5EPJA 4JI2Q 2IX0A 1SYCA 5GAGC 4XTCS 5CBAE 4GN3B 4DV2L 4B3TL 1EY0A 3W3AA 5FO7B 3R2TA 3TZDA 2A69C 4IALA 4JI4L 2L11A 4K6LA 1WJJA 1Y1VI 1AA6A 2QCPX 4RMFA 1AFPA 1X3WA 3MZKB 3I70A 3J7AV 2R93H 2EY5A 3NFZA 1B3AA 3RZDB 1LTID 1VQPZ 1QVGY 4J1MA 1K3RA 3T56B 5IODA 4A3MB 3S15B 4RCOA 4C3IB 1LTTD 1MSHA 3AYHB 4X3KA 1G2TA 1DONA 4HJ9A 2XIWA 3E6ZX 3CCRZ 5IT9E 1QVFZ 3HG9A 3KBGA 1IHZA 5IT9c 1F77A 1X54A 4L6TB 1TR5A 2JA6G 1WTPA 2NVYI 2RDGA 2EOTA 5C5LA 4IO9A 1RF2D 4X3TA 4NBDA 2RIQA 1H95A 5KGUA 3CQZB 3TP6A 4ILWA 4M8AA 3HKZE 1QB5D 1V1QA 5KNBA 3C46A 3M4OH 1B2TA 1RO4A 2JA8B 1BF4A 3FHWA 2RHSB 1SYDA 4OEMB 4BBSH 5C4XG 2Z4HA 2AWOA 3A8JE 2LEXA 1EIYB 2WB1B 1K83I 3CCSZ 1HNWQ 1QOHA 1IXRA 2Y0SE 3GTPH 4DGZA 4YHHQ 1U0LA 3BVGA 1PVOA 1R9TH 4QTTA 1AZPA 3FEWX 1JR0D 1XPUA 1EIFA 3KF8B 4AYBE 1DXMA 4NP5A 5T64A 1NJI1 4IUVA 3PO2G 2QF7A 2AHOB 1CT1D 2B63H 5HGTA 3FDTA 2M48A 2K4KA 1BOSA 2OQ0A 1LTGD 2Z6KA 3DWQA 4HIOA 3TN2A 4JV5Q 3NTHA 2E2HH 1OXTA 2NVTI 2F0HA 1UE1A 5IOCA 2LS01 3CC21 4B3SQ 1PFBA 5IP7G 4JOIC 3M85A 1SNDA 1K8MA 5HURA 2Q51A 5FKAC 5CM2M 1PRTF 1YNJC 1Y1WG 1C9OA 2B2UA 2E2DC 2E75C 4AYBA 3STBC 4LF5L 1YI21 1S5DD 1IW7C 4IQZA 4KN7C 4K8IA 1TY0A 5C0XG 3CAMA 4MHEA 1YJ91 2KI7B 3GTJH 3CD6Z 1JCKB 1BCPD 3F2UA 3HOZB 1Z47A 2B2YA 4NPSA 1Z6HA 3T16A 3NQIA 4DAPA 1VF5C 2EVBA 1EUJA 2RA4A 4DV5Q 4RGOS 3V2TA 3S2HH 4A3CI 4S3SA 3P20A 4OONA 4DV6L 4ZK9B 1EQQA 3CRKC 4KY6A 3I4MI 1ENAA 1XMQQ 3S17B 3J80E 3J7ZC 2YU9I 3J80c 1EU4A 2QRCB 5DNFA 2F0UA 1VQFA 2EZVA 1VQ4Z 2OF1A 5C0XJ 4A3GI 2BJOA 4LW1A 5JJLA 1V8QA 3EJIA 1S5CD 2DY8A 1B8AA 1ET6A 2W04A 1USPB 1EY7A 5IGEA 5D3IB 2PZWA 1S5ED 2X6GA 2NTTA 4MTKA 1JB7A 2EYJA 1SE8A 3T1HL 4XYQA 3S16I 1OO9B 1RTNA 1EWIA 1JWHC 1YEZA 2JA5G 2UUBL 1LT4D 2F1MA 5AN9F 3A8KE 1STGA 5KYIA 2K1BA 4A93H 4LUOA 1QNKA 1XXGA 4A3EI 2XVSA 3A54A 3GTGB 3GKQA 2FHTA 3DLLA 3MAQA 4MH4A 3M4QA 3ZJYC 4A3KG 1EY6A 2UUAQ 1TWHB 3TP7A 3R3OA 3BS1A 1VQ7Z 3CCM1 1HZCA 1X65A 1TWCB 2CWAA 2OT2A 1CTMA 3IX0A 1K3BC 3R8BA 1DOMA 1BDOA 3OTOL 2P3YA 3DXJC 1K9M2 1JE5A 4DR4Q 1O80A 4C3JH 2R93I 4X65Q 2ZM6Q 3OW2Z 5ELNA 3TQYA 3CW2C 2VUGA 2KQ3A 2JP1A 3I4NI 5D1PA 1CFMA 5KIXA 3RN5A 4A3DB 3ZYYX 2RF4A 3BDOA 1I5FA 4X64L 3ULPA 4NXMQ 2XSCA 1KL9A 3BG3A 2DE7A 1VQKZ 4IN3A 2MJ8A 4OGQC 4NBAA 4H7BA 3VR4A 4BBRG 3D6CA 1TWFH 1PH3A 5JJKA 3F1ZA 1B70B 1Y8PB 4GNXC 4L5SA 3TREA 3GTLB 4B3RL 2CH4W 2PZTA 5J3BA 1D5ZC 5M3MG 2MNAA 2BCOA 2HDMA 3VYUA 1J9OA 2Z6BA 4OX9Q 3H15A 4E32A 1JJCB 1DGSA 3MHBA 3T53B 2M9VA 5LL6S 2AYDA 1LTAD 1N36Q 1IBKL 2J6AA 4LFBQ 4TNUA 5FLMI 2UXDL 1P16A 2A6HC 3G71A 4BBSI 2B3GA 3FMCA 1YJWA 4KJNA 3FKIG 5E4XA 3F2BA 4DUZQ 1IKMA 1XNRQ 1RCVD 5JPNC 3CXCA 4B3ML 4ZKCB 4QQBX 1QCBD 3F2CA 2QDBA 1L0YB 2YTXA 1VLAA 5IYBH 1WYDA 3CC71 2JIOA 4XX2A 4R1JA 1X3ZA 3J7AF 3DWAA 1YHAA 3NBIA 4DNRB 1Q8IA 5IP9I 2B63I 4X62L 1P9NA 4IOCA 1BNZA 1X3GA 1Q7Y2 4LF4Q 5C3EI 4P74A 1YITA 2IPKD 4H0LC 1HNZL 2XN9C 1KTKA 3GV3A 5I9OA 3NQTA 2R7ZB 2KECA 4RV9A 4OO1H 2EY2A 4BY1G 4EQOA 1SDFA 2B39A 2WV6D 1NCVA 1Q82C 1MSGA 3I4OA 3X3MA 3KOJA 2P28A 4A3JB 2R92I 1IYVA 2KHSA 1SYGA 2RPRA 3K0XA 2AKLA 4DAYA 2DUDA 3CF5A 2ZJRA 5I2YA 3C1FA 1CHPD 4PZ8A 2A69D 1YNXA 5ELBA 1HQMC 3L3OC 2TMPA 4A3FB 4WJ4A 3M7GA 3A5UA 4JI7L 1VQ51 1RJTA 1PH2A 2DN8A 4A3LG 2BA1A 4LF8Q 1SRUA 4C3HH 2RHQB 2MO0A 3PSIA 1O78A 1TKWB 2NYZD 3BZCA 1YJNZ 4NBHA 4MD8A 1JOKA 4KKSA 1PH7A 4DV4L 2Z0SA 4DR3L 4H13C 1I6HB 3CMAZ 4K5XA 1M4VA 2SNMA 4U68A 4O1NA 5EKLA 5JAVA 3GTOB 1NR4A 2OTL1 4U673 1VQGA 2G5DA 3TS2A 4LF6Q 2NAPA 2VQEL 1PHJA 1G291 4JI5L 1Q90A 3IAYA 3F2DA 1K0SA 3MONA 4P2CB 2F4OA 4GS3A 4X66Q 1LT6D 3SK8A 3H09A 5IGGA 1WI5A 1WVLA 3OOCA 2E2JH 1RTOA 3FPPA 3G6EZ 2JA7B 4A93I 4BXXH 4DV7L 1A62A 3MFGA 4FP5D 1JC7A 5EAYA 1SE2A 2BH8A 3J81f 3A8IE 1SN8A 2K3RA 2E5LL 1VQNZ 2Y0SB 4DU9A 1RDPD 1RO0A 5M3FG 3IFTA 5FO8B 3J7A5 1PFNA 3J81L 2F0WA 2WB1E 4AYBB 2D62A 4N8FA 1G8ZD 2JYOA 2MQHA 3VR5A 1D1KA 4A3IB 3SHLA 5I2XA 4RFBA 4R4OA 4GOPB 3CC2Z 4NDXA 2RBLA 3RZDI 2N88A 1K8AC 4LF7Q 4A3MI 3E3XA 2B2VC 2MGSA 4DAVA 3S15I 1K9M1 2CFMA 5J39A 4A3DH 2PK7A 1EFID 3C3LA 3Q23A 1PTOB 1EY4A 3HOXH 3TP5A 3S1MB 3KLWA 1S721 2A5HA 1YNJD 3SK6A 4WORA 3S1RB 3M3YH 3STBD 4YCUA 1X9NA 1V1PA 5T6BA 1IW7D 2UUCQ 1IYJB 4BWGB 3CQZI 1NMFA 3HOYB 1J5EL 4A3BG 3R2IA 1LTBD 2OQKA 4JI8L 3H0GG 2OTJZ 2JA8I 1X3PA 4DN4M 4NB8A 1NE3A 2F0KA 4A3EB 4JI3L 2VB2X 4MTNA 1EY8A 5IGFA 2VQFL 3HRZC 4FF4A 1YIT1 3ND9A 4BY7G 3QG1A 1XMOQ 4V0BA 2Q8IB 5T1IA 4HR7B 1M902 1Y8OB 1VQ9A 3I55A 2NN6H 2EYOA 2C9OA 2LSSA 2BH2A 4DR2L 4DK6C 2A19A 5DAUA 4E2ZA 3OIQA 1XPRA 2UXCQ 4N9PA 5K36G 1D5XC 1PFTA 1AE3A 3K0YA 2AMCB 4IZ8A 2OXPA 4IPGA 3A56A 3ESWA 4CDDC 1UWVA 1HHVA 1GHJA 1GUOA 4YWMA 4XXEA 1XWEA 2VUMG 1L1OA 3CCEA 2K5QA 3S9WA 1Q7Y1 1X3QA 3UE0A 2Z9HA 4UP9A 2K04A 1QWYA 5KNDA 4HJ5A 5GQOA 4EX5A 1PV4A 1FNWA 1MIUA 1I50B 1IL2A 4ME3A 1M90C 4F88A 4HIDA 4FYDA 3UE1A 2WAQE 1OXXK 2J0TD 1KAAA 3ERSX 2Z8LA 3KJPA 3A5ZB 1HCZA 3D3RA 3PUVA 4RWSC 2RDHA 3ULJA 3K8AA 2RQXA 2VPZA 5A2Qf 1STYA 3I72A 2A74C 3M4OB 3MXNA 3HOZI 3HOUH 2V45A 2NUCA 2Q2HA 3K7UC 1KD12 1VQHA 2RSOA 1K8GA 2JXMB 1Y1VG 1K73C 4BBSB 1S5BD 5DEHA 1LABA 1M8AA 2JMOA 1HZAA 5A2QL 2RT9A 2LFUA 1ONLA 5IWAL 2SDFA 3EERA 3S17I 3GTPB 3J81j 1S3OA 1Z7TA 2JEBI 1R9TB 4K6DA 4GKKL 4GZYC 1RODA 4HN7A 2O2LD 4LNQA 3GTOH 3EVQA 4JI2L 4NXNQ 2WAQA 3W5OA 1E0BA 5C4JH 4NOZA 2B63B 1DYQA 4EQPA 2FMCA 4N9TA 1PDQA 3K59A 4UPAA 2E2HB 3S24A 2JIQA 1KD1C 1IBLQ 1WCMH 1TY2A 2V8JA 2JA7H 2A6HD 3K5LA 2MPMA 3T4AC 3G48A 3BG0B 4P75A 5C44G 3GTGI 1D5MC 4ZQ3A 1SSOA 4NBBA 4IFDI 3I8ZA 1PLFA 3RR5A 2DE6A 1N33Q 3KK7A 1C0AA 1TWHI 2B2WA 3LWUA 2RKSA 1RL2A 3GTKH 1ZKOA 4BA2I 3CCQ1 1KRSA 5T67A 1MBYA 3EN2A 4DAYB 3GTJB 1TWCI 2QLVB 1VQBA 1SIWA 1MKHA 4OWTB 3HOVH 3PMFA 3CC41 2N8NA 1H9SA 4R8NA 2KCTA 4HGZA 2K7VA 4PV1C 3S2HB 4EQNA 4HMJA 1OXVA 1GJXA 3S2DH 2QA4A 5E3FA 2L0CA 3IFDA 1JJ2Y 1CKNA 2NB0A 1EU3A 1CZWA 2VPXA 2EE1A 3UDXA 5EPLA 4A3DI 2A6EC 1YI2A 1HNWL 3UDFA 1Y8NB 4YHHL 1YJ9A 3L7ZC 2F3WA 4QUFA 1MI2A 2K6AA 3HKZG 4RVDA 3CP0A 1TVXA 4UY8C 3M3YI 3NUCA 2CQOA 3GDEA 3IRBA 3K5MA 1CKOA 4LK1C 1B50A 4YWKA 1SR3A 2PM9A 2IX1A 4DR7Q 3TDHB 4JV5L 4P72A 4ZLTF 3GP7A 3AFQA 1TIID 2A68C 2CKZB 1HH2P 4B3SL 2KCMA 3OW2Y 3M4PA 5DLQE 4A3CG 4HSVA 4NMZA 2JJQA 4K8JA 2BE5C 2I5LX 1KQSA 4MRIA 3I4MG 4HMIA 3VYRA 1O7IA 2TSSA 2ALYB 4MIUA 4EQ5A 3DM1A 2O53A 3NH5A 4PNYA 1ML8A 1V43A 2DE5A 4DR1Q 2UU9Q 2JA6H 2EQSA 1VQ6A 1GUNA 1I4PA 5E1FA 4BBRB 4FF2A 3D6WA 2IWHA 4OWXB 1JORA 2GTHA 3PIPA 4C3JB 2V1CC 2AQ2B 4NBGA 1WTHA 5ELFA 1A0IA 2NZOA 1SROA 2R7ZI 3GD7A 1R4PB 2BDOA 5C4XH 3CCMA 5BN5A 1ESFA 1I50H 3VR6A 5HGQA 4DGLA 3TMEA 3QR8A 4F7XA 5C3WA 4A3JI 2PO4A 1BBWA 3NBHA 1JT8A 2F0EA 3VMHA 2F0PA 4JI1Q 1TWFB 4ZAIA 4JI0Q 3RZOH 3H3VH 5LL6X 5CV4A 1N8RC 1BVSA 4HJAA 3PO2H 2EY1A 3CCL1 4A3FI 3S14H 3I3CA 1IZ6A 1V1PB 3ITPA 1B3QA 5ELOA 4KLKA 3KLSA 2QEJC 2F3VA 1AH9A 1A3VA 4K5WA 1ZB8A 2HHHQ 1B7YB 1VQLZ
chains in the Genus database with same CATH topology
2F0SA 3W2DA 2EYFA 4IUUA 1DOKA 4CJ2C 3G71Z 1PZKD 1EQTA 1YJWZ 1II3A 2K33A 3CXCZ 1M1K2 1I6HI 1JQYD 1CI3M 3GTOI 5CMDA 2FJ2A 1YNNC 1S5FD 1X32A 3K5OA 3JAMf 2ENBA 5C0XH 5D14A 1BCPB 1OXSC 1EEID 3JAML 5IIFA 2JA7I 3D31A 1JICA 2YYZA 2QA41 4HH4A 2KCCA 2Z4IA 4IURA 5F2DA 4XQNA 1VQO1 1DCZA 1NR2A 1OXUA 4XQQA 1EYAA 4RA8A 2JEAI 1GXDC 1VQ81 1STNA 2F0GA 4XT3B 1SYFA 1SE4A 4C3HB 4A3II 1B1ZA 4RKLA 1W2BY 3TP8A 2VNUD 3MVVA 2B2UC 1HTPA 4G7ZC 1GOZA 2CW0D 1CK1A 4KHVA 5JJZA 1TS3A 4M1UB 3MXGA 1EOTA 3MXPA 4IUNA 3S1MI 1HPCA 2ZXPA 1H9MA 4HAEA 4ZYSA 4HEDA 1Q862 3DEOA 3S1RI 1PTOC 1WTWA 2WAQB 1V1OA 1JJ2Z 3HOYI 2DNEA 2PQEA 1VQ61 2E2JB 2R6MA 2F4MA 3I561 3HP3A 2GU2A 4HCSA 2RSNA 4KHZA 1QILA 4TQUS 1UUPA 3NTIA 2M00A 1D1IA 3LWEA 1Q1BA 3T51B 3IFUA 2SNSA 3LUSA 2ICEC 1UEAB 2R3ZA 2IW3A 1U4MA 2F0LA 3CME1 3PUYA 2KPIA 1I4QA 1H9SB 3J81b 1I3QB 1Q12A 4FNFA 1QG7A 1U4RA 3H0GB 1VDZA 4NH1C 3CCJ1 3H6MA 5TSSA 5M9OA 1T5EA 1ILPA 2LIYA 2B8FA 3EFXD 3HOXB 5C4XI 5IGCA 1I50I 1RKNA 2EYHA 2EYLA 1R4QB 3M3YB 4BY7B 4B08A 1SEBD 1CA6A 2B8GA 5EBCA 2A73B 3M4OI 3QB3A 5CYUA 1E2WA 4IUPA 3QWUA 3VA5A 5EQ0A 2IJ0A 4BS9A 1SJHD 1Q822 3GTPI 1SMYD 2A6ED 3KUPA 1R9TI 4C3IG 2JS4A 5IP7I 4RHRA 4DNTB 5FOBB 1VQM1 4PQXA 1VQ9Z 1TFIA 3I55Z 2AQ3B 5IGDA 2HUGA 1DD2A 2FFKB 4ODGA 2K05A 2E2HI 3K5NA 4G7OC 3EROA 3NK9A 2PNRC 4O42A 3K57A 2A68D 1ENCA 4RVHA 1F9PA 4RAUC 2QKIC 3ONAB 3CCEZ 5JVH3 1Z03A 2BE5D 1STAA 4KJOA 1G91A 1BO0A 2G9DA 3QIAA 1DL6A 3NDIA 3IKJA 4C1NI 3MZLB 2QR1B 3MFYA 4F87A 1TT2A 2BA0A 4KI0A 3UI2A 3I07A 3EEDA 3GTJI 2WINB 2ZXOA 4EWCA 3HOUB 3F3PC 3CHBD 3MXUA 2KJXA 2D9UA 3S2HI 2EJFC 1NSNS 4NKLA 3Q0AA 1PMRA 3URYA 3VMIA 4IUQA 3MTSA 4DXGA 1G6ZA 2JNYA 3MA2B 1B9MA 2H4OA 2D5DA 5EPKA 5C4JB 4XIGS 3TDQA 3J7A4 4ZKBB 1RQFA 3IL8A 1W2BZ 2H1EA 4DK0A 4RVFA 1WCMB 3NPPA 1E2VA 1K8A2 1SNPA 3NE5B 3P7JA 1LT3D 3KLRA 4DF7A 1JOQA 1AZQA 2W03A 1KLGD 2O5IC 2E76C 