3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Dna binding protein
molecule keywords Methyl-accepting/DNA response regulator
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
5EJWA 2BJOA 1AZPA 2HCIA 3G7LA 5IP7I 1BO0A 3ESWA 4A3KI 2F4MA 3GTMI 3S17I 4A3LI 4NBGA 2B2YA 2B2WA 1X3QA 1HFGA 1QE6A 1G2SA 1TWHI 2J7ZA 4ZK9B 4X3UA 4HEDA 2JP1A 1CA6A 5CBAE 2K5RA 2DE6A 2HCCA 1WTOA 1X3WA 3FKII 1MI2A 2NVTI 1ILQA 1Y1VS 2MGSA 2JA8I 3FDTA 2JR6A 5EPKA 1WTPA 3MWYW 3PO3S 2HF1A 2N55A 1AZQA 1WTRA 1NR4A 2K04A 1F9QA 3GTJI 1E0BA 4R8IA 4NOZA 4IUPA 2HDMA 1WTQA 4A3CI 5JJZA 4MN3A 1F9PA 2NVYI 1DL6A 4A3FI 1B2TA 3Q6SA 3VMHA 3HP3A 3GV6A 3GTLI 1XX8A 3EERA 5AFWA 2VUMI 1B4OA 1ILPA 2BDNA 4CJ2C 1RODA 3S15I 2NYZD 2K01A 1CM9A 4BY7I 5T1IA 4NW2A 4NBHA 3HOUI 3KUPA 4NBFA 1HHVA 4HAEA 3N52A 2EOTA 2YU9I 5C4XI 1PLFA 4NBAA 4Y7NI 1J8IA 1WTVA 1IKLA 4A3DI 1LQLA 2DY8A 1EQTA 2FJ2A 1RJTA 4XT3B 3GV3A 1ML8A 1U4PA 5T1GA 4HSVA 4ZKBB 3H0GI 3S1RI 2HUGA 2L9HA 2L1BA 1NCVA 4XX2A 1X3PA 2EPBA 4DN4M 2X6GA 2Q8TA 1KNAA 1TWAI 4NBEA 3HOWI 2J6AA 2MJ8A 3I91A 5C3EI 1TWGI 2NVXI 1B3AA 3MTSA 1ZB9A 3PO3I 4OIJA 1X32A 2E2HI 4UAIA 5CM2M 4IUQA 4BBSI 3TN2A 2B2VC 1HUMA 3S1NI 1SAPA 4BY1I 4BBRI 3LUSA 4U68A 3SVMA 1A15A 1USPB 2JYOA 1PFMA 2L4NA 2DY7A 1O7ZA 2MP1A 3LWEA 3IFDA 1DZ1A 2B2WC 2B2YC 4QTUA 3GKQA 1K83I 1VLAA 3FPUB 5E4WC 1DOLA 5EPJA 3DEOA 2RBLA 5EPLA 2VXWA 4X3KA 1RTNA 2KUMA 3H3VJ 2R93I 2E2JI 4RAUC 1G2TA 4IUTA 1U4MA 1RLYA 4A3EI 2N88A 2K03A 1Y1WI 2EE1A 1PFNA 4NBBA 3S1MI 1MGSA 1HUNA 3HOXI 4XT1B 2NWGA 2K05A 4ZAIA 2KEDA 3KBXA 2RSNA 3S16I 3GCFA 1HRJA 2PK7A 4X3TA 1DOMA 1C8CA 2KPIA 4RA8A 4XDXA 2B2UA 2FHTA 5DNFA 2NZ1D 3GTQI 2FINB 3RZOI 2JA5I 1JE4A 1HA6A 2K28A 2XIWA 1DOKA 3F2UA 1SSOA 3D6WA 1IL8A 5C44I 1WTXA 4CJ0B 1I3QI 1L1OC 1JICA 4X3SA 2RA4A 1PDQA 5E4XA 3S14I 5IP9I 1KNEA 3VMIA 3DEPA 4IURA 3Q87A 5CBEE 2E2II 1CA5A 1S4ZA 2SDFA 1SDFA 2B2UC 2FFKB 1U4RA 1F2LA 4MHEA 4NB8A 3K7AI 1B53A 4X6AI 3GTMS 4LMQD 4Y52I 4BXXI 1QNKA 1ZXTA 4QUCA 1PFBA 1Q3LA 1O7YA 4R9WA 2D9UA 3GTOI 3I07A 1U4LA 2IL8A 1YUAA 3M3YI 1F9RA 4CJ1B 3TZDA 4IUVA 1BF4A 4NBDA 1TWCI 2B2TC 3HOVI 2H1EA 1MSHA 2CVRA 2JS4A 2KOLA 5EKIA 3IL8A 1BNZA 3RZDI 1VMCA 2R3ZA 2F4OA 1HFNA 1WVLA 1RO4A 3VB9A 3I4NI 3ONAB 4A3II 3U50C 1G6ZA 1AP0A 3R93A 2KEEA 1I6HI 1ESRA 4QTTA 1TWFI 1EL0A 1EOTA 1M8AA 4NBCA 2L12A 1NAPA 5CORA 2K1BA 4A3JI 3VMGA 1G91A 3M4OI 1QYPA 4NB9A 1RHPA 3UI2A 2DE7A 1GUWA 5D65A 2NVQI 4RWSC 5D14A 1F9SA 4A3MI 1EIHA 1ZB8A 4ZLTF 3I90A 3HOZI 3I8ZA 4IUUA 1USPA 1QG7A 2DE5A 1TVXA 1WD0A 5FLMI 2X6LA 2RVLA 4MH4A 3GTKI 3P7JA 3S2HI 2M2LA 2FMMA 1PFTA 1Y1VI 3S2DI 1VMPA 5CMDA 2JNYA 2P3YA 3PO2I 2RSOA 3CQZI 2JA6I 4QUFA 1LV9A 3GTPI 4HCSA 1ML0D 1BBXC 1NUIA 4A3BI 1ICWA 1WCMI 3QO2A 1MSGA 3HOYI 2R7ZI 2KECA 1TFIA 2JA7I 1DONA 2KVMA 1IKMA 3GTGI 3I4MI 1WD1A 5COYA 3H91A 4A93I 2R92I 3I3CA 2B2VA 2X69A 2B63I 3S1QI 1B50A 1SFOI 1XYIA 2Q8RE 2L11A 5EQ0A 1WTWA 1O80A 1EIGA 1NR2A 4OIKA 1I50I 2AKLA 1N2FA 2HDLA 1WW9A 2MPMA 4ZKCB 4A3GI 3DM1A 1RTOA 1X3ZA 5C4JI 2B2TA 4O42A 1R9TI 1J9OA
chains in the Genus database with same CATH superfamily