1EWCA 5ELDA 3KBXA 3VYSA 3CU7A 1RO2A 4RVGA 1PRTB 2EJMA 3GTKB 3BVZA 1VQP1 1F2LA 2K03A 1YNND 2EPBA 3D4RA 4PMWA 2F0DA 5M5YB 4PMBA 3HOVB 4S1TA 2ICIA 4BBRI 3V96A 4NBCA 2GA4B 3CCR1 2CHBD 4KV6A 4KKTA 4Q5VA 5IGBA 3S2DB 5FLXf 4EVOA 2B2VA 3Q87A 1O7LA 5CV9A 3K58A 1KNEA 3S1QB 4MD7A 3D4WA 5FLXL 2QA4Z 4WRDA 3VA7A 4XT1B 2EYPA 3BZDB 4IFDG 3BYTB 5G3LD 1YI2Z 3WDNA 4UAIA 3OW7A 1TWFI 1YUAA 1YJ9Z 1A6XA 3A7LA 3CCS1 3G6JB 4JBWA 4XQJA 3PIP3 1TQOA 5T1GA 2SEBD 2MHVA 5K36H 3J81E 1PZJD 2RDFA 3SDZA 1XYIA 4FF1A 1TU2B 1L0XB 5ELCA 4IFDJ 1AW7A 3DHQA 1BUVT 1KLUD 2F0OA 3I4LA 2VB3X 1IKLA 4CKBA 1KC82 1XTCD 3DEPA 1Q821 2AWNA 2JA6B 1U4LA 4ME5A 1PTOD 1IL8A 2EDGA 1BR9A 3CCU1 1LLRD 1N2FA 2E9HA 4OL7A 1K732 1GUTA 4WFN3 1VQ6Z 2N55A 3VR3A 1JWMD 2F0JA 2NBFA 1GHKA 5D65A 1S7MA 3CKIB 4OO1I 5BN3A 5C4XB 5C6AA 4CJ1B 3WOEA 1BCPC 3CD61 1NAPA 1STEA 2B2TA 3CCMZ 1EYDA 3RZOB 1A2TA 1WTQA 5I6YA 4X6AI 3CXCY 1STHA 4UDUC 1AEXA 1SE3A 5EJWA 3PO2B 1VMCA 1B53A 3C1EA 3S14B 1GUSA 1HRJA 1SYEA 1I4RA 1ZXTA 2JUBA 4J8QA 1J8IA 1VQ41 2Z1CA 3OHXC 3NHHA 1O7ZA 2O4XA 1I4XA 4RS4A 2CQAA 5C4ZA 1DZ1A 4ULLA 5JPMC 3S1NB 3F3FC 3GO5A 4CGYB 5CC4A 4Y7NB 2D2CC 1KABA 3I90A 3RLFA 1Y1WB 4HCEA 2XNAC 2J4XA 3TZUA 1ML0D 1SXTA 2XRSD 3HGBA 2E2JI 2K5RA 3Q22A 3TBIB 2JSOA 2CVRA 1VQ71 2K01A 4BXXI 5LL6f 1DM0B 2HCCA 1K8A1 5A2QE 2LFNA 4L8JA 3WOFA 5A35A 3CC7Z 3AMUA 3JAMb 4FVMA 5CORA 3NSWA 2IX3A 3K7AB 1RNIA 3OMCA 1ZH1A 3MC0B 3H91A 3VR2A 1W6JA 2K5DA 3OIPA 3MWYW 3E0JA 4KY5A 5JEAG 4E2WA 4E2YA 1VQK1 1PYWD 2J7ZA 4B9WA 1UNSA 1MGSA 2JA5B 5C5MA 1I3QI 1B9NA 3H0GI 3HOXI 3GTMS 1YIJ1 3HEJA 3SK4A 1LO5D 4A3KB 1T5XD 3NWSA 3SXHA 4BY7I 2BDNA 5JEAJ 2QEX1 3OWEB 1LTSD 1VQ5Z 1CQVA 1Z02A 1SNOA 2HU9A 3PO3S 1FR3A 1ICWA 3TSSA 3J7YW 4C1NK 3GTMB 1AN8A 3NDJA 3DWPA 5JVG3 2R61A 3PUWA 5IT9f 1SYBA 2OOYB 2VUMI 2PYKA 4RKBA 3PUXA 5C4HA 2OTLZ 3R93A 2NN6I 4E30A 1C4QA 5IT9L 4ABNA 1U9RA 5I6WA 1M901 1WTRA 1N8R2 2PPBC 3Q6SA 2MP1A 1TWAB 1FGBD 2V8IA 5M5WB 3NXWA 2AQ1B 4QB4A 5M3MB 1HXYD 3VB9A 1F2ZA 1TS4A 3QWNA 1K731 3GV6A 3FKIB 1BXTA 1VF7A 5CBEE 4OIKA 2E2IB 1H9RA 2ZT9C 1EEFD 3KIHA 4ZUIA 4NW2A 1EZ8A 1SFOB 1VMPA 1YJN1 3K6OA 2PCFB 2RVLA 2IL8A 2X6LA 3NTKA 3HOUI 2WKCA 3BDLA 4I65A 3CCV1 3CMA1 3EA6A 2EYMA 3AB9A 1KD11 5KEEA 1AP0A 2F0VA 2HCIA 1S72Z 3CRLC 4BY1B 1JWSD 4ZRZA 5C44I 3GQBA 4RGTA 5J22A 2KEDA 5C4JI 1LT5D 3G6E1 5EKIA 2L5TA 5NUCA 1NUCA 3DMUA 5CGKA 3HS0C 2GTIA 1B44D 1WCMI 3A55A 1PZID 5D1OA 4NFRA 4PMCA 5M5XB 3GTQB 2KCNA 3J80f 3QOJA 1YITZ 1VQN1 2HQEA 1K8OA 5CV7A 3VYTA 1HFNA 2ZAEB 1EQVA 3KLSX 4TKOB 3X3NA 3J80L 5CV8A 1ENFA 3HKZA 3NH4A 2Q8TA 5G3LF 3A7AB 1BQQT 4LAAA 4RCNA 3GTKI 1H9JA 4MD9A 3H3VJ 1TWGB 2PW5A 3HOVI 3CCUZ 1EZ6A 1KDCA 1PRTC 2Y0SA 1W6KA 4CL1A 3P75A 3S2DI 4CKEA 4Z9CB 1JB3A 2IT1A 1SAPA 2YADA 1F9SA 4X3SA 4K2LA 1ILQA 3S1QI 1QF8A 2B2YC 3SK5A 3JAME 1CZGA 4RH6A 2WP8J 3FQQA 1VCIA 3CPWZ 2OTJ1 1FNUA 5LHY1 1O7YA 2EJGC 3OSOA 2MUYA 5K5PA 1PTOF 3BG1B 4NB9A 1SJED 4E31A 5M3FB 2L4NA 4K2KA 2KVMA 4QMGA 1NUIA 4NBEA 1A3UA 1WTOA 2OEOA 4FXGC 1WTXA 2JE6I 4OHJA 3RD4A 1I4GA 2NVXI 4XYOA 1TS5A 5CR3A 3FPUB 1U4PA 3PUZA 1YHQ1 1SNCA 2Q4ZA 5FO9B 2NVQI 2K5WA 3PV0A 4Y52I 2SOBA 2XWBB 1KRLA 4B9XA 1HA6A 3D4DA 3VMGA 2JA6I 1LACA 5J1ZA 5BN4A 3D9XA 3MEHA 3T13A 2E74C 4ZUJA 4LMQD 4RGNA 4IUTA 2WIIB 1N8R1 4G7HC 3G4S1 1CM9A 4A3BB 1HA5A 2HF1A 5KYLA 1GUGA 1QE6A 5I4DA 4DK1A 2AUJD 2F03A 1D6EC 3I73A 1GUWA 4RHSA 3CCQZ 3RZOI 4E33A 5FLXb 1KDBA 4E6IA 3VTNA 3CC4Z 3PO2I 2KEEA 1KQSY 3S14I 2L12A 3H3VC 2EY6A 1Q812 2PMZA 4JK1C 1QJOA 4I7ZC 5I9PA 1LQLA 4C3JG 2VUMB 1QVGZ 1QNUA 3S1NI 5ISRA 1YIJZ 1Y1VS 2Q8RE 4Y7NI 3BVMA 3I91A 1C48A 2QEXZ 1SBBB 1Y1WI 1M1K1 1STBA 1B4OA 3H94A 1EIGA 5ELEA 1JOOA 3RUZA 5C0XI 4DFAA 4L63B 4X3UA 3V05A 3QOLA 4J6HA 1Y1VB 2I46A 1KNAA 2K32A 1A15A 5DM63 2F0IA 1I4HA 3FQMA 4MN3A 2IZ3A 1ZEQX 2VXWA 3K7AI 1PFMA 3N6RA 1HQRD 2NVYB 3OMGA 3QO2A 1YUKA 4TRDA 2JA5I 1F2MA 2LKVA 2O5JC 5C44B 2AUKA 5A2Qb 1EY5A 4KN4C 3OPOA 4OO1G 4QUCA 1SNQA 1EY9A 2F0FA 4KK7A 1DOLA 4A3KI 4TSSA 2RBMA 1HTLD 1K83B 1ZYRC 3GCFA 3CCLZ 1F2YA 1Q861 5KNCA 3P1HA 4EGVA 1WIIA 1IYUA 1WD0A 3CCVZ 4R9WA 4DXFA 2C5CA 4KKUA 3N52A 2F4IA 1JWUD 3GTMI 3LX0A 1NP6A 4C3HG 5D1OB 4V190 2F0NA 4ID6A 2K28A 2NVTB 4CJ0B 3HOWI 3QJYA 1I6VC 4QTUA 4FF3A 3SE0A 3M4YA 3HKZB 4MXUA 3PO3I 4IFDH 1Q3LA 1TWAI 1Z01A 2QREB 2FINB 2WKDA 4DQYB 3FRPB 1A3TA 2RHBA 5FK9C 5D3DA 5E4WC 3ERQA 4XDXA 3NWTA 1G2SA 2G9HD 4KTAA 3FKII 2VF1A 3Q24A 1VQOZ 3C2PA 2E2II 2O4HA 5EKKA 3I4MB 1JE4A 3O13A 2YU9B 1SFOI 2PZUA 1VQ8Z 2JR6A 1VQL1 2ID0A 5DM73 4A3GB 3G711 1PRTD 1CHQD 1YJW1 2NWGA 3U9SA 1RHPA 2NVXB 2F0QA 2LY7A 2EXZA 2XWJB 1UAPA 2NVQB 4CKCA 3S16B 3AU7A 5AFWA 1Q811 4G4KA 2WB1A 4BY1I 1EWHA 1WW9A 1KQSZ 2I3CA 1EL0A 4E2XA 1TS2A 5FLXE 2F0TA 2NTSA 1RLYA 1CQFA 4LJZC 3PIO3 3KF8A 2PW7A 2WACA 1C8CA 3NH8A 4QIWB 3OWFA 2X69A 3T4NB 5IT9b 3I56Z 1DJRD 3IF8A 4A3LI 2EGTA 4RGMA 5EBDA 1QVFY 3GTQI 1HFGA 4FXDA 1YHQZ 2QRDB 2I07B 2DY7A 1BCPF 3KIFA 1FYCA 4NBFA 4BA1I 1A2UA 2R93B 2L1BA 4DA2A 1F9RA 5EGTA 3SVMA 3I4NB 1L1OC 1HUMA 4C2MB 1Y69U 2CW0C 2OOXB 2BOSA 2NN6G 1TWGI 2V4DA 2V8KA 3CMEZ 3G4SZ 5JOBA 1H9KA 5C3XA 2XRQD 2NZ1D 2B2TC 1CA5A 3CCJZ 3U50C 3D8GA 3NP8A 4HGYA 1XX8A 2PMZB 3RMHA 3P5JB 3M7NA 1EIHA 4FXKC 3BYYB 1Q1EA 1ET9A 2OZKA 2KUMA 3U9OA 1NJI2 2L55A 1ZB9A 4FO2A 2ZXRA 2KOLA 1FNVA 1USPA 3SR1A 3MZ5A 2IZ4A 1QYPA 4F8MA 1MD2D 1F9QA 1KDAA 5JEAH 3DUZA 4CBVA 4C56C 1LV9A 4MONA 2G2KA 5CV6A 3E5SA 5C3EB 1PXUA 2R6GA 4R8IA 1VQMZ 1RD9D 3ND8A 5KRUA 4G57A 2LMCB 5CV5A 3CPWY 3J80b 2R92B 4Q0FA 5COYA 1FD7D 2QKDA 1ESRA 3LNNA 4YIJA 4A3BI 2B2WC 2H85A 1HUNA 1LTRD 4K5VA 4KD3A 2FMMA 4KY7A 1E2ZA 1X0TA 1EYCA 1SNMA 2L9HA 2KA7A 4QCLA 3G7LA 1D2BA 1SMYC 1PTOH 1WD1A 4OIJA 2HDLA 4KD4A 3SEBA 3TE5B 3L9AX 2M2LA 1VQ91 4WJWA 1BBXC 2QILA 3I551 2DNCA 4HSPA 3GTLI 3HOWB 2M6NA 4H44C 3FVQA 4KMUC 4A93B 2F0MA 4HTHA 3PO3B 1ZYRD 1KC81 4K14A 1WTVA 3BDCA 3EQLC 3HZXA 4QF4A 4CHTB 1S4ZA 3CCE1 5EPJA 2IX0A 1SYCA 5CBAE 4XTCS 1EY0A 3W3AA 5FO7B 3R2TA 3TZDA 2A69C 4IALA 2L11A 4K6LA 1Y1VI 2QCPX 1AFPA 1X3WA 3MZKB 3I70A 3J7AV 2EY5A 3NFZA 1B3AA 3RZDB 1LTID 1VQPZ 1QVGY 4J1MA 3T56B 5IODA 4A3MB 3S15B 4RCOA 4C3IB 1LTTD 1MSHA 4X3KA 1G2TA 1DONA 2XIWA 3E6ZX 3CCRZ 5IT9E 1QVFZ 3HG9A 3KBGA 1IHZA 1F77A 4L6TB 1TR5A 1WTPA 2NVYI 2RDGA 2EOTA 5C5LA 1RF2D 4X3TA 4NBDA 2RIQA 5KGUA 3CQZB 3TP6A 4ILWA 4M8AA 1QB5D 5KNBA 3C46A 1B2TA 1RO4A 2JA8B 1BF4A 1SYDA 2Z4HA 2AWOA 3A8JE 2WB1B 1K83I 3CCSZ 1QOHA 4DGZA 3BVGA 4QTTA 1AZPA 3FEWX 1JR0D 1DXMA 4NP5A 5T64A 1NJI1 4IUVA 2QF7A 1CT1D 5HGTA 3FDTA 2M48A 1BOSA 1LTGD 3DWQA 3TN2A 3NTHA 1OXTA 2NVTI 2F0HA 5IOCA 2LS01 3CC21 1PFBA 3M85A 1SNDA 1K8MA 5HURA 2Q51A 5FKAC 5CM2M 1PRTF 1YNJC 2B2UA 2E2DC 2E75C 4AYBA 1YI21 1S5DD 1IW7C 4IQZA 4KN7C 4K8IA 1TY0A 5C0XG 4MHEA 1YJ91 2KI7B 3CD6Z 1JCKB 1BCPD 3F2UA 3HOZB 1Z47A 2B2YA 1Z6HA 3T16A 3NQIA 4DAPA 1VF5C 2EVBA 2RA4A 4RGOS 3V2TA 4A3CI 4S3SA 3P20A 4ZK9B 3CRKC 4KY6A 3I4MI 1ENAA 3S17B 3J80E 2YU9I 1EU4A 2QRCB 5DNFA 2F0UA 2EZVA 1VQ4Z 2OF1A 5C0XJ 4A3GI 2BJOA 1V8QA 3EJIA 1S5CD 2DY8A 1ET6A 2W04A 1USPB 1EY7A 5IGEA 5D3IB 2PZWA 1S5ED 2X6GA 2NTTA 2EYJA 4XYQA 3S16I 1OO9B 1RTNA 1JWHC 1LT4D 2F1MA 5AN9F 3A8KE 1STGA 5KYIA 2K1BA 1QNKA 1XXGA 4A3EI 2XVSA 3A54A 3GTGB 3GKQA 2FHTA 3MAQA 4MH4A 1EY6A 1TWHB 3TP7A 3R3OA 3BS1A 1VQ7Z 3CCM1 1TWCB 2OT2A 1CTMA 3IX0A 3R8BA 1DOMA 1BDOA 2P3YA 3DXJC 1K9M2 1O80A 2R93I 3OW2Z 2VUGA 2KQ3A 2JP1A 3I4NI 5D1PA 1CFMA 5KIXA 4A3DB 3ZYYX 3BDOA 2XSCA 3BG3A 2DE7A 1VQKZ 4IN3A 2MJ8A 4OGQC 4NBAA 4H7BA 3VR4A 3D6CA 1Y8PB 3GTLB 2PZTA 1D5ZC 2BCOA 2HDMA 3VYUA 1J9OA 4E32A 3MHBA 3T53B 2M9VA 5LL6S 1LTAD 2J6AA 4TNUA 5FLMI 2A6HC 4BBSI 3FMCA 4KJNA 5E4XA 1IKMA 1RCVD 5JPNC 4ZKCB 1QCBD 2QDBA 1L0YB 1VLAA 3CC71 4XX2A 1X3ZA 3J7AF 3DWAA 3NBIA 4DNRB 1Q8IA 5IP9I 2B63I 1P9NA 1BNZA 1Q7Y2 5C3EI 2IPKD 4H0LC 2XN9C 1KTKA 3GV3A 5I9OA 3NQTA 2R7ZB 2KECA 4RV9A 4OO1H 2EY2A 4EQOA 1SDFA 2B39A 2WV6D 1NCVA 1MSGA 3X3MA 2P28A 4A3JB 2R92I 1IYVA 2KHSA 1SYGA 2RPRA 2AKLA 4DAYA 5I2YA 3C1FA 1CHPD 2A69D 5ELBA 1HQMC 3L3OC 2TMPA 4A3FB 3M7GA 1VQ51 1RJTA 2DN8A 2BA1A 1O78A 1TKWB 2NYZD 1YJNZ 4NBHA 4MD8A 1JOKA 4KKSA 4H13C 1I6HB 3CMAZ 4K5XA 1M4VA 2SNMA 4U68A 4O1NA 5EKLA 5JAVA 3GTOB 1NR4A 2OTL1 4U673 1G291 1Q90A 3IAYA 3MONA 4P2CB 2F4OA 1LT6D 3SK8A 3H09A 5IGGA 1WVLA 3OOCA 1RTOA 3FPPA 3G6EZ 2JA7B 4A93I 3MFGA 4FP5D 1JC7A 1SE2A 3J81f 3A8IE 2K3RA 1VQNZ 2Y0SB 4DU9A 1RDPD 1RO0A 3IFTA 5FO8B 1PFNA 3J81L 2F0WA 4AYBB 2D62A 1G8ZD 2JYOA 3VR5A 1D1KA 4A3IB 3SHLA 5I2XA 4RFBA 3CC2Z 4NDXA 2RBLA 3RZDI 2N88A 4A3MI 2B2VC 2MGSA 4DAVA 3S15I 1K9M1 5J39A 2PK7A 1EFID 3C3LA 3Q23A 1PTOB 1EY4A 3TP5A 3S1MB 1S721 2A5HA 1YNJD 3SK6A 4WORA 3S1RB 1V1PA 5T6BA 1IW7D 4BWGB 3CQZI 3HOYB 3R2IA 1LTBD 2OTJZ 2JA8I 1X3PA 4DN4M 4NB8A 2F0KA 4A3EB 2VB2X 1EY8A 5IGFA 3HRZC 4FF4A 1YIT1 3ND9A 3QG1A 4V0BA 2Q8IB 