4YHHQ 3RUZA 2A74C 1PYBA 3S1RH 1AZPA 2QCPX 3J80c 1BO0A 1K83B 3ESWA 5FLXb 3H0GB 5J22A 4DV5L 4A3KI 2F4MA 2JIQA 3S17I 1ENAA 4NBGA 1PH6A 5LMNL 1OXTA 2AWNA 4JW0A 4A3FG 1JC7A 4KKSA 3PO3H 2DNCA 1TWHI 2B63H 2J7ZA 4WJ4A 4HEDA 1UAPA 3SK4A 2BH2A 4ZUIA 3D2LA 2CHBD 2E2JH 1CQFA 2E2IH 3KLRA 1VQKZ 5IGEA 1M4VA 1EQVA 4DV3Q 2OOYB 4HR7B 3I561 2DNEA 3HOUB 2ZXOA 1R9TH 1Q862 1ASYA 2A19A 2YTVA 3D4RA 4P73A 3CPWZ 1BR9A 3CPWA 5K36G 1LABA 5D3DA 2BA1A 1DGSA 4KD4A 4XYOA 2HIVA 2F0NA 1EYCA 1L1OB 1JMCA 2E2HB 2ZXPA 3PO3B 4B3SL 1CHPD 1ZYRC 1NY4A 3T1YL 1QILA 1PH9A 2B63B 1VS0A 5M5XB 2E74C 4YY3L 3A7AB 1QVGY 1F9QA 2JA8G 2K14A 4IJHA 4UP8A 1TWAH 5DM73 1E0BA 5A2Qf 4R8IA 2YADA 3PIO3 1TWCH 1IL2A 1A2TA 1VQK1 3KK7A 3EROA 2L15A 5KNCA 4B3TL 4QIWE 4IFDH 1YJW1 2IT1A 2LIYA 4JI4Q 2EJMA 2K33A 2EJFC 5JOBA 3BVGA 4X6AH 1S3OA 4DR1Q 2AUJD 4LF4Q 4PMBA 5I2XA 3GV6A 3GTLI 1S721 1LTBD 3S17H 3S1MH 1B4OA 2IHFA 1RODA 3TBIB 2B63G 3CP0A 5F2DA 4OONA 4FF4A 3I72A 4A3EG 2ZAEB 2K01A 1RQFA 1H9MA 1L0YB 1TWCB 2MO0A 4BY1G 1CHQD 4NBFA 3HOZG 2B39A 1BVSA 1QOHA 1TS4A 5C4XI 1G291 3G6EZ 3ERSX 2JQOA 2LFUA 1VDZA 1VQM1 5AJ3Q 1HZBA 1PTOD 1LQLA 1UWVA 2FJ2A 4G4KA 1RJTA 3GTMH 1FGBD 3RN5A 1DXMA 1U4PA 3FMCA 1K8OA 3S17B 4HSVA 4ZKBB 4BA2I 3CXCA 1Z47A 2WIIB 3NE5B 3CCVZ 2L1BA 1NCVA 3CCJA 4G7OC 1LTGD 1X3PA 2I3CA 4KY7A 3J80E 3H15A 1C0AA 2Q8TA 1KNAA 3VA7A 4OWTB 1Y69U 3AQQA 4DR7L 1YEZA 2QA4A 1JWHC 2AWOA 3A7LA 3NBHA 3J80i 1IW7D 4DXGA 3DHQA 4H02A 3MXGA 2LFNA 3A0JA 3M4QA 4OIJA 2E2HI 2A69D 1HTLD 3T4NB 4GOPB 1STGA 3T4AC 4LK1C 2AQ3B 5CC4A 5K5PA 4BBSI 3WDNA 4A3EH 1KRLA 3S1NI 3P5JB 2JIRA 3GTGB 5C0XH 1V9PA 3RZOH 5E1FA 3J81c 1WJJA 2QRCB 1XTDA 2JYOA 4BBRG 4UP7A 1GUTA 2R7ZB 1PFMA 2RKSA 3O13A 3JAMf 1PXUA 1WCMB 1XNRL 1GKHA 1TWHB 5D1PA 4QQBX 2M00A 1NUCA 3BDCA 5NUCA 1RL2A 1VF5C 3VR4A 3BG1B 1V8QA 5KYIA 1VQP1 3IFDA 2K3RA 3J7YW 2A1AA 4QTUA 4IJLA 3GKQA 1DOLA 2QEJC 3DEOA 2RBLA 3GTGH 5DAUA 5EPLA 4G7ZC 1PZID 4DV2L 2R93B 5JAVA 1SE3A 1RTNA 2AHOB 3C1FA 3H3VJ 2R93I 4RAUC 1QVFA 3ULJA 5C5LA 1NJI2 1X56A 1RLYA 1GJXA 4JOIC 3QOLA 2LEXA 4IFDJ 2VQFQ 3UDGA 1YJNZ 3T1HL 4E31A 3CCSZ 4UDUC 5HY6A 1KQSA 2K05A 5FOBB 5AN9F 2RSNA 2QDLA 3GCFA 2RBMA 2A8VA 3W2DA 2VQEL 1YNJD 2CH4A 4X3TA 2Y0SG 1ET6A 4CDFC 1UE5A 1Y8OB 1UE7A 4A76A 3G48A 2WAQB 3NQTA 2LXJA 2B8GA 1JE4A 2XIWA 1YUKA 1VQL1 1UUPA 3CCS1 1SYCA 5IYBH 1YJWA 3HOXH 3PCOB 1JWUD 1S40A 3T56B 1JICA 3JC66 2RA4A 3A74A 1BDOA 3Q0AA 1X3FA 1DJRD 2RDGA 5IP9I 1O7LA 3EVQA 2NVXH 4YWKA 4DV7L 3CMAZ 3VMIA 4BY1H 2NB0A 4XQQA 1VQO1 3DEPA 3Q87A 3M4OH 5CBEE 3NUCA 3RLOA 2ICEC 4EQOA 3RNUA 1SDFA 5M5YB 4G57A 2FFKB 1ASZA 3WOFA 5C4ZA 3PF5A 1F2LA 1AN8A 3BU2A 5CV9A 4A3MB 1K9MC 2IWHA 1NJI1 1HCZA 3L7ZC 3K7AI 1B53A 1YNXA 4LMQD 1KD12 4Y52I 4BXXI 3I4OA 1D1KA 3OW2Z 1PFBA 4O0AA 3Q23A 2V8KA 3HS0C 1ZEQX 1TT2A 1ONLA 4J8QA 4KHPQ 3M3YI 1M902 1F9RA 1KHIA 3OWFA 3S2HH 1I4QA 1TWCI 4I7ZC 4FF3A 3CC7A 4E2YA 2F3VA 2N8NA 3NH8A 1UEBA 3NH4A 1JWSD 3MXUA 4CGYB 4BBSB 2A73B 5C3XA 4B3MQ 2H1EA 3S14B 5GAGC 1CTMA 5D1OB 4DXFA 4G7HC 1PYWD 2ASBA 3RZDB 5BN5A 3KF8A 1Q8KA 2A68D 4E2ZA 2KBNA 3DMUA 3KF6A 3X3NA 3I4NI 4FXGC 1STYA 2EXDA 2K5NA 2NVTH 1A63A 1VQ5Z 5J39A 5M5WB 3GTQB 5IGFA 1VQNZ 4JI7L 5CYUA 3BVZA 2E5LL 1KAWA 1YNND 5H1SE 2ENBA 1NAPA 1M90C 3MXPA 3AB9A 3TP8A 3M3YB 3M4OI 3KF8B 1E2VA 1X9NA 1WI5A 3F3PC 2AKWB 4A3GH 4NB9A 5GQOA 1PV4A 4JK1C 1EY6A 4K5WA 3S16B 2DE7A 4A3FH 3UDXA 4M1UB 4LJZC 1I4RA 5LMNW 4JBWA 3GO5A 2WAQE 1RF2D 3KOJA 1PA6A 4QIWB 1PTOB 2ALYB 2WB1A 2KQ3A 1VQPA 3F2DA 2BH8A 4L5TA 3JAMi 3G4S1 1SMYC 1F2MA 1OXVA 4XIGS 1C7YA 1EIHA 1O78A 4ZLTF 3VTNA 4EVOA 3I551 4UHVA 1L0XB 4WJ3M 3HFZB 3MONA 4C3JG 5FLMI 1SNMA 3BVMA 3M3YH 2RVLA 4E30A 3GP7A 1STEA 1LACA 3GTKI 1TKWB 2E75C 3P7JA 2OCEA 2I5HA 3NH5A 3H0GH 4FO2A 1PFTA 3TDHB 3NQIA 1U9RA 3DLLA 2CW0D 3S16H 3NXWA 2JNYA 4ABNA 2P3YA 2Z1CA 4K2KA 2RSOA 4P72A 3CMEZ 5M3FB 2IZ4A 4A3KG 5J1ZA 3SE0A 3D0FA 2JA8H 2JA6G 2NUCA 3LWUA 4FF2A 3QWNA 5FLXL 3Q24A 1NUIA 4MTKA 3QIAA 4DPGA 4ALPA 4FP5D 3BYTB 4E2XA 2RDHA 3G4SZ 2F0PA 1PFSA 4NMZA 2JA7I 4IOCA 1R9TB 2GU2A 3KYHC 5BR8Q 1MIUA 3CCUZ 3NELA 4C3JB 4B3RQ 1PH3A 1SXTA 1Z6HA 2Z9HA 1IBKL 3I4MI 2KCMA 5KIXA 4DV6Q 3A8IE 4JCVE 1GUGA 1K9M2 3H3VH 3U4VA 4GZYC 4MXUA 1QZGA 1BQQT 4LF5Q 2I5MX 1A3UA 2B63I 3CCL1 2CQAA 3CC2Z 1MJCA 2VUGA 1SFOB 2OTLA 4LF8L 2L55A 5IWAQ 4IPHA 5M5XH 3CQZH 2JMOA 1B50A 4R1JA 2Q8RE 1A3TA 2OTJA 1W2BY 4L5RC 1XNRQ 2N49A 3MVVA 2VL6A 2LSSA 1PH5A 1YNNC 3PO2G 4JBMA 3D6CA 2O2LD 2B3GA 1O80A 1KAAA 4OIKA 4OGQC 4LFCQ 5CV5A 3CC41 1WW9A 4OL7A 1VQBA 4ZKCB 4JI3L 1YHQZ 1SNQA 3NK9A 2B2TA 2K4KA 4QF4A 2IV2X 1YIJZ 1ZYRD 1EQQA 2BJOA 4X65Q 3RN2A 1YJN1 1H95A 3KIFA 1B70B 5I2YA 1ESFA 3G7LA 3VYRA 3FVQA 4R4QA 1EFWA 2B2YA 2K50A 4OWWB 2JJQA 4DR5Q 3OOCA 4ID6A 2Z6BA 1G2SA 5C4HA 2UXCL 1PVOA 1YHAA 1K8A2 2VS1A 1CA6A 1HPCA 4OELB 3P75A 3CMA1 1Y1WH 1RO2A 1SJED 1X3WA 4DAYA 5L37A 4PNYA 2PPBC 2RT9A 1VQEA 2RHBA 4RS4A 2EY6A 4GKJQ 2UUBL 1SMXA 3I4NH 1FGUA 1MI2A 1GVPA 4RKLA 1IBLL 5E3FA 3S1NB 1Y1VS 2HQLA 4KHZA 1EY8A 4IUNA 3FDTA 1GHJA 4PMCA 4CDCC 2JR6A 5EPKA 1HTPA 3SDZA 4KI0A 3NTHA 1VQ8A 3MWYW 3DM3A 5C44G 5IYCH 1W6JA 2QW7A 1XNQL 1VQ6A 2N55A 3A56A 4YIJA 3K0XA 3MFGA 3PQIA 2QF7A 1WTRA 1F77A 1AZQA 4JI3Q 2A6HC 2K04A 4A93B 3IX0A 3GTJI 4POGA 4A3CH 4QCLA 1HQMC 4RGOS 4QY7A 3RLFA 1VQOZ 5ELDA 1TWFB 4IUPA 4A3CI 4B08A 3GTJH 5IWAL 3DWAA 1I4HA 5JJZA 2JK8A 5FJ8H 4LF8Q 3S1NH 4BBSG 3I56Z 1PZKD 3V05A 5LMUQ 1M1K2 3U9OA 3K57A 3JAML 2IX0A 5FK9C 2F0WA 1DL6A 3PUVA 3UDIA 4LFAQ 1EEFD 3CD6A 3ND8A 2K5VA 4P71A 2VPYA 2Q2UA 1VQIA 5AFWA 3CRLC 2E76C 3W3AA 3I2ZA 3CCV1 4CJ2C 2E7ZA 4X62L 2K32A 4TSSA 2NYZD 3L2PA 4JV5Q 1CM9A 4GN3B 2Y0SA 2UU9Q 2HT1A 1VQN1 3LX0A 2H5XA 5IT9L 2VY3A 1TWFH 3R8BA 2YV5A 3H09A 4KMUC 2NN6H 5T64A 5KRUA 1WOCA 2XWJB 1GO3E 1WCMH 3I73A 3HRZC 2HHHQ 5JJLA 1S5ED 3N52A 2FXQA 3JAMb 4TKOB 2WP8J 4DV4L 1V1QA 4JBJA 4L63B 5GAEC 1XNQQ 3CRKC 2DY8A 4DAMA 3VDYA 4XT3B 5ELNA 4LFBQ 3TZUA 4LUZA 5C3EH 2VZAA 2EYHA 2IX3A 3OW2A 4IPGA 1SNPA 3A5ZB 3BDOA 1FDIA 5IYDH 3X3MA 1RD9D 3QR8A 2NVYH 1T9HA 3ZYYX 4B9XA 4KY5A 1Q822 3ULLA 3FQQA 2EZVA 2EPBA 1FD7D 2V45A 4DGZA 1N9WA 2Q4ZA 3CC7Z 1QUQB 1XMOQ 3DWQA 2MJ8A 1IBML 1I50B 2QA41 2AQ1B 4DV6L 4RFBA 2IPKD 2UXCQ 3MAQA 2IZ3A 4K5XA 2NVXI 1B3AA 4V190 5D1OA 3G711 1NJIC 3PO3I 2K6AA 5LMUL 3ERQA 1X32A 3STBC 3JAME 2O4HA 2Q2HA 3KLSA 3CCRA 1PH8A 1CKNA 3S1QB 1BBWA 2ZTCA 2E5LQ 3NDJA 2R6GA 3DUZA 5CM2M 2PQAA 4IUQA 1TS5A 1Q7YC 2CCZA 4POFA 4X66Q 1LUZA 3TN2A 4EQPA 1HUMA 4CL1A 2SEBD 3NWTA 1TY2A 1UE1A 2YTXA 4NP5A 2XNAC 4HJ8A 1YIT1 1CZGA 3CC4A 1YHBA 1SNCA 4U68A 1OXSC 3SVMA 4AQYQ 1A15A 1USPB 4RHRA 2UUCQ 3RD4A 4HTHA 1I4GA 1STNA 2UUAL 1M901 5IGDA 3HOYG 4DGLA 1EY5A 2MHVA 2TMPA 1Y8CA 1CSQA 1EY7A 5D3IB 5EKLA 4CKBA 4WFN3 4KTAA 2M9VA 1VCIA 1KLGD 5ELOA 3LWEA 5LL6S 4A3KB 1K8MA 1H9SB 2P28A 3PO2B 4S1TA 1K83I 1VLAA 1GUSA 3PUXA 3IFUA 5KYLA 1IBKQ 4C3IH 5EGTA 5EPJA 3CCM1 2IW3A 4KK7A 4K6LA 1STBA 5M5YH 2PZUA 3E0EA 1VQKA 3TQYA 5I4DA 2E2JI 4BBRH 4OXPA 2VPZA 1DYQA 