5T1IA 4HR7B 1M902 1Y8OB 2NN6H 2EYOA 2C9OA 5DAUA 4E2ZA 3OIQA 4N9PA 5K36G 1D5XC 1PFTA 3K0YA 4IZ8A 2OXPA 3A56A 3ESWA 1HHVA 1GHJA 1GUOA 4XXEA 1XWEA 2K5QA 3S9WA 1Q7Y1 1X3QA 2K04A 1QWYA 5KNDA 1FNWA 1I50B 4F88A 4FYDA 1OXXK 2J0TD 1KAAA 2Z8LA 1HCZA 3D3RA 3PUVA 4RWSC 2RDHA 2RQXA 5A2Qf 1STYA 3I72A 2A74C 3M4OB 3MXNA 3HOZI 2NUCA 1KD12 2RSOA 2JXMB 4BBSB 1S5BD 5DEHA 1LABA 1M8AA 2JMOA 5A2QL 2RT9A 2LFUA 1ONLA 2SDFA 3EERA 3S17I 3GTPB 1Z7TA 2JEBI 1R9TB 4K6DA 4GZYC 1RODA 4HN7A 2O2LD 3EVQA 2WAQA 1E0BA 4NOZA 2B63B 1DYQA 4EQPA 2FMCA 4N9TA 1PDQA 3K59A 2E2HB 1TY2A 2V8JA 2A6HD 3K5LA 2MPMA 3T4AC 3BG0B 3GTGI 1D5MC 4ZQ3A 1SSOA 4NBBA 4IFDI 3I8ZA 1PLFA 2DE6A 3KK7A 1TWHI 2B2WA 3LWUA 2RKSA 1ZKOA 4BA2I 3CCQ1 1MBYA 5T67A 3GTJB 1TWCI 2QLVB 3PMFA 3CC41 4R8NA 1H9SA 4HGZA 2K7VA 4PV1C 3S2HB 4EQNA 4HMJA 1OXVA 1GJXA 5E3FA 2L0CA 3IFDA 1JJ2Y 2NB0A 1EU3A 1CZWA 2EE1A 5EPLA 4A3DI 2A6EC 1Y8NB 3L7ZC 2F3WA 4QUFA 1MI2A 2K6AA 4RVDA 1TVXA 3M3YI 3NUCA 3K5MA 4LK1C 1B50A 2PM9A 2IX1A 3TDHB 4ZLTF 3GP7A 1TIID 2A68C 3OW2Y 4HSVA 4NMZA 4K8JA 2BE5C 4MRIA 4HMIA 3VYRA 2TSSA 4MIUA 3DM1A 2O53A 3NH5A 4PNYA 1ML8A 1V43A 2DE5A 1GUNA 1I4PA 5E1FA 4BBRB 4FF2A 3D6WA 2IWHA 1JORA 2GTHA 4C3JB 2AQ2B 4NBGA 5ELFA 2R7ZI 3GD7A 1R4PB 2BDOA 5BN5A 1ESFA 3VR6A 4DGLA 3TMEA 5C3WA 4F7XA 4A3JI 2PO4A 3NBHA 2F0EA 3VMHA 2F0PA 1TWFB 4ZAIA 5LL6X 5CV4A 2EY1A 3CCL1 4A3FI 3I3CA 1V1PB 3ITPA 3KLSA 2QEJC 2F3VA 1A3VA 4K5WA 1ZB8A 1VQLZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVR A;  2DE7 A;  2K01 A;  1DOK A;  4BXX I;  2MJ8 A;  4IUU A;  4NBA A;  4CJ2 C;  2HCC A;  1EQT A;  5E4W C;  4XDX A;  1I6H I;  1G2S A;  3GTO I;  5CMD A;  2FJ2 A;  3FKI I;  5COR A;  2HDM A;  1J9O A;  2E2I I;  1X32 A;  3H91 A;  2J6A A;  1JE4 A;  3MWY W;  5FLM I;  5D14 A;  1SFO I;  4BBS I;  2JR6 A;  5E4X A;  1IKM A;  4ZKC B;  2JA7 I;  2J7Z A;  1JIC A;  1MGS A;  2NWG A;  1VLA A;  1RHP A;  1I3Q I;  3H0G I;  4XX2 A;  3HOX I;  4IUR A;  1X3Z A;  3GTM S;  5IP9 I;  2B63 I;  1NR2 A;  5AFW A;  4RA8 A;  4BY1 I;  1BNZ A;  4BY7 I;  2BDN A;  1WW9 A;  5C3E I;  1EL0 A;  4XT3 B;  1RLY A;  4A3I I;  3GV3 A;  2KEC A;  1C8C A;  3PO3 S;  1SDF A;  2B2U C;  1ICW A;  2X69 A;  1NCV A;  1MSG A;  5JJZ A;  2R92 I;  4A3L I;  2AKL A;  3GTQ I;  1EOT A;  3S1M I;  2VUM I;  1HFG A;  4HAE A;  2DY7 A;  4HED A;  3R93 A;  3DEO A;  3S1R I;  4NBF A;  2L1B A;  1RJT A;  1F9R A;  1WTW A;  1WTR A;  3SVM A;  3Q6S A;  2MP1 A;  1L1O C;  1HUM A;  3HOY I;  2NYZ D;  2F4M A;  1TWG I;  4NBH A;  3VB9 A;  3HP3 A;  4HCS A;  2RSN A;  2NZ1 D;  4U68 A;  2B2T C;  1CA5 A;  3U50 C;  1NR4 A;  3GV6 A;  3LWE A;  5CBE E;  4OIK A;  1XX8 A;  4NW2 A;  3LUS A;  2F4O A;  1EIH A;  1VMP A;  2R3Z A;  1WVL A;  2KUM A;  1U4M A;  1RTO A;  2RVL A;  2IL8 A;  2X6L A;  3HOU I;  4A93 I;  1ZB9 A;  2KPI A;  2KOL A;  1USP A;  1QG7 A;  1U4R A;  1QYP A;  1ILP A;  5C4X I;  1F9Q A;  1AP0 A;  1I50 I;  2HCI A;  1LV9 A;  5C44 I;  1PFN A;  4R8I A;  2KED A;  5C4J I;  2JYO A;  1CA6 A;  5EKI A;  3M4O I;  2RBL A;  3RZD I;  2N88 A;  4A3M I;  2B2V C;  2MGS A;  4IUP A;  3S15 I;  5EQ0 A;  2PK7 A;  1WCM I;  5COY A;  1ESR A;  3GTP I;  3KUP A;  4A3B I;  2B2W C;  1R9T I;  1HFN A;  2JS4 A;  5IP7 I;  1HUN A;  2FMM A;  2Q8T A;  3CQZ I;  1TFI A;  3GTK I;  2HUG A;  3H3V J;  2FFK B;  2JA8 I;  1X3P A;  2K05 A;  2E2H I;  4DN4 M;  4NB8 A;  3HOV I;  2L9H A;  3G7L A;  4O42 A;  1WD1 A;  3S2D I;  4OIJ A;  5T1I A;  2HDL A;  1F9P A;  4RAU C;  3ONA B;  1SAP A;  1F9S A;  4X3S A;  2M2L A;  1ILQ A;  1G91 A;  3S1Q I;  1BBX C;  2B2Y C;  1BO0 A;  1DL6 A;  3GTL I;  1PFT A;  1O7Y A;  3UI2 A;  3I07 A;  3GTJ I;  3ESW A;  1HHV A;  4NB9 A;  2D9U A;  3S2H I;  2L4N A;  1X3Q A;  2KVM A;  1NUI A;  4NBE A;  1WTV A;  1WTO A;  2K04 A;  1S4Z A;  5EPJ A;  1WTX A;  5CBA E;  3VMI A;  4IUQ A;  3MTS A;  2NVX I;  1G6Z A;  2JNY A;  3TZD A;  3FPU B;  1U4P A;  2L11 A;  5EPK A;  1Y1V I;  2NVQ I;  4Y52 I;  4RWS C;  1X3W A;  1HA6 A;  1B3A A;  4ZKB B;  3HOZ I;  3IL8 A;  3VMG A;  2JA6 I;  2RSO A;  2H1E A;  1MSH A;  4X3K A;  4LMQ D;  1M8A A;  4IUT A;  1G2T A;  1DON A;  2XIW A;  3P7J A;  2SDF A;  3EER A;  3S17 I;  1CM9 A;  1AZQ A;  1WTP A;  2NVY I;  2HF1 A;  1ROD A;  2EOT A;  1E0B A;  1QE6 A;  3KBX A;  4NBD A;  4X3T A;  4NOZ A;  1PDQ A;  1GUW A;  1B2T A;  1F2L A;  2K03 A;  1RO4 A;  2EPB A;  1BF4 A;  3RZO I;  4BBR I;  4NBC A;  3PO2 I;  1K83 I;  2KEE A;  3S14 I;  2L12 A;  2MPM A;  2B2V A;  3GTG I;  3Q87 A;  1SSO A;  4NBB A;  4QTT A;  1AZP A;  3I8Z A;  1PLF A;  4IUV A;  1KNE A;  2DE6 A;  1LQL A;  4XT1 B;  1TWH I;  2B2W A;  3FDT A;  3S1N I;  1Y1V S;  2Q8R E;  4UAI A;  3TN2 A;  1TWC I;  1TWF I;  1YUA A;  4Y7N I;  2NVT I;  3I91 A;  1Y1W I;  5T1G A;  1PFB A;  1B4O A;  1EIG A;  3IFD A;  2EE1 A;  1XYI A;  5EPL A;  4A3D I;  5CM2 M;  4X3U A;  2B2U A;  1KNA A;  4QUF A;  1MI2 A;  1A15 A;  4MHE A;  1IKL A;  1TVX A;  3DEP A;  3M3Y I;  3F2U A;  4MN3 A;  2B2Y A;  1U4L A;  2VXW A;  2RA4 A;  1B50 A;  3K7A I;  4A3C I;  1IL8 A;  1PFM A;  4ZK9 B;  1N2F A;  4ZLT F;  3I4M I;  2YU9 I;  2N55 A;  5DNF A;  5D65 A;  4HSV A;  4A3G I;  2BJO A;  3QO2 A;  2DY8 A;  4CJ1 B;  2JA5 I;  1USP B;  3DM1 A;  1NAP A;  1ML8 A;  2X6G A;  2B2T A;  2DE5 A;  3S16 I;  1WTQ A;  1RTN A;  4QUC A;  4X6A I;  3D6W A;  1DOL A;  4A3K I;  5EJW A;  1VMC A;  1B53 A;  2K1B A;  3GCF A;  1HRJ A;  4NBG A;  1QNK A;  4A3E I;  1ZXT A;  1J8I A;  3GKQ A;  2FHT A;  4MH4 A;  2R7Z I;  1WD0 A;  4R9W A;  1O7Z A;  3N52 A;  4A3J I;  3GTM I;  1DZ1 A;  3VMH A;  2K28 A;  4ZAI A;  1DOM A;  4CJ0 B;  2P3Y A;  3HOW I;  3I90 A;  4A3F I;  4QTU A;  1O80 A;  2R93 I;  3I3C A;  1ML0 D;  3PO3 I;  3I4N I;  2JP1 A;  1Q3L A;  1TWA I;  2FIN B;  1ZB8 A;  2E2J I;  2K5R A; 
#chains in the Genus database with same CATH topology
 2F0S A;  4DUY Q;  3W2D A;  2EYF A;  4AQY Q;  4IUU A;  1J6Q A;  1DOK A;  4CJ2 C;  3G71 Z;  1PZK D;  1GKH A;  1EQT A;  1Q46 A;  5IP7 H;  1YJW Z;  3I4N G;  1II3 A;  3S1N H;  2K33 A;  3CXC Z;  1M1K 2;  1I6H I;  1JQY D;  1CI3 M;  4Y7N H;  3GTO I;  2UUA L;  5CMD A;  2FJ2 A;  1YNN C;  1Y1W H;  1S5F D;  2HD3 A;  1BBU A;  1X32 A;  3K5O A;  3JAM f;  2ENB A;  1VQA A;  3PF4 A;  5C0X H;  5D14 A;  3CPF A;  1BCP B;  4DR4 L;  1OXS C;  1EEI D;  3SGI A;  3PGZ A;  3JAM L;  5IIF A;  2JA7 I;  2ZM6 L;  2L15 A;  3D31 A;  1JIC A;  2YYZ A;  3CC7 A;  4JOI A;  4P71 A;  5FLM G;  1PH4 A;  2QA4 1;  4HH4 A;  2Q2U A;  2KCC A;  2Z6K C;  4NXM L;  2A1A A;  2Z4I A;  1M1K C;  4IUR A;  5F2D A;  4XQN A;  1PH9 A;  1VQO 1;  4OEL B;  3W1B A;  1DCZ A;  3PF5 A;  4L5R C;  1NR2 A;  3K7A H;  1OXU A;  4XQQ A;  1EYA A;  4RA8 A;  2JEA I;  1JJG A;  4J15 A;  1VQJ A;  1N34 Q;  1GXD C;  1VQ8 1;  1STN A;  2F0G A;  4XT3 B;  1SYF A;  1SE4 A;  4C3H B;  4DV2 Q;  4A3I I;  2C35 B;  5IP9 G;  1PYB A;  1B1Z A;  1N36 L;  4RKL A;  1W2B Y;  3TP8 A;  2VNU D;  3MVV A;  2B2U C;  1HTP A;  4G7Z C;  1GOZ A;  2CW0 D;  1CK1 A;  2JA5 H;  5C3E G;  4UP8 A;  2HIX A;  4KHV A;  5JJZ A;  4DUZ L;  2ZJQ A;  1TS3 A;  4M1U B;  4GLX A;  3MXG A;  4GKJ Q;  1EOT A;  3MXP A;  4IUN A;  4GOP C;  2DJF C;  3S1M I;  1HPC A;  2ZXP A;  1H9M A;  4HAE A;  4ZYS A;  1VQ5 A;  1XNQ L;  4A3K H;  4HED A;  1Q86 2;  3DEO A;  3S1R I;  2R92 G;  4JCV E;  1PTO C;  1WTW A;  2WAQ B;  1V1O A;  3NEN A;  4R4I A;  1KIX A;  1JJ2 Z;  3HOY I;  2DNE A;  2PQE A;  2QGQ A;  1UE5 A;  1Y14 B;  1VQ6 1;  3J81 i;  2R6M A;  2E2J B;  2F4M A;  1HNX Q;  5GAH C;  5FJ8 G;  3I56 1;  3KDF A;  3HP3 A;  2GU2 A;  4HCS A;  4LFC Q;  3GTM H;  2OTL A;  4CDF C;  2RSN A;  4KHZ A;  4LUV A;  4OXP A;  5GAD C;  1QIL A;  4TQU S;  3WWV A;  2XTI A;  1UUP A;  3NTI A;  2CWP A;  2M00 A;  1D1I A;  3LWE A;  1Q1B A;  1Q86 C;  3T51 B;  3IFU A;  2SNS A;  3LUS A;  2ICE C;  1UEA B;  2CCZ A;  4BBR H;  2R3Z A;  1TWA H;  2IW3 A;  1SMX A;  1OTC A;  1W3S A;  1U4M A;  2F0L A;  5M3M H;  3CME 1;  3PUY A;  2KPI A;  1I4Q A;  1H9S B;  4LUZ A;  3J81 b;  1I3Q B;  1Q12 A;  4FNF A;  4O0A A;  1HR0 Q;  1QG7 A;  1U4R A;  3HOW G;  3H0G B;  4HJ8 A;  1VDZ A;  4NH1 C;  3CCJ 1;  3H6M A;  5TSS A;  5M9O A;  1T5E A;  1ILP A;  2LIY A;  2B8F A;  3EFX D;  4TVA B;  3HOX B;  5C4X I;  5IGC A;  1LTL A;  3FKI H;  1I50 I;  3PO3 G;  4DV0 Q;  1RKN A;  2EYH A;  2EYL A;  4DV3 L;  1C7Y A;  2E2I H;  1R4Q B;  3M3Y B;  4BY7 B;  2VW9 A;  4IJL A;  4B08 A;  1SFO H;  4QJF A;  3H3V I;  4LF6 L;  2H5X A;  1FDO A;  1SEB D;  1CA6 A;  2B8G A;  5EBC A;  2VPY A;  2A73 B;  3M4O I;  3QB3 A;  5CYU A;  2GVA A;  4X66 L;  1E2W A;  4IUP A;  3QWU A;  3VA5 A;  5EQ0 A;  2IJ0 A;  2RCF A;  4LF5 Q;  1EFW A;  4BS9 A;  1S72 A;  1WFQ A;  1SJH D;  1Q82 2;  3GTP I;  1SMY D;  2A6E D;  4APV A;  3KUP A;  4A3M G;  1R9T I;  1YBY A;  4C3I G;  4DPG