3EBEA 2CKZB 4ME3A 1PH4A 4K5VA 3OTOL 1K3BC 2K03A 4IQZA 1Y1WI 2HIXA 2AUKA 2EE1A 1HR0L 3PF4A 2R6MA 1PFNA 3FEWX 3CC21 1N8R1 4NBBA 1YBYA 1CKMA 3TMEA 3HOXI 2NWGA 2QKIC 3CD6Z 1HA5A 5EBCA 4WRDA 4E33A 5IP7G 1CT1D 2JA5B 1LO5D 2MUYA 2RPRA 1KD1C 4FNFA 2CFMA 4MONA 1X0TA 3HKZA 3A8KE 3CCMZ 4J1MA 4A3JG 5HGTA 2KPIA 3PGZA 4BBRB 1KIXA 1J6QA 3RMHA 2B2UA 4B3ML 2FHTA 4A3BH 1QB5D 2NZ1D 2ZT9C 5CV6A 3GQBA 1YI2A 3HOUH 1QWYA 1VQHA 4A3IG 1HA6A 3RZDH 1QNUA 1DOKA 4OO1G 4KY6A 2OOXB 1SSOA 4GOPA 1VQLA 1IL8A 3VYTA 2EVBA 1Q16A 2K5HA 1VQ8Z 4LAAA 1WTXA 1HNXQ 4LF6L 3C46A 1QVGZ 1QVGA 4B3RL 5GAHC 4X3SA 3CD61 3ND9A 1BCPC 1C48A 2EYPA 4LF9L 3HOVB 2JA5G 2Z0SA 1Y1VB 1OXUA 2QR1B 2AYDA 3CCE1 3D9XA 1IYJB 1KNEA 1HZ9A 2C5CA 2GVBA 1TWAB 3NSWA 4MNOA 5FLXf 1S4ZA 4RVFA 2SDFA 5M3MG 2WB1G 1XMQQ 3MZKB 1XMQL 3PUYA 2HU9A 4MHEA 1QVFZ 3S1RB 2PW5A 3IF8A 4DR2L 5ELCA 1PH2A 3W1BA 2QDBA 4C2MB 4X64Q 3PIP3 1QNKA 4JV5L 1D7QA 2QREB 1S72Z 1Q3LA 1WYDA 4R9WA 2D9UA 1W2BA 3HOVH 3MFYA 1B8AA 1KDAA 5FLXE 2G5DA 1SR3A 1XPOA 4DV3L 1STAA 4AH6A 2E2DC 4CJ1B 1K0RA 2DN8A 2E2IB 1XMOL 2MNAA 5IP9H 1EEID 3QWUA 2NN6G 1AFPA 3CHBD 3HOVI 5HGQA 2VF1A 1Y8NB 1C4QA 2JS4A 1FNWA 3FP9A 3AYHB 4NXNL 5LMNQ 2XRQD 4C2MH 2F4VQ 1TXYA 2VQEQ 2NTTA 4CDEC 4B9WA 2E2HH 4DK6C 2F4OA 4HMIA 5A2Qb 5JVG3 4KHVA 4DV0Q 3J7AV 1WVLA 5ELEA 1SE2A 2PNHA 3ONAB 4A3II 4AYBA 5GROA 1CK1A 1GD7A 2KEEA 3G6EA 5C3WA 3EIVA 3NHHA 4FXKC 1SE8A 4DV7Q 3A54A 5C0XJ 3HOWH 3K81C 2L12A 5CORA 4A3JI 3KF6B 3WWVA 2EYFA 2OT2A 4ME5A 2QA4Z 2VUMH 3SHLA 5FO8B 1X55A 1RHPA 2NVQH 1ICFB 3E0JA 4HIDA 3T13A 4X62Q 5M3FG 4EX5A 4Q0FA 2F0QA 4KKUA 2NVQI 5HURA 2B8FA 4LFAL 4YWMA 5IYCG 1F9SA 4QMGA 4A3LG 4OO1I 3LGJA 4KD3A 1PMRA 4C1NI 1ZB8A 1EU3A 1NNXA 3I90A 3HOZI 1USPA 3HGBA 3GD7A 3M4PA 3CCMA 3F2BA 4CKCA 5IGCA 3FKIB 4GLVB 2X6LA 1E2ZA 4RKBA 4BY7B 4MH4A 5TSSA 1TS2A 3E3XA 2JA7G 2M2LA 1JJGA 4XXEA 3D8GA 5C6AA 2R7ZH 5CMDA 3GTLB 2A5HA 4CHTB 4AYBG 4NXML 1TU2B 2LY7A 3AFPA 3CQZI 1PZJD 3PIPA 2J0TD 5IODA 4H7BA 3K5MA 2JA6I 1TWHH 4L8JA 3SR1A 4QUFA 1YZ6A 2IX1A 1P8LA 5C44B 4DR3Q 1XJVA 2ZM6Q 1VQ4A 1LV9A 1D6EC 1TY0A 2MO1A 4IZ8A 2UXBQ 4A3BI 3QO2A 2D5DA 3HOYI 1N34Q 2EQSA 2KECA 4NFRA 2KHIA 4EQ5A 2JEBI 2KVMA 1SLJA 2O4XA 5DEHA 2O5IC 1IKMA 1FYCA 3EEDA 1K8AC 2JXMB 3FKIG 4BY7H 3HOYH 4N8FA 5A2QE 5COYA 3H91A 2Q2IA 2R92I 1PTOF 1Q90A 1VQCA 4JI5Q 5IGBA 3J7AF 3S1QI 2BA0A 1QVFY 2CWAA 2RQXA 3TREA 4A93H 2N3SA 2L11A 4X64L 1YJ9A 1NBWA 3NEMA 4APVA 5JPNC 1TWGB 1NMGA 3IRBA 4MIUA 2RIQA 3OMGA 4A3EB 4LFBL 1VQJA 1FVIA 3I56A 4X65L 1X65A 2WB1E 2YYZA 2XSCA 4QB4A 5FLMG 5M3MH 3LNNA 3G6JB 3MC0B 1Q821 3EJIA 2F0MA 3L0OA 4GLAC 2HCIA 4ZRZA 3E5SA 3GTOH 1OXXK 2IHEA 3GTPB 3T1HQ 5T67A 1H9RA 3CKIB 3BG3A 3GTMI 4A3LI 1SYGA 3K5OA 2B2WA 1HFGA 1M1KC 4HMJA 4U673 2O53A 4HJ9A 5FO7B 5EKKA 3BG0B 2Z4HA 2PI2A 4S3SA 1MD2D 4A3DB 2WINB 1IW7C 1GOZA 1RKNA 2C35B 4DR1L 5A35A 5CBAE 4C3HG 2K5RA 4DR7Q 1FDOA 4YWLA 4N9PA 4JI4L 1CUKA 1K28A 3FKII 4RGTA 1X54A 4BY1B 1QJOA 4NH1C 4A3IH 5BR8L 4CDDC 1ILQA 3M7GA 4DV5Q 3FRPB 2JA8I 1HJPA 4IFDG 1A0IA 2D2CC 2F0TA 2ZTEA 1WTPA 4N8X1 1EY9A 2UXBL 1V1OA 3PO3S 1VQ81 1MBYA 3CCJZ 1GXDC 5AJ3L 2NVYB 1VQ61 1BOSA 1EWIA 3KJOA 2A6EC 4NXMQ 3I55A 4LFCL 4JI2Q 3H3VI 5CV8A 2ICIA 3T53B 1Q12A 2NN6I 4NOZA 2DJFC 3M4YA 4PZ8A 3KJPA 2HDMA 3VR2A 4GNXB 3G6E1 4RMFA 2ZJPA 1VQ7A 3W1GA 3MZLB 2QLVB 1JWMD 4MN3A 4QGUA 1F9PA 2K75A 2D0PA 4HSPA 2EY5A 2UUBQ 2O5JC 3B6YA 2NVYI 1KC82 3S1QH 1BBUA 2QEX1 4A3FI 2HQEA 1KQSZ 1L1OA 1EUJA 3VMHA 4OWXB 1ILPA 1XX8A 1A2UA 3EERA 2VUMI 4KKTA 2GN5A 2BDNA 4HN7A 3CCJ1 1K731 3P20A 1Z01A 3S2DB 3S15I 2WFWA 3OW7A 2K5QA 3CU7A 2I46A 3L9AX 3HKSA 4NW2A 4NBHA 2F0FA 4PG3A 4DNTB 1EZ6A 1E3PA 4DR2Q 3FQMA 3KBGA 4PZ7A 5M5WH 4K2LA 4HAEA 3CXCY 3HEJA 2EOTA 2YU9I 4CKEA 1PLFA 2ZTDA 1KQSY 1EWCA 3TP7A 2EY2A 2J4XA 1WTVA 4JI7Q 1J8IA 4B3SQ 3H6MA 3HOZH 3G71Z 4PZ6A 1A6XA 1IKLA 1Z03A 4A3DI 4A3KH 4JG2A 2PI2E 4DV0L 3GV3A 2CH4W 5G3LF 1E22A 4A3FB 1HXYD 4DV1L 2EYOA 1PH1A 3CPFA 1Z02A 3OIPA 3S2DH 1B9NA 2KHSA 3KDFA 2L9HA 4C56C 4NXNQ 3D3RA 1HNXL 1VQ51 4XX2A 3I55Z 3PV0A 2X6GA 4R4CA 2HD3A 4JYAQ 5FLXc 1TWAI 1K8A1 4NBEA 1I6HB 1N33Q 1V43A 3HOWI 2F0JA 2G9DA 3I91A 3SK8A 4HGYA 4H0LC 2W03A 1TWGI 3D4WA 1Z9FA 1MKHA 4WJWA 1ZB9A 4I7AA 2AMCB 2F0OA 5BN4A 3G71A 2WACA 3PO3G 3R3OA 4UAIA 2JA5H 3CCR1 1R4QB 3TEHB 2VPXA 4DK3C 5CV4A 1KTKA 1E1TA 2JA8B 3CMAA 3SK6A 2D0OA 4DNIA 2NVTB 2KCCA 1D1IA 1SAPA 3I4MB 4BY1I 2F0SA 3GTQH 4BBRI 4DR6Q 1UE6A 3T1YQ 3A8JE 1SJHD 4FF1A 1XXGA 4RVDA 1KL9A 2VPWA 4E6IA 2WB1B 5KGUA 4IOAA 2V4DA 2L4NA 4H13C 5C0XG 4R4TA 2QGQA 2DY7A 4KN7C 2KI7B 1HNWL 2GTIA 3J81b 2OZKA 1JORA 4QL5A 2PZWA 3CAMA 2JUBA 4HIMA 2B2YC 5CV7A 5E4WC 3AFQA 1HR0W 2LMCB 1BCPB 2RDFA 1TIID 1Y1WG 3SGIA 3KLWA 1SNDA 1N33L 3GTKB 3QB3A 2XRSD 2VXWA 4J6HA 1YHQ1 4HCEA 2KUMA 1B7YB 1D8LA 1EYAA 3N6RA 4DU9A 1G2TA 2JIOA 4HJAA 1LTTD 1EZ8A 1HZAA 2N88A 4Z9CB 1EIYB 1GUNA 1EYDA 4DV1Q 3NBIA 3CCSA 1QZHA 4K8JA 1KC8C 3CCLZ 1N32Q 5GADC 2OTLZ 5K36H 1MGSA 3CC2A 5M3FH 4XT1B 1EFID 1VQAA 2WAQA 1LT5D 4MRIA 2BCOA 3S16I 3HOVG 1HRJA 2F3WA 1T5EA 1V1PB 4OX9L 4L5SA 1VQNA 1HR0Q 3GTKH 3HOWG 1C8CA 3CC4Z 3D31A 3OSOA 1VQ91 2KCNA 2SOBA 5JEAG 4MTNA 4RA8A 3GTQI 3IFTA 3A55A 1SIWA 3RZOI 3TRZA 1E1OA 3I4NB 2K28A 1RCVD 1ENFA 2W04A 1TS3A 3CMEA 1CZWA 3CCQZ 3D6WA 5C44I 5IT9f 2Z4IA 3K7UC 4CJ0B 5I6WA 1I3QI 5KNBA 3A5UA 3S1MB 3CQZB 1U5KA 2OQ0A 4DR5L 4GOPC 1E24A 3JAMc 3S14I 4F8MA 4JI8L 1EQRA 1IHZA 2Y0SE 5LL6X 1K8GA 2L5TA 2JSOA 3HOWB 1XWEA 1PHJA 2PO4A 1N8RC 5JEAJ 3TP6A 5C0XI 1AW7A 1W6KA 4R4OA 2Q8IB 2C9OA 4IURA 4C3HB 4PMWA 2E2II 2ZXRA 1CA5A 3BJUA 2UUCL 2NZHA 2R7ZG 5IGGA 1BCPF 3KIHA 1A62A 1BCPD 2VW9A 1RNIA 4DNRB 2CQOA 2RHQB 1I6VC 1Z7TA 3NTKA 3CPWY 3GTMS 3ULPA 3EFXD 3J81i 2UU9L 2CWPA 1G51A 1ZXTA 2EYJA 5BN3A 1QCBD 2IJ0A 1II3A 5JJIA 4DV2Q 1LM0A 3D4DA 3J81E 5C3EG 4K0KL 4GKKL 2IL8A 4HJ7A 4DF7A 5I6YA 3FKIH 2YU9B 4LF5L 4LUOA 3K5NA 4DR4Q 4XYQA 4ZYSA 4DR4L 1VQ5A 2RHSB 2B29A 3CF5A 1VQFA 1VQOA 5JPMC 3SK5A 4XQJA 2B2TC 1JB7A 2XN9C 3CW2C 1JOOA 1VQMZ 1KD11 1HH2P 2RCNA 1MSHA 2PMZB 5A2QL 2ES2A 1X3GA 1BUVT 5C44H 5EKIA 1EIFA 2NTSA 5DLQE 2QEXZ 3IR7A 2KJXA 3FPPA 1LYLA 1VMCA 3ICEA 5DM63 1CKOA 1RO4A 4KJNA 1K3RA 1WIIA 1Q46A 3EA6A 5C3EB 2OTJZ 1Y14B 3U50C 3VYUA 3U58A 3R93A 4GNXA 4QTTA 4JI6L 1IZ6A 1M8AA 4BY7G 2K1BA 1LTLA 1FNUA 3VMGA 3GTJB 1SMYD 4PQXA 3H3VC 1IBLQ 4A3MG 1FJGL 1WTHA 4DK0A 1QYPA 1YNJC 3TS2A 2QKDA 4DAPA 1WFQA 4BWGB 4Y52H 1IYUA 2A6HD 2KA7A 3HG9A 3IAYA 3IKJA 2VUMG 1X3EA 1JOQA 4AYBE 1I3QH 4JBKA 1YJ9Z 1SRUA 1QF8A 5D14A 1AEXA 1Q82C 4Y7NB 3I4MG 2PW7A 1NP6A 4R8NA 3I8ZA 1KDCA 1LLRD 4UP9A 1QG7A 4A75A 1TVXA 1WD0A 2A68C 4GN5A 1YHQA 5G3LD 2EYLA 1YI21 4TQUS 3STBD 3S2HI 4YHHL 4RVHA 3KFUA 3CCLA 2IY5B 3QG1A 4DAVA 5KNDA 2ZM6L 3AMUA 2XTIA 5CR3A 