A;  4BY1 H;  2JS4 A;  5IP7 I;  4RHR A;  4DNT B;  5FOB B;  1VQM 1;  4DV6 Q;  4PQX A;  1VQ9 Z;  1TFI A;  3I55 Z;  2IY5 B;  4POF A;  2AQ3 B;  5IGD A;  2HUG A;  1DD2 A;  2FFK B;  4ODG A;  2K05 A;  2E2H I;  3K5N A;  4G7O C;  3ERO A;  3NK9 A;  1YVC A;  4A3L H;  2PNR C;  4O42 A;  3GTQ H;  5M5X H;  3K57 A;  2GVB A;  1Q81 C;  4LF7 L;  2A68 D;  1ENC A;  4QGU A;  4RVH A;  1F9P A;  1Z9F A;  2QKI C;  4RAU C;  3ONA B;  1PH5 A;  2JA8 G;  3CCE Z;  5JVH 3;  2A8V A;  1Z03 A;  2BE5 D;  1STA A;  4KJO A;  2WB1 G;  4MNO A;  1G91 A;  1BO0 A;  2G9D A;  3QIA A;  1DL6 A;  3NDI A;  3CCU A;  2PQA A;  3IKJ A;  4C1N I;  3MZL B;  4X6A H;  1Q8K A;  3NBH B;  2QR1 B;  2JIR A;  3MFY A;  4F87 A;  1TT2 A;  2BA0 A;  4KI0 A;  3UI2 A;  3I07 A;  3EED A;  3GTJ I;  1K28 A;  2WIN B;  1TWG H;  2ZXO A;  4EWC A;  3W1G A;  1PA6 A;  3HOU B;  3F3P C;  3CHB D;  1CSQ A;  3MXU A;  5AJ3 Q;  4KHP Q;  2KJX A;  2D9U A;  4CDE C;  3S2H I;  2EJF C;  1NSN S;  4NKL A;  3Q0A A;  1VQC A;  1PMR A;  3URY A;  3VMI A;  4IUQ A;  3MTS A;  4DXG A;  1G6Z A;  2JNY A;  3CPW A;  3MA2 B;  1B9M A;  2H4O A;  2D5D A;  1XMO L;  5EPK A;  4IPC A;  5C4J B;  1IBM Q;  4XIG S;  3TDQ A;  1G51 A;  3J7A 4;  1P8L A;  4ZKB B;  1RQF A;  3IL8 A;  1W2B Z;  4X64 Q;  2H1E A;  3A74 A;  2UXC L;  4DK0 A;  5M3F H;  4RVF A;  1WCM B;  5IYD G;  3NPP A;  3K81 C;  1E2V A;  1K8A 2;  1SNP A;  3NE5 B;  3P7J A;  1PH8 A;  3TRZ A;  1LT3 D;  3HOZ G;  3KLR A;  4DF7 A;  1JOQ A;  2R7D A;  1AZQ A;  1GO3 E;  2W03 A;  1KLG D;  2O5I C;  2E76 C;  5IE8 A;  3M9B A;  4DV1 Q;  1EWC A;  3JC6 6;  5ELD A;  3KBX A;  3VYS A;  3CU7 A;  1RO2 A;  4RVG A;  1PRT B;  2EJM A;  3GTK B;  3BVZ A;  1VQP 1;  1F2L A;  2K03 A;  2E8G A;  1YNN D;  2EPB A;  3D4R A;  4PMW A;  2F0D A;  5M5Y B;  4PMB A;  3HOV B;  4S1T A;  1PH1 A;  4DR6 Q;  2ICI A;  4BBR I;  3V96 A;  4NBC A;  4L5Q A;  2GA4 B;  3CCR 1;  2CHB D;  2VS1 A;  1QXF A;  1TXY A;  4KV6 A;  4KKT A;  4Q5V A;  5IGB A;  3S2D B;  5FLX f;  4EVO A;  2B2V A;  4A3B H;  3Q87 A;  1I3Q H;  3H0G H;  1O7L A;  2IV2 X;  5CV9 A;  3K58 A;  1KNE A;  2N78 A;  3S1Q B;  4MD7 A;  3D4W A;  5FLX L;  2QA4 Z;  4WRD A;  3VA7 A;  3CCQ A;  1I94 Q;  4XT1 B;  2EYP A;  1E7Z A;  2VPW A;  3BZD B;  1XJV A;  3PCO B;  3CC4 A;  4BY7 H;  4IFD G;  3BYT B;  5G3L D;  1YI2 Z;  3WDN A;  4UAI A;  4NXN L;  3OW7 A;  1TWF I;  1YUA A;  1YJ9 Z;  1A6X A;  2QW7 A;  2JQO A;  3A7L A;  3CCS 1;  3G6J B;  4JBW A;  5JJI A;  4XQJ A;  3PIP 3;  1TQO A;  5T1G A;  2SEB D;  2MHV A;  2K75 A;  3J81 E;  1PZJ D;  5K36 H;  2RDF A;  3SDZ A;  3J81 c;  2F4V Q;  1QVG A;  1XYI A;  4FF1 A;  1TU2 B;  1YIJ A;  4LFA L;  1L0X B;  5ELC A;  4RG1 A;  3L2P A;  4IFD J;  1FJG L;  1AW7 A;  1E24 A;  1K0R A;  2N49 A;  2VUM H;  3DHQ A;  3KDF B;  1BUV T;  1KLU D;  1PFS A;  2F0O A;  3I4L A;  1NMG A;  2QEX A;  1D7Q A;  2VB3 X;  1IKL A;  2F52 A;  1KC8 2;  4CKB A;  1XTC D;  1VQE A;  3DEP A;  4JYA L;  1Q82 1;  2AWN A;  3AEV A;  2JA6 B;  1U4L A;  2ZTE A;  4JG2 A;  4ME5 A;  5LMU L;  1PTO D;  1N9W A;  1IL8 A;  2EDG A;  4A4I A;  1BR9 A;  3CCU 1;  1LLR D;  4DR3 Q;  1N2F A;  2E9H A;  4OL7 A;  1K73 2;  1GUT A;  4GLV B;  4WFN 3;  1VQ6 Z;  1UE7 A;  2N55 A;  3VR3 A;  1JWM D;  4A75 A;  2F0J A;  2NBF A;  1GHK A;  4GN4 B;  1FDI A;  5D65 A;  1S7M A;  1XPO A;  4QL5 A;  3CKI B;  4OO1 I;  5BN3 A;  5C4X B;  2KHJ A;  5C6A A;  4CJ1 B;  4HIK A;  3WOE A;  1BCP C;  3CD6 1;  1HR0 W;  1N32 L;  1NAP A;  1STE A;  1KC8 C;  1MJC A;  2B2T A;  3CCM Z;  1EYD A;  1Y8C A;  3RZO B;  1A2T A;  1WTQ A;  5I6Y A;  1MHW C;  4X6A I;  1STH A;  3CXC Y;  4UDU C;  1SLJ A;  2XGT A;  1AEX A;  1SE3 A;  5EJW A;  3PO2 B;  3D2L A;  1VMC A;  1B53 A;  3C1E A;  2NZH A;  3S14 B;  1GUS A;  1HRJ A;  1SYE A;  1I4R A;  1GVP A;  1ZXT A;  2JUB A;  4J8Q A;  4HJ7 A;  5LMN Q;  1J8I A;  1VQ4 1;  2NVY H;  4DR7 L;  1FGU A;  2E5L Q;  2Z1C A;  3OHX C;  3NHH A;  1O7Z A;  2O4X A;  3B6Y A;  1I4X A;  3RN2 A;  4RS4 A;  2CQA A;  5C4Z A;  1DZ1 A;  4ULL A;  5JPM C;  3S1N B;  3JAM i;  3F3F C;  5C44 H;  2JIM A;  1YJN A;  3GO5 A;  3CCL A;  4CGY B;  5CC4 A;  4Y7N B;  2R7Z G;  2D2C C;  2JN4 A;  1KAB A;  3RNU A;  3I90 A;  3RLF A;  1Y1W B;  1K83 H;  4HCE A;  2K5H A;  2XNA C;  4A3J G;  3CCV A;  3CMA A;  1NTG A;  4R4Q A;  2J4X A;  1ASZ A;  1HJP A;  1V9P A;  2F3I A;  3TZU A;  1RIP A;  1ML0 D;  1MJE A;  1SXT A;  2MFI A;  1FL0 A;  2XRS D;  3HGB A;  2E2J I;  1WJ2 A;  4A3F G;  2K5R A;  3Q22 A;  3TBI B;  2JSO A;  1X55 A;  2CVR A;  1VQI A;  1VQ7 1;  2K01 A;  3UDI A;  4BXX I;  5LL6 f;  1DM0 B;  4JI6 Q;  2HCC A;  2E7Z A;  1K8A 1;  2VZA A;  5A2Q E;  2LFN A;  4L8J A;  3WOF A;  5A35 A;  2NVT H;  3CC7 Z;  3AMU A;  3JAM b;  4FVM A;  5COR A;  3NSW A;  2IX3 A;  3K7A B;  1NNX A;  5H1S E;  1PH6 A;  4JI1 L;  1RNI A;  4JI0 L;  3OMC A;  1ZH1 A;  3MC0 B;  5M5Y H;  3H91 A;  3VR2 A;  1W6J A;  2K5D A;  3OIP A;  3MWY W;  2KEN A;  1NJI C;  2PQA B;  1WOC A;  3E0J A;  4KY5 A;  1U5K A;  4IPH A;  3FP9 A;  5JEA G;  2CH4 A;  4E2W A;  4E2Y A;  1VQK 1;  1PYW D;  2J7Z A;  4B9W A;  1UNS A;  1MGS A;  4H02 A;  2JA5 B;  5C5M A;  1I3Q I;  1VQO A;  1B9N A;  3H0G I;  2HHH L;  1QZH A;  3S1Q H;  4DUY L;  1L2F A;  2V3V A;  3HOX I;  4IOA A;  3GTM S;  4LF9 Q;  4OWW B;  1YIJ 1;  1QUQ A;  3LGJ A;  3HEJ A;  3SK4 A;  1LO5 D;  1VQ8 A;  4A3C H;  4A3K B;  1T5X D;  3NWS A;  3SXH A;  4BY7 I;  2BDN A;  5JEA J;  3I4M H;  2QEX 1;  2YU9 H;  3OWE B;  1LTS D;  1VQ5 Z;  1CQV A;  1Z02 A;  1SNO A;  2GN5 A;  3AFP A;  2Y0S G;  3T1Y Q;  2HU9 A;  3PO3 S;  1FR3 A;  1ICW A;  3TSS A;  3J7Y W;  4C1N K;  2R7F A;  2NVX H;  4AYB G;  3GTM B;  1AN8 A;  3NDJ A;  2K52 A;  3ICE A;  2HIV A;  3DWP A;  5JVG 3;  4A3I G;  2R61 A;  3PUW A;  5IT9 f;  2NVQ H;  3ULL A;  4Y52 H;  1SYB A;  2OOY B;  2VUM I;  2PYK A;  4RKB A;  3PUX A;  3S16 H;  5C4H A;  2B29 A;  2OTL Z;  3R93 A;  2NN6 I;  4E30 A;  1C4Q A;  5IT9 L;  2LXK A;  4ABN A;  1U9R A;  5I6W A;  2PI2 A;  1M90 1;  2KBN A;  1WTR A;  1N8R 2;  2PPB C;  4A3G G;  3Q6S A;  2MP1 A;  1TWA B;  3I56 A;  1FGB D;  2V8I A;  5M5W B;  1YHB A;  3NXW A;  4DR5 Q;  2AQ1 B;  4QB4 A;  5M3M B;  1HXY D;  3VB9 A;  4DV5 L;  1YHQ A;  1F2Z A;  1TS4 A;  3KF6 A;  5IYC G;  3HOY G;  3QWN A;  2OWO A;  1XMQ L;  3F8T A;  1K73 1;  3TS0 A;  3GV6 A;  3KJO A;  3OYY A;  3FKI B;  1CKM A;  4A3E G;  1BXT A;  1VF7 A;  5CBE E;  4OIK A;  2E2I B;  4GKJ L;  1H9R A;  2ZT9 C;  1EEF D;  3KIH A;  4ZUI A;  4NW2 A;  1EZ8 A;  1SFO B;  2ATW A;  3I4N H;  1VMP A;  3CME A;  4C2M H;  3G4S A;  1VS0 A;  3HKS A;  1YJN 1;  3PIO A;  3K6O A;  2PCF B;  2RVL A;  2IL8 A;  2X6L A;  3NTK A;  3HOU I;  3CCJ A;  1KAW A;  2WKC A;  3BDL A;  4I65 A;  2YTV A;  3CCV 1;  3CMA 1;  1JMC A;  3EA6 A;  2EYM A;  3AB9 A;  4DK3 C;  2MO1 A;  1HNX L;  1KD1 1;  2R93 G;  1NBW A;  4LFC L;  5KEE A;  1AP0 A;  2F0V A;  1LUZ A;  4AIM A;  2HCI A;  1S72 Z;  3CRL C;  4BY1 B;  1JWS D;  3BU2 A;  4ZRZ A;  1UEB A;  5C44 I;  3GQB A;  4RGT A;  5J22 A;  5FLM H;  2KHI A;  4UHV A;  1CUK A;  4K0K Q;  2KED A;  5C4J I;  4AH6 A;  1LT5 D;  3G6E 1;  5EKI A;  2L5T A;  2K50 A;  5NUC A;  2N3S A;  1NUC A;  4IPD A;  3DMU A;  5CGK A;  3HS0 C;  2GTI A;  3I2Z A;  1B44 D;  1WCM I;  3A55 A;  4X65 L;  1PZI D;  4ZCK A;  5D1O A;  4NFR A;  4PMC A;  5M5X B;  3GTQ B;  2KCN A;  3J80 f;  3QOJ A;  1YIT Z;  1VQN 1;  2HQE A;  4PZ7 A;  4YY3 Q;  1VQM A;  4YCW A;  1K8O A;  5IP9 H;  2UXB L;  1HR0 L;  1L1O B;  5CV7 A;  3VYT A;  1HFN A;  2ZAE B;  1EQV A;  4BBS G;  3KLS X;  1HZB A;  4TKO B;  3X3N A;  3J80 L;  5C3E H;  5CV8 A;  1ENF A;  2I5H A;  3HKZ A;  3NH4 A;  2Q8T A;  5BR8 Q;  5G3L F;  3A7A B;  2K5N A;  1BQQ T;  4LAA A;  4DV0 L;  4RCN A;  3GTK I;  1H9J A;  4MD9 A;  3H3V J;  2EXD A;  1TWG B;  2PW5 A;  1A8V A;  2JA9 A;  3HOV I;  3CCU Z;  1EZ6 A;  1WZN A;  1KDC A;  4B3T Q;  4OX9 L;  2R92 H;  1PRT C;  2Y0S A;  4N8X 1;  1GD7 A;  2B63 G;  1W6K A;  3MXN B;  4LFB L;  4CL1 A;  4FDB A;  4JI4 Q;  3P75 A;  3S2D I;  4CKE A;  1EYG A;  4Z9C B;  1JB3 A;  5GAE C;  2IT1 A;  2PNH A;  5LMN W;  1SAP A;  2YAD A;  1F9S A;  2IHF A;  1XNR L;  4X3S A;  5FJ8 H;  4K2L A;  3EBE A;  1ILQ A;  1KXL A;  3S1Q I;  4GOP A;  1QF8 A;  2B2Y C;  3SK5 A;  3JAM E;  1CZG A;  4RH6 A;  2WP8 J;  3JAM c;  3FQQ A;  1VCI A;  3CPW Z;  2OTJ 1;  1FNU A;  4QIW E;  5LHY 1;  1O7Y A;  2EJG C;  3OSO A;  2MUY A;  5K5P A;  1PTO F;  3BG1 B;  4NB9 A;  3RLO A;  1SJE D;  4E31 A;  4LWC A;  5M3F B;  2L4N A;  4K2K A;  2KVM A;  4QMG A;  1NUI A;  4NBE A;  1A3U A;  4LF4 L;  3IR7 A;  2EIF A;  2I5M X;  2OEO A;  1WTO A;  4FXG C;  2VL6 A;  4JBK A;  2VY3 A;  1WTX A;  2JE6 I;  4OHJ A;  3RD4 A;  1I4G A;  2NVX I;  4XYO A;  1TS5 A;  5CR3 A;  3FPU B;  1U4P A;  3PUZ A;  1YHQ 1;  1SNC