3PO2I 4C1NK 4F88A 1I94Q 2WAQG 2F0IA 3H0GG 1JJ2A 1I3QB 3T16A 3J81L 3ZJYC 5IYDG 3GTPI 4HCSA 1VQ41 3NPPA 3CCEA 3M85A 4HH4A 1WCMI 2AQ2B 4IFDI 2EIFA 3RZOB 2LKVA 1TFIA 1H9JA 1DONA 4ODGA 3J7A4 3SXHA 4YCUA 2NAPA 1FL0A 4FYDA 3SEBA 4TRDA 2JA7H 3HOUG 2LS01 4JI1L 4RGMA 4O1NA 4A3BG 4KHPL 1CI3M 1I50H 2R61A 1H9KA 2B2VA 2M6NA 3OYYA 2X69A 3FHWA 3R2IA 1VQMA 2XVSA 3ITPA 4RG1A 3HOXB 3CME1 5J3BA 1SFOI 1XYIA 1N8R2 2JA6H 2UXDL 1SBBB 3E9HA 3T51B 1FJGQ 2R92B 3K7AH 4LUVA 3HZXA 1VQ4Z 1EIGA 1NR2A 2R93H 1I50I 4OX9Q 2HDLA 2MPMA 3F1ZA 1LTRD 3PIOA 2WV6D 4DAYB 2Q2TA 5C4JI 4O42A 1R9TI 1RIPA 1J9OA 2VNUD 2JA7B 2PQAB 5EJWA 4IPDA 2F0LA 3TDQA 4MZ9A 4A3BB 5IP7I 4NDXA 1VQLZ 3S24A 4KLKA 2F4VL 4DK1A 4E32A 4HIKA 1M1K1 2BDOA 5IY0A 2OWOA 1X3QA 2JA6B 1QE6A 5IT9c 1B3QA 3AEVA 4LF6Q 2JN4A 4DUYL 4C3IG 2R92H 4QJFA 3KLSX 1JJ2Z 4ZK9B 4X3UA 2JP1A 4XQNA 5IT9E 2F4IA 4J15A 2ZJQA 5C4XB 2HCCA 2DE6A 2XGTA 3PMFA 1Y1VH 1WTOA 1BXTA 5C4JB 3J81f 1JE5A 1KLUD 1D5MC 4P75A 5IOCA 3HOZB 2NVTI 4JC0A 3M7NA 2EYMA 3CCQA 4BBSH 4MD7A 2MGSA 3MHBA 2BE5C 4YCVA 4V0BA 3TS0A 3I4NG 1JJCB 1D5ZC 1EWHA 4H44C 1MJEA 3F2CA 2HF1A 3MXNA 1ET9A 1LT6D 2MFIA 1JJ2Y 4DFAA 1BKBA 4DQYB 1NR4A 2NVXB 4E2WA 3WOEA 5C4XH 3M4OB 3RR5A 1XTCD 3OTOQ 1K9M1 1Q86C 5C4JH 4HGZA 2E8GA 4OHJA 3EQLC 2R7DA 1N36L 2JEAI 3J81j 4RCOA 1WTQA 4UY8C 1Q8IA 4JI8Q 2M48A 4P74A 4YCWA 2OEOA 1LT3D 1T5XD 3MEFA 4LNQA 4JI1Q 1STHA 1D5XC 1B2TA 3Q6SA 4BXXH 3F8TA 3K80C 3QOJA 3MXNB 1A8VA 3HP3A 1E7ZA 1JB3A 3K5LA 3U9SA 3ER0A 3NTIA 4KN4C 4A3CG 1IXRA 3S2HB 2YTYA 4BY7I 4ULLA 5T1IA 1EY4A 2QRDB 2KENA 3HOUI 2UUAQ 2EDGA 3KUPA 1S5DD 4JI2L 1RO0A 5IT9b 1HHVA 1L0WA 3C1EA 2G2KA 1WZNA 1V1PA 4NBAA 4Y7NI 3M9BA 3S15B 3VR6A 2ATWA 3K0YA 1WCMG 3BZDB 4F87A 2VUMB 1EQTA 2NVQB 5I9PA 1JQYD 1ML8A 1SROA 1YJWZ 1YJ91 4K6DA 5T1GA 3PUZA 1Q1EA 3H0GI 1YVCA 3C2PA 3OPOA 3S1RI 4R4IA 4NKLA 2HUGA 2Q51A 1YITZ 1ZH1A 2DGYA 4FVMA 4GS3A 4DN4M 1VQGA 1IBMQ 3BDLA 2V3VA 1PYSB 4K14A 3UE1A 4A3GB 5IE8A 2J6AA 4PV1C 1YI2Z 2F3IA 1Q812 3S15H 1U0LA 2E9HA 5C3EI 4K8IA 4EWCA 3NP8A 1K73C 1EU4A 3KDFB 3MEHA 2ID0A 3J7A5 3HKZG 1B1ZA 4FXDA 3MTSA 3VR5A 1HQRD 2A6ED 4DKAC 1PRTC 1B9MA 3L3OC 1Q1BA 2NZOA 4O2DA 4BXXG 2JIMA 4GN4B 4DUZQ 3OIQA 1NTGA 2CW0C 2OXPA 3GDEA 4JI6Q 1UEAB 2SNSA 4KV6A 3TSSA 3VYSA 3DXJC 1KC81 2VB3X 3U4ZA 3R2TA 1P16A 2B2VC 4HJ5A 2I0QA 2OQKA 3PUWA 4IN3A 3Q22A 1VQ7Z 2H4OA 1GHKA 2WKDA 4JI0Q 3LUSA 1PRTD 2HHHL 5JEAH 2LXKA 3OHXC 5FLMH 4A3GG 2EY1A 1OO9B 4JVZA 3V2TA 1GM5A 3CC71 1C9OA 3NDIA 2DJGC 5IP9G 2UXDQ 3BZCA 4GLXA 1Q81C 4AIMA 3DWPA 1O7ZA 2MP1A 2K5WA 1Q811 1SYDA 2F03A 2XWBB 4LF4L 1DZ1A 2B2WC 3GTMB 4Q5VA 3AU7A 3CXCZ 1S7MA 3CCRZ 3FPUB 2PMZA 4C3HH 4N9TA 2JE6I 4GKKQ 2Z6KA 4C3JH 1XPRA 4JYAL 1SYBA 1ENCA 4X3KA 1VQ71 1Q7Y2 1G6PA 3I7FA 3CCU1 1SE4A 4RVGA 1YITA 1JOKA 4IUTA 1U4MA 4A3EI 5M3MB 1WJ2A 1HNZL 4ZUJA 3EN2A 2KCTA 3K59A 1SFOH 3CCQ1 1R4PB 1TQOA 2QEXA 4YY3Q 3S1MI 3GTLH 5M9OA 1HUNA 1SYFA 2PZTA 3GTPH 1EY0A 1F2ZA 1VF7A 4ZAIA 2KEDA 3KBXA 3HOXG 4DV4Q 2YU9H 2F52A 1F2YA 3CCEZ 2L0CA 1CKNB 1W2BZ 4DUZL 4ILWA 2PK7A 2PQEA 3J80L 3G4SA 4HIOA 4A3DH 1DOMA 1SNOA 2VQFL 1OTCA 3HKZE 2V8IA 2F0DA 1NMFA 4XDXA 1YIJ1 5DNFA 2K52A 2FINB 3HOYB 1KDBA 5FO9B 4UPAA 3UDFA 3NFZA 4LWCA 5JJKA 2JA5I 3PSIA 4JI5L 1Q7Y1 1JT8A 3F2UA 3NWSA 1NSNS 3P1HA 1KXLA 4WORA 4P2CB 4MD9A 2ZJRA 2D62A 4K0KQ 1L1OC 1PDQA 5E4XA 2F0HA 1Y1WB 4MD8A 