A;  2Q4Z A;  5FO9 B;  2NVQ I;  2K5W A;  3HOW H;  3PV0 A;  4Y52 I;  2SOB A;  2XWB B;  1KRL A;  3AQQ A;  4B9X A;  1HA6 A;  1E1O A;  3D4D A;  3VMG A;  4JBM A;  2JA6 I;  3PO3 H;  1LAC A;  5J1Z A;  5BN4 A;  3UDG A;  3D9X A;  3MEH A;  3T13 A;  2E74 C;  4ZUJ A;  4LMQ D;  4RGN A;  4IUT A;  2WII B;  5M5W H;  2I0Q A;  1N8R 1;  4G7H C;  3G4S 1;  4LF8 L;  1CM9 A;  5AJ3 L;  4KHP L;  2PMZ E;  4A3B B;  2P5Z X;  1HA5 A;  2HF1 A;  4POG A;  1EOV A;  1HZ9 A;  4MZ9 A;  2OCE A;  3RLN A;  5KYL A;  1VQP A;  1GUG A;  1QE6 A;  5I4D A;  1CKN B;  4DK1 A;  4A93 G;  2AUJ D;  1FVI A;  2F03 A;  1D6E C;  3I73 A;  1GUW A;  4HIM A;  4RHS A;  3RZD H;  3CCR A;  4A3M H;  4GNX A;  3TEH B;  3CCQ Z;  1IBM L;  3RZO I;  1XTD A;  1QVF A;  4C3I H;  3S15 H;  1QUQ B;  4E33 A;  5FLX b;  1KDB A;  4E6I A;  3VTN A;  3CC4 Z;  3PO2 I;  2KEE A;  1KQS Y;  3S14 I;  4JPB W;  2L12 A;  4JBJ A;  1E1T A;  3H3V C;  3DM3 A;  2EY6 A;  5L37 A;  1Q81 2;  2PMZ A;  1EQR A;  4JK1 C;  1ICF B;  1QJO A;  4I7Z C;  5I9P A;  1LQL A;  4C3J G;  2VUM B;  2HQL A;  3CQZ H;  3PQI A;  1QVG Z;  1QNU A;  3S1N I;  4DV1 L;  5ISR A;  1YIJ Z;  1K9M C;  3CCS A;  1Y1V S;  2Q8R E;  2IHE A;  2JA8 H;  1VQL A;  4Y7N I;  3BVM A;  3I91 A;  1C48 A;  2QEX Z;  1SBB B;  1Y1W I;  1M1K 1;  1STB A;  1B4O A;  3H94 A;  1EIG A;  5ELE A;  1JOO A;  4DR6 L;  2K5V A;  3RUZ A;  4YCV A;  5C0X I;  4PG3 A;  1XNQ Q;  4DFA A;  3ER0 A;  4L63 B;  4X3U A;  3V05 A;  3QOL A;  4J6H A;  1Y1V B;  2I46 A;  3T1H Q;  1KNA A;  2K32 A;  1A15 A;  5DM6 3;  2F0I A;  3KF6 B;  1I4H A;  2UUB Q;  3FQM A;  4MN3 A;  2IZ3 A;  1I94 L;  1ZEQ X;  2VXW A;  3K7A I;  5IY0 A;  1PFM A;  5IYB G;  2QDL A;  2UUC L;  1AE2 A;  1X6O A;  3N6R A;  1HQR D;  2NVY B;  3CD6 A;  3OMG A;  4P73 A;  3QO2 A;  1YUK A;  2F4V L;  5IYD H;  4TRD A;  2JA5 I;  1F2M A;  3OTO Q;  2LKV A;  2O5J C;  1NY4 A;  3HOZ H;  5C44 B;  2AUK A;  1Q7Y C;  5A2Q b;  1EY5 A;  4KN4 C;  1PYS B;  3OPO A;  4OO1 G;  4QUC A;  1KRT A;  1SNQ A;  2F0F A;  1EY9 A;  4KK7 A;  1DOL A;  4A3K I;  1E3P A;  2JK8 A;  2RBM A;  4IJH A;  4TSS A;  1HTL D;  1K83 B;  1ZYR C;  1VQ4 A;  3GCF A;  3S17 H;  3CCL Z;  1F2Y A;  2AKW B;  4JVZ A;  1Q86 1;  5KNC A;  3P1H A;  4EGV A;  1WII A;  1IYU A;  1WD0 A;  3CCV Z;  4R9W A;  4DV3 Q;  4DXF A;  4R4C A;  2C5C A;  4KKU A;  3N52 A;  2F4I A;  4B3R Q;  1JWU D;  3GTM I;  1JJ2 A;  3LX0 A;  1NP6 A;  4A76 A;  4C3H G;  5D1O B;  4V19 0;  2F0N A;  4ID6 A;  2ZTC A;  2K28 A;  1IBK Q;  2NVT B;  4CJ0 B;  2UXD Q;  3HOW I;  3QJY A;  1I6V C;  4QTU A;  4B3M Q;  4FF3 A;  3SE0 A;  3M4Y A;  3HKZ B;  3GTG H;  4MXU A;  3PO3 I;  3NEM A;  4IFD H;  1Q3L A;  1TWA I;  4PZ6 A;  1Z01 A;  2QRE B;  1VQ7 A;  2FIN B;  4NB3 A;  2WKD A;  4DQY B;  1LYL A;  1TWH H;  3FRP B;  5LMN L;  1A3T A;  2WAQ G;  2RHB A;  4DAM A;  5FK9 C;  4X62 Q;  5D3D A;  5E4W C;  3ERQ A;  4XDX A;  3NWT A;  1TWC H;  1G2S A;  1QZG A;  2G9H D;  3OW2 A;  4KTA A;  3FKI I;  2VF1 A;  3Q24 A;  1VQO Z;  3E9H A;  3C2P A;  4BXX G;  4CDC C;  1HNZ Q;  2E2I I;  2Q2I A;  2O4H A;  4GN5 A;  5EKK A;  1S40 A;  3I4M B;  1JE4 A;  3O13 A;  2YU9 B;  1X3E A;  1SFO I;  1VQK A;  2PZU A;  1VQ8 Z;  2JR6 A;  2YTY A;  1VQL 1;  2ID0 A;  3BJU A;  5DM7 3;  4A3G B;  3G71 1;  1PRT D;  2WFW A;  1CHQ D;  1IBL L;  1YJW 1;  1A63 A;  2NWG A;  3U9S A;  1RHP A;  2NVX B;  2F0Q A;  2LY7 A;  2EXZ A;  4DNI A;  2XWJ B;  1LM0 A;  1UAP A;  4JI7 Q;  4JC0 A;  3GTL H;  2NVQ B;  3KYH C;  4CKC A;  3S16 B;  3U58 A;  4JI6 L;  4WJ3 M;  3AU7 A;  5AFW A;  1X3F A;  1Q81 1;  4G4K A;  2WB1 A;  4BY1 I;  4A3D G;  1N33 L;  1EWH A;  1CSP A;  1WW9 A;  1KQS Z;  2I3C A;  1EL0 A;  4E2X A;  1TS2 A;  5FLX E;  3HOX G;  5FLX c;  2F0T A;  1GM5 A;  2NTS A;  1RLY A;  1CQF A;  4LJZ C;  3PIO 3;  2JIP A;  3KF8 A;  2ES2 A;  4DV4 Q;  2PW7 A;  2WAC A;  3NEL A;  1C8C A;  3NH8 A;  4QIW B;  3OWF A;  2X69 A;  3T4N B;  5IT9 b;  2K14 A;  1ASY A;  3I56 Z;  1DJR D;  3VDY A;  3IF8 A;  2VQE Q;  4A3L I;  3EIV A;  2EGT A;  4QY7 A;  4RGM A;  5EBD A;  2Q2T A;  1QVF Y;  3GTQ I;  5GRO A;  4JI5 Q;  3KFU A;  1Y1V H;  5E7N A;  1HFG A;  4FXD A;  1YHQ Z;  1D8L A;  2QRD B;  2I07 B;  3K80 C;  2DY7 A;  1BCP F;  3KIF A;  1FYC A;  4NBF A;  4BA1 I;  1A2U A;  2DGY A;  2R93 B;  2L1B A;  4DA2 A;  1F9R A;  2RCN A;  4L5T A;  5EGT A;  4LF9 L;  3SVM A;  3I4N B;  1L1O C;  1HUM A;  4DV7 Q;  4O2D A;  4C2M B;  1Y69 U;  2CW0 C;  2R7Z H;  2OOX B;  2BOS A;  2NN6 G;  1TWG I;  2V4D A;  4GNX B;  2V8K A;  4A3J H;  3CME Z;  3G4S Z;  4I7A A;  1KHI A;  3T1Y L;  2YV5 A;  5JOB A;  1H9K A;  5C3X A;  2XRQ D;  2NZ1 D;  2B2T C;  1CA5 A;  3CCJ Z;  1QVC A;  3U50 C;  3D8G A;  3NP8 A;  4HGY A;  4A3F H;  3I7F A;  1XX8 A;  2PMZ B;  1X56 A;  3RMH A;  3P5J B;  2UXB Q;  3M7N A;  1EIH A;  4FXK C;  3BYY B;  1Q1E A;  1ET9 A;  2ASB A;  2OZK A;  2KUM A;  3J80 i;  3U9O A;  1VQD A;  4DR1 L;  2UU9 L;  1NJI 2;  2L55 A;  1ZB9 A;  1Q16 A;  4FO2 A;  2ZXR A;  2KOL A;  1BKB A;  1FNV A;  1USP A;  3SR1 A;  3A0J A;  3MZ5 A;  2IZ4 A;  1I6H H;  1QYP A;  4F8M A;  4DR5 L;  1MD2 D;  1W2B A;  1F9Q A;  1KDA A;  3HOU G;  5JEA H;  3DUZ A;  4CBV A;  4C56 C;  1T9H A;  1J5E Q;  1LV9 A;  4MON A;  2G2K A;  3G6E A;  4JI8 Q;  5CV6 A;  3E5S A;  5C3E B;  1PXU A;  2R6G A;  4R8I A;  1VQM Z;  4JI3 Q;  1RD9 D;  2VQF Q;  3ND8 A;  5KRU A;  3L0O A;  4G57 A;  4LFA Q;  1UE6 A;  2LMC B;  5CV5 A;  2ZJP A;  1FJG Q;  3CPW Y;  3J80 b;  1VQN A;  2R92 B;  4Q0F A;  5COY A;  1FD7 D;  2QKD A;  1ESR A;  3LNN A;  4DR2 Q;  4YIJ A;  4JYA Q;  1G6P A;  4A3B I;  2B2W C;  2H85 A;  1E22 A;  5LMU Q;  2DJG C;  4JW0 A;  2LXJ A;  1HUN A;  1WCM G;  3CC2 A;  1LTR D;  4K5V A;  4KD3 A;  2FMM A;  4AQY L;  4KY7 A;  2JA7 G;  1E2Z A;  3Q8D A;  4A3I H;  2PI2 E;  3E0E A;  1X0T A;  1EYC A;  4K0K L;  1SNM A;  3E9I A;  2L9H A;  2KA7 A;  4UP7 A;  3HFZ B;  4QCL A;  3G7L A;  1D2B A;  1SMY C;  3BZK A;  1L0W A;  1N32 Q;  4YWL A;  4A3G H;  1PTO H;  1WD1 A;  2HT1 A;  3S1M H;  4OIJ A;  2HDL A;  4KD4 A;  4DKA C;  3SEB A;  3TE5 B;  3L9A X;  3HOV G;  3S1R H;  2M2L A;  1VQ9 1;  4WJW A;  1BBX C;  4YY3 L;  2OTJ A;  2QIL A;  3I55 1;  2DNC A;  4HSP A;  3GTL I;  5IYC H;  2FXQ A;  3HOW B;  2M6N A;  3HOY H;  3U4Z A;  4H44 C;  3FVQ A;  5HY6 A;  4KMU C;  5IWA Q;  2D0P A;  5BR8 L;  4A3E H;  4A93 B;  2F0M A;  4HTH A;  2D0O A;  3PO3 B;  2ZTD A;  1ZYR D;  3MEF A;  4ALP A;  1YZ6 A;  1KC8 1;  4K14 A;  4R4T A;  3U4V A;  4GKK Q;  1N34 L;  1WTV A;  4GLA C;  3BDC A;  3D0F A;  3EQL C;  3HZX A;  4QF4 A;  4CHT B;  1S4Z A;  3CCE 1;  5EPJ A;  4JI2 Q;  2IX0 A;  1SYC A;  5GAG C;  4XTC S;  5CBA E;  4GN3 B;  4DV2 L;  4B3T L;  1EY0 A;  3W3A A;  5FO7 B;  3R2T A;  3TZD A;  2A69 C;  4IAL A;  4JI4 L;  2L11 A;  4K6L A;  1WJJ A;  1Y1V I;  1AA6 A;  2QCP X;  4RMF A;  1AFP A;  1X3W A;  3MZK B;  3I70 A;  3J7A V;  2R93 H;  2EY5 A;  3NFZ A;  1B3A A;  3RZD B;  1LTI D;  1VQP Z;  1QVG Y;  4J1M A;  1K3R A;  3T56 B;  5IOD A;  4A3M B;  3S15 B;  4RCO A;  4C3I B;  1LTT D;  1MSH A;  3AYH B;  4X3K A;  1G2T A;  1DON A;  4HJ9 A;  2XIW A;  3E6Z X;  3CCR Z;  5IT9 E;  1QVF Z;  3HG9 A;  3KBG A;  1IHZ A;  5IT9 c;  1F77 A;  1X54 A;  4L6T B;  1TR5 A;  2JA6 G;  1WTP A;  2NVY I;  2RDG A;  2EOT A;  5C5L A;  4IO9 A;  1RF2 D;  4X3T A;  4NBD A;  2RIQ A;  1H95 A;  5KGU A;  3CQZ B;  3TP6 A;  4ILW A;  4M8A A;  3HKZ E;  1QB5 D;  1V1Q A;  5KNB A;  3C46 A;  3M4O H;  1B2T A;  1RO4 A;  2JA8 B;  1BF4 A;  3FHW A;  2RHS B;  1SYD A;  4OEM B;  4BBS H;  5C4X G;  2Z4H A;  2AWO A;  3A8J E;  2LEX A;  1EIY B;  2WB1 B;  1K83 I;  3CCS Z;  1HNW Q;  1QOH A;  1IXR A;  2Y0S E;  3GTP H;  4DGZ A;  4YHH Q;  1U0L A;  3BVG A;  1PVO A;  1R9T H;  4QTT A;  1AZP A;  3FEW X;  1JR0 D;  1XPU A;  1EIF A;  3KF8 B;  4AYB E;  1DXM A;  4NP5 A;  5T64 A;  1NJI 1;  4IUV A;  3PO2 G;  2QF7 A;  2AHO B;  1CT1 D;  2B63 H;  5HGT A;  3FDT A;  2M48 A;  2K4K A;  1BOS A;  2OQ0 A;  1LTG D;  2Z6K A;  3DWQ A;  4HIO A;  3TN2 A;  4JV5 Q;  3NTH A;  2E2H H;  1OXT A;  2NVT I;  2F0H A;  1UE1 A;  5IOC A;  2LS0 1;  3CC2 1;  4B3S Q;  1PFB A;  5IP7 G;  4JOI C;  3M85 A;  1SND A;  1K8M A;  5HUR A;  2Q51 A;  5FKA C;  5CM2 M;  1PRT F;  1YNJ C;  1Y1W G;  1C9O A;  2B2U A;  2E2D C;  2E75 C;  4AYB A;  3STB C;  4LF5 L;  1YI2 1;  1S5D D;  1IW7 C;  4IQZ A;  4KN7 C;  4K8I A;  1TY0 A;  5C0X G;  3CAM A;  4MHE A;  1YJ9 1;  2KI7 B;  3GTJ H;  3CD6 Z;  1JCK B;  1BCP D;  3F2U A;  3HOZ B;  1Z47 A;  2B2Y A;  4NPS A;  1Z6H A;  3T16 A;  3NQI A;  4DAP A;  1VF5 C;  2EVB A;  1EUJ A;  2RA4 A;  4DV5 Q;  4RGO S;  3V2T A;  3S2H H;  4A3C I;  4S3S A;  3P20 A;  4OON A;  4DV6 L;  4ZK9 B;  1EQQ A;  3CRK C;  4KY6 A;  3I4M I;  1ENA A;  1XMQ Q;  3S17 B;  3J80 E;  3J7Z C;  2YU9 I;  3J80 c;  1EU4 A;  2QRC B;  5DNF A;  2F0U A;  1VQF A;  2EZV A;  1VQ4 Z;  2OF1 A;  5C0X J;  4A3G I;  2BJO A;  4LW1 A;  5JJL A;  1V8Q A;  3EJI A;  1S5C D;  2DY8 A;  1B8A A;  1ET6 A;  2W04 A;  1USP B;  1EY7 A;  5IGE A;  5D3I B;  2PZW A;  1S5E D;  2X6G A;  2NTT A;  4MTK A;  1JB7 A;  2EYJ A;  1SE8 A;  3T1H L;  4XYQ A;  3S16 I;  1OO9 B;  1RTN A;  1EWI A;  1JWH C;  1YEZ A;  2JA5 G;  2UUB L;  1LT4 D;  2F1M A;  5AN9 F;  3A8K E;  1STG A;  5KYI A;  2K1B A;  4A93 H;  4LUO A;  1QNK A;  1XXG A;  4A3E I;  2XVS A;  3A54 A;  3GTG B;  3GKQ A;  2FHT A;  3DLL A;  3MAQ A;  4MH4 A;  3M4Q A;  3ZJY C;  4A3K G;  1EY6 A;  2UUA Q;  1TWH B;  3TP7 A;  3R3O A;  3BS1 A;  1VQ7 Z;  3CCM 1;  1HZC A;  1X65 A;  1TWC B;  2CWA A;  2OT2 A;  1CTM A;  3IX0 A;  1K3B C;  3R8B A;  1DOM A;  1BDO A;  3OTO L;  2P3Y A;  3DXJ C;  1K9M 2;  1JE5 A;  4DR4 Q;  1O80 A;  4C3J H;  2R93 I;  4X65 Q;  2ZM6 Q;  3OW2 Z;  5ELN A;  3TQY A;  3CW2 C;  2VUG A;  2KQ3 A;  2JP1 A;  3I4N I;  5D1P A;  1CFM A;  5KIX A;  3RN5 A;  4A3D B;  3ZYY X;  2RF4 A;  3BDO A;  1I5F A;  4X64 L;  3ULP A;  4NXM Q;  2XSC A;  1KL9 A;  3BG3 A;  2DE7 A;  1VQK Z;  4IN3 A;  2MJ8 A;  4OGQ C;  4NBA A;  4H7B A;  3VR4 A;  4BBR G;  3D6C A;  1TWF H;  1PH3 A;  5JJK A;  3F1Z A;  1B70 B;  1Y8P B;  4GNX C;  4L5S A;  3TRE A;  3GTL B;  4B3R L;  2CH4 W;  2PZT A;  5J3B A;  1D5Z C;  5M3M G;  2MNA A;  2BCO A;  2HDM A;  3VYU A;  1J9O A;  2Z6B A;  4OX9 Q;  3H15 A;  4E32 A;  1JJC B;  1DGS A;  3MHB A;  3T53 B;  2M9V A;  5LL6 S;  2AYD A;  1LTA D;  1N36 Q;  1IBK L;  2J6A A;  4LFB Q;  4TNU A;  5FLM I;  2UXD L;  1P16 A;  2A6H C;  3G71 A;  4BBS I;  2B3G A;  3FMC A;  1YJW A;  4KJN A;  3FKI G;  5E4X A;  3F2B A;  4DUZ Q;  1IKM A;  1XNR Q;  1RCV D;  5JPN C;  3CXC A;  4B3M L;  4ZKC B;  4QQB X;  1QCB D;  3F2C A;  2QDB A;  1L0Y B;  2YTX A;  1VLA A;  5IYB H;  1WYD A;  3CC7 1;  2JIO A;  4XX2 A;  4R1J A;  1X3Z A;  3J7A F;  3DWA A;  1YHA A;  3NBI A;  4DNR B;  1Q8I A;  5IP9 I;  2B63 I;  4X62 L;  1P9N A;  4IOC A;  1BNZ A;  1X3G A;  1Q7Y 2;  4LF4 Q;  5C3E I;  4P74 A;  1YIT A;  2IPK D;  4H0L C;  1HNZ L;  2XN9 C;  1KTK A;  3GV3 A;  5I9O A;  3NQT A;  2R7Z B;  2KEC A;  4RV9 A;  4OO1 H;  2EY2 A;  4BY1 G;  4EQO A;  1SDF A;  2B39 A;  2WV6 D;  1NCV A;  1Q82 C;  1MSG A;  3I4O A;  3X3M A;  3KOJ A;  2P28 A;  4A3J B;  2R92 I;  1IYV A;  2KHS A;  1SYG A;  2RPR A;  3K0X A;  2AKL A;  4DAY A;  2DUD A;  3CF5 A;  2ZJR A;  5I2Y A;  3C1F A;  1CHP D;  4PZ8 A;  2A69 D;  1YNX A;  5ELB A;  1HQM C;  3L3O C;  2TMP A;  4A3F B;  4WJ4 A;  3M7G A;  3A5U A;  4JI7 L;  1VQ5 1;  1RJT A;  1PH2 A;  2DN8 A;  4A3L G;  2BA1 A;  4LF8 Q;  1SRU A;  4C3H H;  2RHQ B;  2MO0 A;  3PSI A;  1O78 A;  1TKW B;  2NYZ D;  3BZC A;  1YJN Z;  4NBH A;  4MD8 A;  1JOK A;  4KKS A;  1PH7 A;  4DV4 L;  2Z0S A;  4DR3 L;  4H13 C;  1I6H B;  3CMA Z;  4K5X A;  1M4V A;  2SNM A;  4U68 A;  4O1N A;  5EKL A;  5JAV A;  3GTO B;  1NR4 A;  2OTL 1;  4U67 3;  1VQG A;  2G5D A;  3TS2 A;  4LF6 Q;  2NAP A;  2VQE L;  1PHJ A;  1G29 1;  4JI5 L;  1Q90 A;  3IAY A;  3F2D A;  1K0S A;  3MON A;  4P2C B;  2F4O A;  4GS3 A;  4X66 Q;  1LT6 D;  3SK8 A;  3H09 A;  5IGG A;  1WI5 A;  1WVL A;  3OOC A;  2E2J H;  1RTO A;  3FPP A;  3G6E Z;  2JA7 B;  4A93 I;  4BXX H;  4DV7 L;  1A62 A;  3MFG A;  4FP5 D;  1JC7 A;  5EAY A;  1SE2 A;  2BH8 A;  3J81 f;  3A8I E;  1SN8 A;  2K3R A;  2E5L L;  1VQN Z;  2Y0S B;  4DU9 A;  1RDP D;  1RO0 A;  5M3F G;  3IFT A;  5FO8 B;  3J7A 5;  1PFN A;  3J81 L;  2F0W A;  2WB1 E;  4AYB B;  2D62 A;  4N8F A;  1G8Z D;  2JYO A;  2MQH A;  3VR5 A;  1D1K A;  4A3I B;  3SHL A;  5I2X A;  4RFB A;  4R4O A;  4GOP B;  3CC2 Z;  4NDX A;  2RBL A;  3RZD I;  2N88 A;  1K8A C;  4LF7 Q;  4A3M I;  3E3X A;  2B2V C;  2MGS A;  4DAV A;  3S15 I;  1K9M 1;  2CFM A;  5J39 A;  4A3D H;  2PK7 A;  1EFI D;  3C3L A;  3Q23 A;  1PTO B;  1EY4 A;  3HOX H;  3TP5 A;  3S1M B;  3KLW A;  1S72 1;  2A5H A;  1YNJ D;  3SK6 A;  4WOR A;  3S1R B;  3M3Y H;  3STB D;  4YCU A;  1X9N A;  1V1P A;  5T6B A;  1IW7 D;  2UUC Q;  1IYJ B;  4BWG B;  3CQZ I;  1NMF A;  3HOY B;  1J5E L;  4A3B G;  3R2I A;  1LTB D;  2OQK A;  4JI8 L;  3H0G G;  2OTJ Z;  2JA8 I;  1X3P A;  4DN4 M;  4NB8 A;  1NE3 A;  2F0K A;  4A3E B;  4JI3 L;  2VB2 X;  4MTN A;  1EY8 A;  5IGF A;  2VQF L;  3HRZ C;  4FF4 A;  1YIT 1;  3ND9 A;  4BY7 G;  3QG1 A;  1XMO Q;  4V0B A;  2Q8I B;  5T1I A;  4HR7 B;  1M90 2;  1Y8O B;  1VQ9 A;  3I55 A;  2NN6 H;  2EYO A;  2C9O A;  2LSS A;  2BH2 A;  4DR2 L;  4DK6 C;  2A19 A;  5DAU A;  4E2Z A;  3OIQ A;  1XPR A;  2UXC Q;  4N9P A;  5K36 G;  1D5X C;  1PFT A;  1AE3 A;  3K0Y A;  2AMC B;  4IZ8 A;  2OXP A;  4IPG A;  3A56 A;  3ESW A;  4CDD C;  1UWV A;  1HHV A;  1GHJ A;  1GUO A;  4YWM A;  4XXE A;  1XWE A;  2VUM G;  1L1O A;  3CCE A;  2K5Q A;  3S9W A;  1Q7Y 1;  1X3Q A;  3UE0 A;  2Z9H A;  4UP9 A;  2K04 A;  1QWY A;  5KND A;  4HJ5 A;  5GQO A;  4EX5 A;  1PV4 A;  1FNW A;  1MIU A;  1I50 B;  1IL2 A;  4ME3 A;  1M90 C;  4F88 A;  4HID A;  4FYD A;  3UE1 A;  2WAQ E;  1OXX K;  2J0T D;  1KAA A;  3ERS X;  2Z8L A;  3KJP A;  3A5Z B;  1HCZ A;  3D3R A;  3PUV A;  4RWS C;  2RDH A;  3ULJ A;  3K8A A;  2RQX A;  2VPZ A;  5A2Q f;  1STY A;  3I72 A;  2A74 C;  3M4O B;  3MXN A;  3HOZ I;  3HOU H;  2V45 A;  2NUC A;  2Q2H A;  3K7U C;  1KD1 2;  1VQH A;  2RSO A;  1K8G A;  2JXM B;  1Y1V G;  1K73 C;  4BBS B;  1S5B D;  5DEH A;  1LAB A;  1M8A A;  2JMO A;  1HZA A;  5A2Q L;  2RT9 A;  2LFU A;  1ONL A;  5IWA L;  2SDF A;  3EER A;  3S17 I;  3GTP B;  3J81 j;  1S3O A;  1Z7T A;  2JEB I;  1R9T B;  4K6D A;  4GKK L;  4GZY C;  1ROD A;  4HN7 A;  2O2L D;  4LNQ A;  3GTO H;  3EVQ A;  4JI2 L;  4NXN Q;  2WAQ A;  3W5O A;  1E0B A;  5C4J H;  4NOZ A;  2B63 B;  1DYQ A;  4EQP A;  2FMC A;  4N9T A;  1PDQ A;  3K59 A;  4UPA A;  2E2H B;  3S24 A;  2JIQ A;  1KD1 C;  1IBL Q;  1WCM H;  1TY2 A;  2V8J A;  2JA7 H;  2A6H D;  3K5L A;  2MPM A;  3T4A C;  3G48 A;  3BG0 B;  4P75 A;  5C44 G;  3GTG I;  1D5M C;  4ZQ3 A;  1SSO A;  4NBB A;  4IFD I;  3I8Z A;  1PLF A;  3RR5 A;  2DE6 A;  1N33 Q;  3KK7 A;  1C0A A;  1TWH I;  2B2W A;  3LWU A;  2RKS A;  1RL2 A;  3GTK H;  1ZKO A;  4BA2 I;  3CCQ 1;  1KRS A;  5T67 A;  1MBY A;  3EN2 A;  4DAY B;  3GTJ B;  1TWC I;  2QLV B;  1VQB A;  1SIW A;  1MKH A;  4OWT B;  3HOV H;  3PMF A;  3CC4 1;  2N8N A;  1H9S A;  4R8N A;  2KCT A;  4HGZ A;  2K7V A;  4PV1 C;  3S2H B;  4EQN A;  4HMJ A;  1OXV A;  1GJX A;  3S2D H;  2QA4 A;  5E3F A;  2L0C A;  3IFD A;  1JJ2 Y;  1CKN A;  2NB0 A;  1EU3 A;  1CZW A;  2VPX A;  2EE1 A;  3UDX A;  5EPL A;  4A3D I;  2A6E C;  1YI2 A;  1HNW L;  3UDF A;  1Y8N B;  4YHH L;  1YJ9 A;  3L7Z C;  2F3W A;  4QUF A;  1MI2 A;  2K6A A;  3HKZ G;  4RVD A;  3CP0 A;  1TVX A;  4UY8 C;  3M3Y I;  3NUC A;  2CQO A;  3GDE A;  3IRB A;  3K5M A;  1CKO A;  4LK1 C;  1B50 A;  4YWK A;  1SR3 A;  2PM9 A;  2IX1 A;  4DR7 Q;  3TDH B;  4JV5 L;  4P72 A;  4ZLT F;  3GP7 A;  3AFQ A;  1TII D;  2A68 C;  2CKZ B;  1HH2 P;  4B3S L;  2KCM A;  3OW2 Y;  3M4P A;  5DLQ E;  4A3C G;  4HSV A;  4NMZ A;  2JJQ A;  4K8J A;  2BE5 C;  2I5L X;  1KQS A;  4MRI A;  3I4M G;  4HMI A;  3VYR A;  1O7I A;  2TSS A;  2ALY B;  4MIU A;  4EQ5 A;  3DM1 A;  2O53 A;  3NH5 A;  4PNY A;  1ML8 A;  1V43 A;  2DE5 A;  4DR1 Q;  2UU9 Q;  2JA6 H;  2EQS A;  1VQ6 A;  1GUN A;  1I4P A;  5E1F A;  4BBR B;  4FF2 A;  3D6W A;  2IWH A;  4OWX B;  1JOR A;  2GTH A;  3PIP A;  4C3J B;  2V1C C;  2AQ2 B;  4NBG A;  1WTH A;  5ELF A;  1A0I A;  2NZO A;  1SRO A;  2R7Z I;  3GD7 A;  1R4P B;  2BDO A;  5C4X H;  3CCM A;  5BN5 A;  1ESF A;  1I50 H;  3VR6 A;  5HGQ A;  4DGL A;  3TME A;  3QR8 A;  4F7X A;  5C3W A;  4A3J I;  2PO4 A;  1BBW A;  3NBH A;  1JT8 A;  2F0E A;  3VMH A;  2F0P A;  4JI1 Q;  1TWF B;  4ZAI A;  4JI0 Q;  3RZO H;  3H3V H;  5LL6 X;  5CV4 A;  1N8R C;  1BVS A;  4HJA A;  3PO2 H;  2EY1 A;  3CCL 1;  4A3F I;  3S14 H;  3I3C A;  1IZ6 A;  1V1P B;  3ITP A;  1B3Q A;  5ELO A;  4KLK A;  3KLS A;  2QEJ C;  2F3V A;  1AH9 A;  1A3V A;  4K5W A;  1ZB8 A;  2HHH Q;  1B7Y B;  1VQL Z; 
#chains in the Genus database with same CATH homology