1EOVA 1AE2A 1S5CD 2F0GA 1TWGH 2G9HD 1A3VA 2I07B 4DA2A 3F3FC 2F0VA 1MHWC 4A3JH 3E9IA 3V96A 2N78A 1VQ9Z 2B2UC 5LHY1 1SN8A 1DM0B 1U4RA 4JI0L 2BOSA 4RCNA 4EGVA 1AE3A 1W3SA 1I94L 2JA9A 3VA5A 3GTOB 4TNUA 4RV9A 4NB8A 4AYBB 4X6AI 4NPSA 1KRTA 4TVAB 1E2WA 3I70A 3RLNA 2P5ZX 1O7IA 4M8AA 4QUCA 1P9NA 1QUQA 4Y7NH 1O7YA 1VQ6Z 3GTOI 1CQVA 2OTJ1 3I07A 1D2BA 1PTOC 2RCFA 1U4LA 2SNMA 4GKJL 4XTCS 1YUAA 1X6OA 4A3JB 4CBVA 1LTAD 1GUOA 2PYKA 3TZDA 2EXZA 2F0EA 4IUVA 1BF4A 4NBDA 3MA2B 2F1MA 5KEEA 3I4LA 4B3TQ 4A3IB 5EBDA 3S9WA 4IO9A 2RF4A 5JVH3 1VQDA 2CVRA 2KOLA 1YJNA 5E7NA 1N36Q 2V8JA 1QVCA 4NB3A 3IL8A 1BNZA 3RZDI 5FKAC 1L2FA 2R3ZA 1SEBD 5ELFA 1HFNA 1K0SA 1I4XA 2R92G 3VB9A 1IYVA 2JIPA 2Y0SB 1LT4D 1G6ZA 1AP0A 5CGKA 1I6HI 5IIFA 1ESRA 1TWFI 5FJ8G 1EL0A 1N32L 1EOTA 4NBCA 3URYA 2GVAA 1EYGA 1G91A 4GNXC 1HNZQ 3VR3A 1I6HH 1CFMA 2QILA 4F7XA 3H94A 3UI2A 5I9OA 1GUWA 4L6TB 3C3LA 5D65A 3TP5A 4A3LH 2DUDA 4A3MH 2MQHA 3J80b 1S72A 4BS9A 2V1CC 2EGTA 3K7AB 4RWSC 1ZKOA 4BA1I 5IP7H 1LTSD 3BS1A 4JPBW 4A3MI 2EJGC 1Y1VG 3BYYB 4DUYQ 1JCKB 2K5DA 1VQ9A 2F0KA 2PCFB 3OW2Y 1I4PA 2I5LX 4IUUA 2TSSA 2NBFA 1Q861 2DE5A 2Z8LA 5EAYA 1QXFA 1N34L 3I4MH 1HZCA 1TR5A 4RH6A 2A69C 3CCUA 1XPUA 4IPCA 5T6BA 1JR0D 2FMMA 1Y1VI 3S2DI 4OO1H 1RDPD 1VMPA 2Z6KC 3QJYA 4DR3L 1J5EQ 4LF7Q 5IYBG 2PMZE 1PRTB 1FNVA 3HKZB 1B44D 1H9SA 3S14H 3K8AA 5C5MA 2BE5D 2OF1A 3MZ5A 1KRSA 3NBHB 2PM9A 1ML0D 4L5QA 3J80f 1BBXC 1ICWA 4LW1A 4A3DG 1NE3A 3CCVA 1AA6A 1MSGA 2K7VA 2R7ZI 3TE5B 4LF9Q 3Q8DA 2R7FA 1S5BD 3NENA 1DCZA 1G8ZD 3GTGI 3BZKA 4IALA 1WD1A 5ISRA 1UNSA 3K6OA 1YIJA 3OMCA 3UE0A 2GTHA 4A93I 3I3CA 1Y8PB 2WKCA 1KABA 2H85A 2OTL1 1K83H 1CSPA 1AH9A 4OEMB 4ZQ3A 3PO2H 1HNWQ 2PNRC 5LL6f 2F0UA 1VQPZ 1PRTF 4C3IB 4I65A 5EQ0A 4RHSA 4EQNA 2VB2X 2GA4B 4A4IA 1S5FD 4KJOA 4ZCKA 3K58A 1WTWA 3W5OA 4A93G 2FMCA 5ELBA 1PTOH 2AKLA 5C4XG 4AQYL 1N2FA 1I5FA 3J7ZC 4DR6L 2KHJA 4JOIA 1SYEA 4A3GI 1FR3A 3DM1A 2E2JB 1RTOA 4RGNA 1PH7A 4FDBA 1K732 3OWEB 1X3ZA 1J5EL 4LF7L 1DD2A 3E6ZX 2R93G 4X66L 1LTID
chains in the Genus database with same CATH topology
3RUZA 2A74C 1AZPA 2QCPX 1BO0A 1K83B 3ESWA 5FLXb 3H0GB 5J22A 4A3KI 2F4MA 3S17I 1ENAA 4NBGA 1OXTA 2AWNA 1JC7A 4KKSA 2DNCA 1TWHI 2J7ZA 4HEDA 1UAPA 3SK4A 4ZUIA 2CHBD 1CQFA 3KLRA 1VQKZ 5IGEA 1M4VA 1EQVA 2OOYB 4HR7B 3I561 2DNEA 3HOUB 2ZXOA 1Q862 3D4RA 5K36G 3CPWZ 1BR9A 1LABA 5D3DA 2BA1A 4KD4A 4XYOA 2F0NA 1EYCA 2E2HB 2ZXPA 3PO3B 1CHPD 1ZYRC 1QILA 2B63B 5M5XB 2E74C 3A7AB 1QVGY 1F9QA 5DM73 1E0BA 5A2Qf 4R8IA 2YADA 3PIO3 1A2TA 1VQK1 3KK7A 3EROA 5KNCA 4IFDH 1YJW1 2IT1A 2LIYA 2EJMA 2K33A 2EJFC 5JOBA 3BVGA 2AUJD 4PMBA 5I2XA 3GV6A 3GTLI 1S721 1LTBD 1B4OA 1RODA 3TBIB 5F2DA 4FF4A 3I72A 2ZAEB 2K01A 1RQFA 1H9MA 1L0YB 1TWCB 1CHQD 4NBFA 2B39A 1QOHA 1TS4A 5C4XI 1G291 3G6EZ 2LFUA 1VDZA 1VQM1 1PTOD 1LQLA 2FJ2A 4G4KA 1RJTA 1FGBD 1DXMA 1U4PA 3FMCA 1K8OA 3S17B 4HSVA 4ZKBB 4BA2I 3NE5B 1Z47A 2WIIB 3CCVZ 2L1BA 1NCVA 4G7OC 1LTGD 1X3PA 2I3CA 4KY7A 3J80E 2Q8TA 1KNAA 3VA7A 1Y69U 1JWHC 2AWOA 3A7LA 3NBHA 1IW7D 4DXGA 3DHQA 3MXGA 2LFNA 4OIJA 2E2HI 2A69D 1HTLD 3T4NB 1STGA 3T4AC 4LK1C 2AQ3B 5CC4A 5K5PA 4BBSI 3WDNA 1KRLA 3S1NI 3P5JB 3GTGB 5C0XH 5E1FA 2QRCB 2JYOA 1GUTA 2R7ZB 1PFMA 2RKSA 3O13A 3JAMf 1PXUA 1WCMB 1TWHB 5D1PA 2M00A 1NUCA 3BDCA 5NUCA 1VF5C 3VR4A 3BG1B 1V8QA 5KYIA 1VQP1 3IFDA 2K3RA 3J7YW 4QTUA 