 2F0S A;  3W2D A;  2EYF A;  4IUU A;  1DOK A;  4CJ2 C;  3G71 Z;  1PZK D;  1EQT A;  1YJW Z;  1II3 A;  2K33 A;  3CXC Z;  1M1K 2;  1I6H I;  1JQY D;  1CI3 M;  3GTO I;  5CMD A;  2FJ2 A;  1YNN C;  1S5F D;  1X32 A;  3K5O A;  3JAM f;  2ENB A;  5C0X H;  5D14 A;  1BCP B;  1OXS C;  1EEI D;  3JAM L;  5IIF A;  2JA7 I;  3D31 A;  1JIC A;  2YYZ A;  2QA4 1;  4HH4 A;  2KCC A;  2Z4I A;  4IUR A;  5F2D A;  4XQN A;  1VQO 1;  1DCZ A;  1NR2 A;  1OXU A;  4XQQ A;  1EYA A;  4RA8 A;  2JEA I;  1GXD C;  1VQ8 1;  1STN A;  2F0G A;  4XT3 B;  1SYF A;  1SE4 A;  4C3H B;  4A3I I;  1B1Z A;  4RKL A;  1W2B Y;  3TP8 A;  2VNU D;  3MVV A;  2B2U C;  1HTP A;  4G7Z C;  1GOZ A;  2CW0 D;  1CK1 A;  4KHV A;  5JJZ A;  1TS3 A;  4M1U B;  3MXG A;  1EOT A;  3MXP A;  4IUN A;  3S1M I;  1HPC A;  2ZXP A;  1H9M A;  4HAE A;  4ZYS A;  4HED A;  1Q86 2;  3DEO A;  3S1R I;  1PTO C;  1WTW A;  2WAQ B;  1V1O A;  1JJ2 Z;  3HOY I;  2DNE A;  2PQE A;  1VQ6 1;  2E2J B;  2R6M A;  2F4M A;  3I56 1;  3HP3 A;  2GU2 A;  4HCS A;  2RSN A;  4KHZ A;  1QIL A;  4TQU S;  1UUP A;  3NTI A;  2M00 A;  1D1I A;  3LWE A;  1Q1B A;  3T51 B;  3IFU A;  2SNS A;  3LUS A;  2ICE C;  1UEA B;  2R3Z A;  2IW3 A;  1U4M A;  2F0L A;  3CME 1;  3PUY A;  2KPI A;  1I4Q A;  1H9S B;  3J81 b;  1I3Q B;  1Q12 A;  4FNF A;  1QG7 A;  1U4R A;  3H0G B;  1VDZ A;  4NH1 C;  3CCJ 1;  3H6M A;  5TSS A;  5M9O A;  1T5E A;  1ILP A;  2LIY A;  2B8F A;  3EFX D;  3HOX B;  5C4X I;  5IGC A;  1I50 I;  1RKN A;  2EYH A;  2EYL A;  1R4Q B;  3M3Y B;  4BY7 B;  4B08 A;  1SEB D;  1CA6 A;  2B8G A;  5EBC A;  2A73 B;  3M4O I;  3QB3 A;  5CYU A;  1E2W A;  4IUP A;  3QWU A;  3VA5 A;  5EQ0 A;  2IJ0 A;  4BS9 A;  1SJH D;  1Q82 2;  3GTP I;  1SMY D;  2A6E D;  3KUP A;  1R9T I;  4C3I G;  2JS4 A;  5IP7 I;  4RHR A;  4DNT B;  5FOB B;  1VQM 1;  4PQX A;  1VQ9 Z;  1TFI A;  3I55 Z;  2AQ3 B;  5IGD A;  2HUG A;  1DD2 A;  2FFK B;  4ODG A;  2K05 A;  2E2H I;  3K5N A;  4G7O C;  3ERO A;  3NK9 A;  2PNR C;  4O42 A;  3K57 A;  2A68 D;  1ENC A;  4RVH A;  1F9P A;  4RAU C;  2QKI C;  3ONA B;  3CCE Z;  5JVH 3;  1Z03 A;  2BE5 D;  1STA A;  4KJO A;  1G91 A;  1BO0 A;  2G9D A;  3QIA A;  1DL6 A;  3NDI A;  3IKJ A;  4C1N I;  3MZL B;  2QR1 B;  3MFY A;  4F87 A;  1TT2 A;  2BA0 A;  4KI0 A;  3UI2 A;  3I07 A;  3EED A;  3GTJ I;  2WIN B;  2ZXO A;  4EWC A;  3HOU B;  3F3P C;  3CHB D;  3MXU A;  2KJX A;  2D9U A;  3S2H I;  2EJF C;  1NSN S;  4NKL A;  3Q0A A;  1PMR A;  3URY A;  3VMI A;  4IUQ A;  3MTS A;  4DXG A;  1G6Z A;  2JNY A;  3MA2 B;  1B9M A;  2H4O A;  2D5D A;  5EPK A;  5C4J B;  4XIG S;  3TDQ A;  3J7A 4;  4ZKB B;  1RQF A;  3IL8 A;  1W2B Z;  2H1E A;  4DK0 A;  4RVF A;  1WCM B;  3NPP A;  1E2V A;  1K8A 2;  1SNP A;  3NE5 B;  3P7J A;  1LT3 D;  3KLR A;  4DF7 A;  1JOQ A;  1AZQ A;  2W03 A;  1KLG D;  2O5I C;  2E76 C;  1EWC A;  5ELD A;  3KBX A;  3VYS A;  3CU7 A;  1RO2 A;  4RVG A;  1PRT B;  2EJM A;  3GTK B;  3BVZ A;  1VQP 1;  1F2L A;  2K03 A;  1YNN D;  2EPB A;  3D4R A;  4PMW A;  2F0D A;  5M5Y B;  4PMB A;  3HOV B;  4S1T A;  2ICI A;  4BBR I;  3V96 A;  4NBC A;  2GA4 B;  3CCR 1;  2CHB D;  4KV6 A;  4KKT A;  4Q5V A;  5IGB A;  3S2D B;  5FLX f;  4EVO A;  2B2V A;  3Q87 A;  1O7L A;  5CV9 A;  3K58 A;  1KNE A;  3S1Q B;  4MD7 A;  3D4W A;  5FLX L;  2QA4 Z;  4WRD A;  3VA7 A;  4XT1 B;  2EYP A;  3BZD B;  4IFD G;  3BYT B;  5G3L D;  1YI2 Z;  3WDN A;  4UAI A;  3OW7 A;  1TWF I;  1YUA A;  1YJ9 Z;  1A6X A;  3A7L A;  3CCS 1;  3G6J B;  4JBW A;  4XQJ A;  3PIP 3;  1TQO A;  5T1G A;  2SEB D;  2MHV A;  5K36 H;  3J81 E;  1PZJ D;  2RDF A;  3SDZ A;  1XYI A;  4FF1 A;  1TU2 B;  1L0X B;  5ELC A;  4IFD J;  1AW7 A;  3DHQ A;  1BUV T;  1KLU D;  2F0O A;  3I4L A;  2VB3 X;  1IKL A;  4CKB A;  1KC8 2;  1XTC D;  3DEP A;  1Q82 1;  2AWN A;  2JA6 B;  1U4L A;  4ME5 A;  1PTO D;  1IL8 A;  2EDG A;  1BR9 A;  3CCU 1;  1LLR D;  1N2F A;  2E9H A;  4OL7 A;  1K73 2;  1GUT A;  4WFN 3;  1VQ6 Z;  2N55 A;  3VR3 A;  1JWM D;  2F0J A;  2NBF A;  1GHK A;  5D65 A;  1S7M A;  3CKI B;  4OO1 I;  5BN3 A;  5C4X B;  5C6A A;  4CJ1 B;  3WOE A;  1BCP C;  3CD6 1;  1NAP A;  1STE A;  2B2T A;  3CCM Z;  1EYD A;  3RZO B;  1A2T A;  1WTQ A;  5I6Y A;  4X6A I;  3CXC Y;  1STH A;  4UDU C;  1AEX A;  1SE3 A;  5EJW A;  3PO2 B;  1VMC A;  1B53 A;  3C1E A;  3S14 B;  1GUS A;  1HRJ A;  1SYE A;  1I4R A;  1ZXT A;  2JUB A;  4J8Q A;  1J8I A;  1VQ4 1;  2Z1C A;  3OHX C;  3NHH A;  1O7Z A;  2O4X A;  1I4X A;  4RS4 A;  2CQA A;  5C4Z A;  1DZ1 A;  4ULL A;  5JPM C;  3S1N B;  3F3F C;  3GO5 A;  4CGY B;  5CC4 A;  4Y7N B;  2D2C C;  1KAB A;  3I90 A;  3RLF A;  1Y1W B;  4HCE A;  2XNA C;  2J4X A;  3TZU A;  1ML0 D;  1SXT A;  2XRS D;  3HGB A;  2E2J I;  2K5R A;  3Q22 A;  3TBI B;  2JSO A;  2CVR A;  1VQ7 1;  2K01 A;  4BXX I;  5LL6 f;  1DM0 B;  2HCC A;  1K8A 1;  5A2Q E;  2LFN A;  4L8J A;  3WOF A;  5A35 A;  3CC7 Z;  3AMU A;  3JAM b;  4FVM A;  5COR A;  3NSW A;  2IX3 A;  3K7A B;  1RNI A;  3OMC A;  1ZH1 A;  3MC0 B;  3H91 A;  3VR2 A;  1W6J A;  2K5D A;  3OIP A;  3MWY W;  3E0J A;  4KY5 A;  5JEA G;  4E2W A;  4E2Y A;  1VQK 1;  1PYW D;  2J7Z A;  4B9W A;  1UNS A;  1MGS A;  2JA5 B;  5C5M A;  1I3Q I;  1B9N A;  3H0G I;  3HOX I;  3GTM S;  1YIJ 1;  3HEJ A;  3SK4 A;  1LO5 D;  4A3K B;  1T5X D;  3NWS A;  3SXH A;  4BY7 I;  2BDN A;  5JEA J;  2QEX 1;  3OWE B;  1LTS D;  1VQ5 Z;  1CQV A;  1Z02 A;  1SNO A;  2HU9 A;  3PO3 S;  1FR3 A;  1ICW A;  3TSS A;  3J7Y W;  4C1N K;  3GTM B;  1AN8 A;  3NDJ A;  3DWP A;  5JVG 3;  2R61 A;  3PUW A;  5IT9 f;  1SYB A;  2OOY B;  2VUM I;  2PYK A;  4RKB A;  3PUX A;  5C4H A;  2OTL Z;  3R93 A;  2NN6 I;  4E30 A;  1C4Q A;  5IT9 L;  4ABN A;  1U9R A;  5I6W A;  1M90 1;  1WTR A;  1N8R 2;  2PPB C;  3Q6S A;  2MP1 A;  1TWA B;  1FGB D;  2V8I A;  5M5W B;  3NXW A;  2AQ1 B;  4QB4 A;  5M3M B;  1HXY D;  3VB9 A;  1F2Z A;  1TS4 A;  3QWN A;  1K73 1;  3GV6 A;  3FKI B;  1BXT A;  1VF7 A;  5CBE E;  4OIK A;  2E2I B;  1H9R A;  2ZT9 C;  1EEF D;  3KIH A;  4ZUI A;  4NW2 A;  1EZ8 A;  1SFO B;  1VMP A;  1YJN 1;  3K6O A;  2PCF B;  2RVL A;  2IL8 A;  2X6L A;  3NTK A;  3HOU I;  2WKC A;  3BDL A;  4I65 A;  3CCV 1;  3CMA 1;  3EA6 A;  2EYM A;  3AB9 A;  1KD1 1;  5KEE A;  1AP0 A;  2F0V A;  2HCI A;  1S72 Z;  3CRL C;  4BY1 B;  1JWS D;  4ZRZ A;  5C44 I;  3GQB A;  4RGT A;  5J22 A;  2KED A;  5C4J I;  1LT5 D;  3G6E 1;  5EKI A;  2L5T A;  5NUC A;  1NUC A;  3DMU A;  5CGK A;  3HS0 C;  2GTI A;  1B44 D;  1WCM I;  3A55 A;  1PZI D;  5D1O A;  4NFR A;  4PMC A;  5M5X B;  3GTQ B;  2KCN A;  3J80 f;  3QOJ A;  1YIT Z;  1VQN 1;  2HQE A;  1K8O A;  5CV7 A;  3VYT A;  1HFN A;  2ZAE B;  1EQV A;  3KLS X;  4TKO B;  3X3N A;  3J80 L;  5CV8 A;  1ENF A;  3HKZ A;  3NH4 A;  2Q8T A;  5G3L F;  3A7A B;  1BQQ T;  4LAA A;  4RCN A;  3GTK I;  1H9J A;  4MD9 A;  3H3V J;  1TWG B;  2PW5 A;  3HOV I;  3CCU Z;  1EZ6 A;  1KDC A;  1PRT C;  2Y0S A;  1W6K A;  4CL1 A;  3P75 A;  3S2D I;  4CKE A;  4Z9C B;  1JB3 A;  2IT1 A;  1SAP A;  2YAD A;  1F9S A;  4X3S A;  4K2L A;  1ILQ A;  3S1Q I;  1QF8 A;  2B2Y C;  3SK5 A;  3JAM E;  1CZG A;  4RH6 A;  2WP8 J;  3FQQ A;  1VCI A;  3CPW Z;  2OTJ 1;  1FNU A;  5LHY 1;  1O7Y A;  2EJG C;  3OSO A;  2MUY A;  5K5P A;  1PTO F;  3BG1 B;  4NB9 A;  1SJE D;  4E31 A;  5M3F B;  2L4N A;  4K2K A;  2KVM A;  4QMG A;  1NUI A;  4NBE A;  1A3U A;  1WTO A;  2OEO A;  4FXG C;  1WTX A;  2JE6 I;  4OHJ A;  3RD4 A;  1I4G A;  2NVX I;  4XYO A;  1TS5 A;  5CR3 A;  3FPU B;  1U4P A;  3PUZ A;  1YHQ 1;  1SNC A;  2Q4Z A;  5FO9 B;  2NVQ I;  2K5W A;  3PV0 A;  4Y52 I;  2SOB A;  2XWB B;  1KRL A;  4B9X A;  1HA6 A;  3D4D A;  3VMG A;  2JA6 I;  1LAC A;  5J1Z A;  5BN4 A;  3D9X A;  3MEH A;  3T13 A;  2E74 C;  4ZUJ A;  4LMQ D;  4RGN A;  4IUT A;  2WII B;  1N8R 1;  4G7H C;  3G4S 1;  1CM9 A;  4A3B B;  1HA5 A;  2HF1 A;  5KYL A;  1GUG A;  1QE6 A;  5I4D A;  4DK1 A;  2AUJ D;  2F03 A;  1D6E C;  3I73 A;  1GUW A;  4RHS A;  3CCQ Z;  3RZO I;  4E33 A;  5FLX b;  1KDB A;  4E6I A;  3VTN A;  3CC4 Z;  3PO2 I;  2KEE A;  1KQS Y;  3S14 I;  2L12 A;  3H3V C;  2EY6 A;  1Q81 2;  2PMZ A;  4JK1 C;  1QJO A;  4I7Z C;  5I9P A;  1LQL A;  4C3J G;  2VUM B;  1QVG Z;  1QNU A;  3S1N I;  5ISR A;  1YIJ Z;  1Y1V S;  2Q8R E;  4Y7N I;  3BVM A;  3I91 A;  1C48 A;  2QEX Z;  1SBB B;  1Y1W I;  1M1K 1;  1STB A;  1B4O A;  3H94 A;  1EIG A;  5ELE A;  1JOO A;  3RUZ A;  5C0X I;  4DFA A;  4L63 B;  4X3U A;  3V05 A;  3QOL A;  4J6H A;  1Y1V B;  2I46 A;  1KNA A;  2K32 A;  1A15 A;  5DM6 3;  2F0I A;  1I4H A;  3FQM A;  4MN3 A;  2IZ3 A;  1ZEQ X;  2VXW A;  3K7A I;  1PFM A;  3N6R A;  1HQR D;  2NVY B;  3OMG A;  3QO2 A;  1YUK A;  4TRD A;  2JA5 I;  1F2M A;  2LKV A;  2O5J C;  5C44 B;  2AUK A;  5A2Q b;  1EY5 A;  4KN4 C;  3OPO A;  4OO1 G;  4QUC A;  1SNQ A;  1EY9 A;  2F0F A;  4KK7 A;  1DOL A;  4A3K I;  4TSS A;  2RBM A;  1HTL D;  1K83 B;  1ZYR C;  3GCF A;  3CCL Z;  1F2Y A;  1Q86 1;  5KNC A;  3P1H A;  4EGV A;  1WII A;  1IYU A;  1WD0 A;  3CCV Z;  4R9W A;  4DXF A;  2C5C A;  4KKU A;  3N52 A;  2F4I A;  1JWU D;  3GTM I;  3LX0 A;  1NP6 A;  4C3H G;  5D1O B;  4V19 0;  2F0N A;  4ID6 A;  2K28 A;  2NVT B;  4CJ0 B;  3HOW I;  3QJY A;  1I6V C;  4QTU A;  4FF3 A;  3SE0 A;  3M4Y A;  3HKZ B;  4MXU A;  3PO3 I;  4IFD H;  1Q3L A;  1TWA I;  1Z01 A;  2QRE B;  2FIN B;  2WKD A;  4DQY B;  3FRP B;  1A3T A;  2RHB A;  5FK9 C;  5D3D A;  5E4W C;  3ERQ A;  4XDX A;  3NWT A;  1G2S A;  2G9H D;  4KTA A;  3FKI I;  2VF1 A;  3Q24 A;  1VQO Z;  3C2P A;  2E2I I;  2O4H A;  5EKK A;  3I4M B;  1JE4 A;  3O13 A;  2YU9 B;  1SFO I;  2PZU A;  1VQ8 Z;  2JR6 A;  1VQL 1;  2ID0 A;  5DM7 3;  4A3G B;  3G71 1;  1PRT D;  1CHQ D;  1YJW 1;  2NWG A;  3U9S A;  1RHP A;  2NVX B;  2F0Q A;  2LY7 A;  2EXZ A;  2XWJ B;  1UAP A;  2NVQ B;  4CKC A;  3S16 B;  3AU7 A;  5AFW A;  1Q81 1;  4G4K A;  2WB1 A;  4BY1 I;  1EWH A;  1WW9 A;  1KQS Z;  2I3C A;  1EL0 A;  4E2X A;  1TS2 A;  5FLX E;  2F0T A;  2NTS A;  1RLY A;  1CQF A;  4LJZ C;  3PIO 3;  3KF8 A;  2PW7 A;  2WAC A;  1C8C A;  3NH8 A;  4QIW B;  3OWF A;  2X69 A;  3T4N B;  5IT9 b;  3I56 Z;  1DJR D;  3IF8 A;  4A3L I;  2EGT A;  4RGM A;  5EBD A;  1QVF Y;  3GTQ I;  1HFG A;  4FXD A;  1YHQ Z;  2QRD B;  2I07 B;  2DY7 A;  1BCP F;  3KIF A;  1FYC A;  4NBF A;  4BA1 I;  1A2U A;  2R93 B;  2L1B A;  4DA2 A;  1F9R A;  5EGT A;  3SVM A;  3I4N B;  1L1O C;  1HUM A;  4C2M B;  1Y69 U;  2CW0 C;  2OOX B;  2BOS A;  2NN6 G;  1TWG I;  2V4D A;  2V8K A;  3CME Z;  3G4S Z;  5JOB A;  1H9K A;  5C3X A;  2XRQ D;  2NZ1 D;  2B2T C;  1CA5 A;  3CCJ Z;  3U50 C;  3D8G A;  3NP8 A;  4HGY A;  1XX8 A;  2PMZ B;  3RMH A;  3P5J B;  3M7N A;  1EIH A;  4FXK C;  3BYY B;  1Q1E A;  1ET9 A;  2OZK A;  2KUM A;  3U9O A;  1NJI 2;  2L55 A;  1ZB9 A;  4FO2 A;  2ZXR A;  2KOL A;  1FNV A;  1USP A;  3SR1 A;  3MZ5 A;  2IZ4 A;  1QYP A;  4F8M A;  1MD2 D;  1F9Q A;  1KDA A;  5JEA H;  3DUZ A;  4CBV A;  4C56 C;  1LV9 A;  4MON A;  2G2K A;  5CV6 A;  3E5S A;  5C3E B;  1PXU A;  2R6G A;  4R8I A;  1VQM Z;  1RD9 D;  3ND8 A;  5KRU A;  4G57 A;  2LMC B;  5CV5 A;  3CPW Y;  3J80 b;  2R92 B;  4Q0F A;  5COY A;  1FD7 D;  2QKD A;  1ESR A;  3LNN A;  4YIJ A;  4A3B I;  2B2W C;  2H85 A;  1HUN A;  1LTR D;  4K5V A;  4KD3 A;  2FMM A;  4KY7 A;  1E2Z A;  1X0T A;  1EYC A;  1SNM A;  2L9H A;  2KA7 A;  4QCL A;  3G7L A;  1D2B A;  1SMY C;  1PTO H;  1WD1 A;  4OIJ A;  2HDL A;  4KD4 A;  3SEB A;  3TE5 B;  3L9A X;  2M2L A;  1VQ9 1;  4WJW A;  1BBX C;  2QIL A;  3I55 1;  2DNC A;  4HSP A;  3GTL I;  3HOW B;  2M6N A;  4H44 C;  3FVQ A;  4KMU C;  4A93 B;  2F0M A;  4HTH A;  3PO3 B;  1ZYR D;  1KC8 1;  4K14 A;  1WTV A;  3BDC A;  3EQL C;  3HZX A;  4QF4 A;  4CHT B;  1S4Z A;  3CCE 1;  5EPJ A;  2IX0 A;  1SYC A;  5CBA E;  4XTC S;  1EY0 A;  3W3A A;  5FO7 B;  3R2T A;  3TZD A;  2A69 C;  4IAL A;  2L11 A;  4K6L A;  1Y1V I;  2QCP X;  1AFP A;  1X3W A;  3MZK B;  3I70 A;  3J7A V;  2EY5 A;  3NFZ A;  1B3A A;  3RZD B;  1LTI D;  1VQP Z;  1QVG Y;  4J1M A;  3T56 B;  5IOD A;  4A3M B;  3S15 B;  4RCO A;  4C3I B;  1LTT D;  1MSH A;  4X3K A;  1G2T A;  1DON A;  2XIW A;  3E6Z X;  3CCR Z;  5IT9 E;  1QVF Z;  3HG9 A;  3KBG A;  1IHZ A;  1F77 A;  4L6T B;  1TR5 A;  1WTP A;  2NVY I;  2RDG A;  2EOT A;  5C5L A;  1RF2 D;  4X3T A;  4NBD A;  2RIQ A;  5KGU A;  3CQZ B;  3TP6 A;  4ILW A;  4M8A A;  1QB5 D;  5KNB A;  3C46 A;  1B2T A;  1RO4 A;  2JA8 B;  1BF4 A;  1SYD A;  2Z4H A;  2AWO A;  3A8J E;  2WB1 B;  1K83 I;  3CCS Z;  1QOH A;  4DGZ A;  3BVG A;  4QTT A;  1AZP A;  3FEW X;  1JR0 D;  1DXM A;  4NP5 A;  5T64 A;  1NJI 1;  4IUV A;  2QF7 A;  1CT1 D;  5HGT A;  3FDT A;  2M48 A;  1BOS A;  1LTG D;  3DWQ A;  3TN2 A;  3NTH A;  1OXT A;  2NVT I;  2F0H A;  5IOC A;  2LS0 1;  3CC2 1;  1PFB A;  3M85 A;  1SND A;  1K8M A;  5HUR A;  2Q51 A;  5FKA C;  5CM2 M;  1PRT F;  1YNJ C;  2B2U A;  2E2D C;  2E75 C;  4AYB A;  1YI2 1;  1S5D D;  1IW7 C;  4IQZ A;  4KN7 C;  4K8I A;  1TY0 A;  5C0X G;  4MHE A;  1YJ9 1;  2KI7 B;  3CD6 Z;  1JCK B;  1BCP D;  3F2U A;  3HOZ B;  1Z47 A;  2B2Y A;  1Z6H A;  3T16 A;  3NQI A;  4DAP A;  1VF5 C;  2EVB A;  2RA4 A;  4RGO S;  3V2T A;  4A3C I;  4S3S A;  3P20 A;  4ZK9 B;  3CRK C;  4KY6 A;  3I4M I;  1ENA A;  3S17 B;  3J80 E;  2YU9 I;  1EU4 A;  2QRC B;  5DNF A;  2F0U A;  2EZV A;  1VQ4 Z;  2OF1 A;  5C0X J;  4A3G I;  2BJO A;  1V8Q A;  3EJI A;  1S5C D;  2DY8 A;  1ET6 A;  2W04 A;  1USP B;  1EY7 A;  5IGE A;  5D3I B;  2PZW A;  1S5E D;  2X6G A;  2NTT A;  2EYJ A;  4XYQ A;  3S16 I;  1OO9 B;  1RTN A;  1JWH C;  1LT4 D;  2F1M A;  5AN9 F;  3A8K E;  1STG A;  5KYI A;  2K1B A;  1QNK A;  1XXG A;  4A3E I;  2XVS A;  3A54 A;  3GTG B;  3GKQ A;  2FHT A;  3MAQ A;  4MH4 A;  1EY6 A;  1TWH B;  3TP7 A;  3R3O A;  3BS1 A;  1VQ7 Z;  3CCM 1;  1TWC B;  2OT2 A;  1CTM A;  3IX0 A;  3R8B A;  1DOM A;  1BDO A;  2P3Y A;  3DXJ C;  1K9M 2;  1O80 A;  2R93 I;  3OW2 Z;  2VUG A;  2KQ3 A;  2JP1 A;  3I4N I;  5D1P A;  1CFM A;  5KIX A;  4A3D B;  3ZYY X;  3BDO A;  2XSC A;  3BG3 A;  2DE7 A;  1VQK Z;  4IN3 A;  2MJ8 A;  4OGQ C;  4NBA A;  4H7B A;  3VR4 A;  3D6C A;  1Y8P B;  3GTL B;  2PZT A;  1D5Z C;  2BCO A;  2HDM A;  3VYU A;  1J9O A;  4E32 A;  3MHB A;  3T53 B;  2M9V A;  5LL6 S;  1LTA D;  2J6A A;  4TNU A;  5FLM I;  2A6H C;  4BBS I;  3FMC A;  4KJN A;  5E4X A;  1IKM A;  1RCV D;  5JPN C;  4ZKC B;  1QCB D;  2QDB A;  1L0Y B;  1VLA A;  3CC7 1;  4XX2 A;  1X3Z A;  3J7A F;  3DWA A;  3NBI A;  4DNR B;  1Q8I A;  5IP9 I;  2B63 I;  1P9N A;  1BNZ A;  1Q7Y 2;  5C3E I;  2IPK D;  4H0L C;  2XN9 C;  1KTK A;  3GV3 A;  5I9O A;  3NQT A;  2R7Z B;  2KEC A;  4RV9 A;  4OO1 H;  2EY2 A;  4EQO A;  1SDF A;  2B39 A;  2WV6 D;  1NCV A;  1MSG A;  3X3M A;  2P28 A;  4A3J B;  2R92 I;  1IYV A;  2KHS A;  1SYG A;  2RPR A;  2AKL A;  4DAY A;  5I2Y A;  3C1F A;  1CHP D;  2A69 D;  5ELB A;  1HQM C;  3L3O C;  2TMP A;  4A3F B;  3M7G A;  1VQ5 1;  1RJT A;  2DN8 A;  2BA1 A;  1O78 A;  1TKW B;  2NYZ D;  1YJN Z;  4NBH A;  4MD8 A;  1JOK A;  4KKS A;  4H13 C;  1I6H B;  3CMA Z;  4K5X A;  1M4V A;  2SNM A;  4U68 A;  4O1N A;  5EKL A;  5JAV A;  3GTO B;  1NR4 A;  2OTL 1;  4U67 3;  1G29 1;  1Q90 A;  3IAY A;  3MON A;  4P2C B;  2F4O A;  1LT6 D;  3SK8 A;  3H09 A;  5IGG A;  1WVL A;  3OOC A;  1RTO A;  3FPP A;  3G6E Z;  2JA7 B;  4A93 I;  3MFG A;  4FP5 D;  1JC7 A;  1SE2 A;  3J81 f;  3A8I E;  2K3R A;  1VQN Z;  2Y0S B;  4DU9 A;  1RDP D;  1RO0 A;  3IFT A;  5FO8 B;  1PFN A;  3J81 L;  2F0W A;  4AYB B;  2D62 A;  1G8Z D;  2JYO A;  3VR5 A;  1D1K A;  4A3I B;  3SHL A;  5I2X A;  4RFB A;  3CC2 Z;  4NDX A;  2RBL A;  3RZD I;  2N88 A;  4A3M I;  2B2V C;  2MGS A;  4DAV A;  3S15 I;  1K9M 1;  5J39 A;  2PK7 A;  1EFI D;  3C3L A;  3Q23 A;  1PTO B;  1EY4 A;  3TP5 A;  3S1M B;  1S72 1;  2A5H A;  1YNJ D;  3SK6 A;  4WOR A;  3S1R B;  1V1P A;  5T6B A;  1IW7 D;  4BWG B;  3CQZ I;  3HOY B;  3R2I A;  1LTB D;  2OTJ Z;  2JA8 I;  1X3P A;  4DN4 M;  4NB8 A;  2F0K A;  4A3E B;  2VB2 X;  1EY8 A;  5IGF A;  3HRZ C;  4FF4 A;  1YIT 1;  3ND9 A;  3QG1 A;  4V0B A;  2Q8I B;  5T1I A;  4HR7 B;  1M90 2;  1Y8O B;  2NN6 H;  2EYO A;  2C9O A;  5DAU A;  4E2Z A;  3OIQ A;  4N9P A;  5K36 G;  1D5X C;  1PFT A;  3K0Y A;  4IZ8 A;  2OXP A;  3A56 A;  3ESW A;  1HHV A;  1GHJ A;  1GUO A;  4XXE A;  1XWE A;  2K5Q A;  3S9W A;  1Q7Y 1;  1X3Q A;  2K04 A;  1QWY A;  5KND A;  1FNW A;  1I50 B;  4F88 A;  4FYD A;  1OXX K;  2J0T D;  1KAA A;  2Z8L A;  1HCZ A;  3D3R A;  3PUV A;  4RWS C;  2RDH A;  2RQX A;  5A2Q f;  1STY A;  3I72 A;  2A74 C;  3M4O B;  3MXN A;  3HOZ I;  2NUC A;  1KD1 2;  2RSO A;  2JXM B;  4BBS B;  1S5B D;  5DEH A;  1LAB A;  1M8A A;  2JMO A;  5A2Q L;  2RT9 A;  2LFU A;  1ONL A;  2SDF A;  3EER A;  3S17 I;  3GTP B;  1Z7T A;  2JEB I;  1R9T B;  4K6D A;  4GZY C;  1ROD A;  4HN7 A;  2O2L D;  3EVQ A;  2WAQ A;  1E0B A;  4NOZ A;  2B63 B;  1DYQ A;  4EQP A;  2FMC A;  4N9T A;  1PDQ A;  3K59 A;  2E2H B;  1TY2 A;  2V8J A;  2A6H D;  3K5L A;  2MPM A;  3T4A C;  3BG0 B;  3GTG I;  1D5M C;  4ZQ3 A;  1SSO A;  4NBB A;  4IFD I;  3I8Z A;  1PLF A;  2DE6 A;  3KK7 A;  1TWH I;  2B2W A;  3LWU A;  2RKS A;  1ZKO A;  4BA2 I;  3CCQ 1;  1MBY A;  5T67 A;  3GTJ B;  1TWC I;  2QLV B;  3PMF A;  3CC4 1;  4R8N A;  1H9S A;  4HGZ A;  2K7V A;  4PV1 C;  3S2H B;  4EQN A;  4HMJ A;  1OXV A;  1GJX A;  5E3F A;  2L0C A;  3IFD A;  1JJ2 Y;  2NB0 A;  1EU3 A;  1CZW A;  2EE1 A;  5EPL A;  4A3D I;  2A6E C;  1Y8N B;  3L7Z C;  2F3W A;  4QUF A;  1MI2 A;  2K6A A;  4RVD A;  1TVX A;  3M3Y I;  3NUC A;  3K5M A;  4LK1 C;  1B50 A;  2PM9 A;  2IX1 A;  3TDH B;  4ZLT F;  3GP7 A;  1TII D;  2A68 C;  3OW2 Y;  4HSV A;  4NMZ A;  4K8J A;  2BE5 C;  4MRI A;  4HMI A;  3VYR A;  2TSS A;  4MIU A;  3DM1 A;  2O53 A;  3NH5 A;  4PNY A;  1ML8 A;  1V43 A;  2DE5 A;  1GUN A;  1I4P A;  5E1F A;  4BBR B;  4FF2 A;  3D6W A;  2IWH A;  1JOR A;  2GTH A;  4C3J B;  2AQ2 B;  4NBG A;  5ELF A;  2R7Z I;  3GD7 A;  1R4P B;  2BDO A;  5BN5 A;  1ESF A;  3VR6 A;  4DGL A;  3TME A;  5C3W A;  4F7X A;  4A3J I;  2PO4 A;  3NBH A;  2F0E A;  3VMH A;  2F0P A;  1TWF B;  4ZAI A;  5LL6 X;  5CV4 A;  2EY1 A;  3CCL 1;  4A3F I;  3I3C A;  1V1P B;  3ITP A;  3KLS A;  2QEJ C;  2F3V A;  1A3V A;  4K5W A;  1ZB8 A;  1VQL Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...