3GKQA 1DOLA 2QEJC 3DEOA 2RBLA 5DAUA 5EPLA 4G7ZC 1PZID 2R93B 5JAVA 1SE3A 1RTNA 3C1FA 3H3VJ 2R93I 4RAUC 5C5LA 1NJI2 1RLYA 1GJXA 4IFDJ 3QOLA 1YJNZ 4E31A 3CCSZ 4UDUC 2K05A 5FOBB 5AN9F 2RSNA 3GCFA 2RBMA 3W2DA 1YNJD 4X3TA 1ET6A 1Y8OB 2WAQB 3NQTA 2B8GA 1JE4A 2XIWA 1YUKA 1VQL1 1UUPA 3CCS1 1SYCA 1JWUD 3T56B 1JICA 2RA4A 1BDOA 3Q0AA 1DJRD 2RDGA 5IP9I 1O7LA 3EVQA 3CMAZ 3VMIA 2NB0A 4XQQA 1VQO1 3DEPA 3Q87A 5CBEE 3NUCA 2ICEC 4EQOA 1SDFA 5M5YB 4G57A 2FFKB 3WOFA 5C4ZA 1F2LA 1AN8A 5CV9A 4A3MB 2IWHA 1NJI1 1HCZA 3L7ZC 3K7AI 1B53A 4LMQD 1KD12 4Y52I 4BXXI 1D1KA 3OW2Z 1PFBA 3Q23A 2V8KA 3HS0C 1ZEQX 1TT2A 1ONLA 4J8QA 3M3YI 1M902 1F9RA 3OWFA 1I4QA 1TWCI 4I7ZC 4FF3A 4E2YA 2F3VA 3NH8A 3NH4A 1JWSD 3MXUA 4CGYB 4BBSB 2A73B 5C3XA 2H1EA 3S14B 1CTMA 5D1OB 4DXFA 4G7HC 1PYWD 3RZDB 5BN5A 3KF8A 2A68D 4E2ZA 3DMUA 3X3NA 3I4NI 4FXGC 1STYA 1VQ5Z 5J39A 5M5WB 3GTQB 5IGFA 1VQNZ 5CYUA 3BVZA 1YNND 2ENBA 1NAPA 3MXPA 3AB9A 3TP8A 3M3YB 3M4OI 1E2VA 3F3PC 4NB9A 4JK1C 1EY6A 4K5WA 3S16B 2DE7A 4M1UB 4LJZC 1I4RA 4JBWA 3GO5A 1RF2D 4QIWB 1PTOB 2KQ3A 2WB1A 3G4S1 1SMYC 1F2MA 1OXVA 4XIGS 1EIHA 1O78A 4ZLTF 3VTNA 4EVOA 3I551 1L0XB 3MONA 4C3JG 5FLMI 1SNMA 3BVMA 2RVLA 4E30A 3GP7A 1STEA 1LACA 3GTKI 1TKWB 2E75C 3P7JA 4FO2A 3NH5A 1PFTA 3TDHB 3NQIA 1U9RA 2CW0D 3NXWA 2JNYA 4ABNA 2P3YA 2Z1CA 4K2KA 2RSOA 3CMEZ 5M3FB 2IZ4A 5J1ZA 3SE0A 2NUCA 3LWUA 4FF2A 3QWNA 5FLXL 3Q24A 1NUIA 3QIAA 4FP5D 3BYTB 4E2XA 2RDHA 3G4SZ 2F0PA 4NMZA 2JA7I 1R9TB 2GU2A 3CCUZ 4C3JB 1SXTA 1Z6HA 3I4MI 5KIXA 3A8IE 4GZYC 1GUGA 1K9M2 4MXUA 1BQQT 1A3UA 2B63I 3CCL1 2CQAA 3CC2Z 2VUGA 1SFOB 2L55A 2JMOA 1B50A 2Q8RE 1A3TA 1W2BY 3MVVA 1YNNC 3D6CA 2O2LD 1O80A 1KAAA 4OIKA 4OGQC 5CV5A 3CC41 1WW9A 4OL7A 4ZKCB 1YHQZ 1SNQA 3NK9A 2B2TA 4QF4A 1YIJZ 1ZYRD 2BJOA 1YJN1 3KIFA 5I2YA 1ESFA 3G7LA 3VYRA 3FVQA 2B2YA 3OOCA 4ID6A 1G2SA 5C4HA 1K8A2 1CA6A 1HPCA 3P75A 3CMA1 1RO2A 1SJED 1X3WA 4DAYA 2PPBC 4PNYA 2RT9A 2RHBA 4RS4A 2EY6A 1MI2A 4RKLA 5E3FA 3S1NB 1Y1VS 4KHZA 1EY8A 4IUNA 3FDTA 1GHJA 4PMCA 2JR6A 5EPKA 1HTPA 3SDZA 4KI0A 3NTHA 3MWYW 1W6JA 2N55A 3A56A 4YIJA 3MFGA 1AZQA 2QF7A 1WTRA 1F77A 2A6HC 2K04A 4A93B 3IX0A 3GTJI 4QCLA 1HQMC 4RGOS 3RLFA 1VQOZ 5ELDA 1TWFB 4IUPA 4A3CI 4B08A 3DWAA 1I4HA 5JJZA 3I56Z 1PZKD 3V05A 1M1K2 3U9OA 3K57A 3JAML 2IX0A 5FK9C 2F0WA 1DL6A 3PUVA 1EEFD 3ND8A 5AFWA 3CRLC 2E76C 3W3AA 4CJ2C 3CCV1 2K32A 4TSSA 2NYZD 1CM9A 2Y0SA 1VQN1 3LX0A 5IT9L 3R8BA 3H09A 4KMUC 2NN6H 5T64A 5KRUA 2XWJB 3I73A 3HRZC 1S5ED 3N52A 3JAMb 4TKOB 2WP8J 4L63B 3CRKC 2DY8A 4XT3B 3TZUA 2IX3A 2EYHA 1SNPA 3BDOA 3X3MA 1RD9D 4B9XA 3ZYYX 4KY5A 1Q822 3FQQA 2EZVA 2EPBA 1FD7D 4DGZA 2Q4ZA 3CC7Z 3DWQA 2MJ8A 1I50B 2QA41 2AQ1B 4RFBA 2IPKD 3MAQA 2IZ3A 4K5XA 2NVXI 1B3AA 4V190 5D1OA 3G711 3PO3I 2K6AA 3ERQA 1X32A 3JAME 2O4HA 3KLSA 3S1QB 3NDJA 2R6GA 3DUZA 5CM2M 4IUQA 1TS5A 3TN2A 4EQPA 1HUMA 4CL1A 2SEBD 3NWTA 1TY2A 4NP5A 2XNAC 1YIT1 1CZGA 4U68A 1SNCA 3SVMA 1OXSC 1A15A 1USPB 4RHRA 3RD4A 4HTHA 1I4GA 1STNA 1M901 5IGDA 4DGLA 1EY5A 2MHVA 2TMPA 1EY7A 5D3IB 5EKLA 4CKBA 4WFN3 4KTAA 2M9VA 1VCIA 1KLGD 3LWEA 5LL6S 4A3KB 1K8MA 1H9SB 2P28A 3PO2B 4S1TA 1K83I 1VLAA 1GUSA 3PUXA 3IFUA 5KYLA 5EGTA 5EPJA 3CCM1 2IW3A 4KK7A 4K6LA 1STBA 2PZUA 5I4DA 2E2JI 1DYQA 4K5VA 4IQZA 2K03A 1Y1WI 2AUKA 2EE1A 2R6MA 1PFNA 3FEWX 3CC21 1N8R1 4NBBA 3TMEA 3HOXI 2NWGA 2QKIC 3CD6Z 1HA5A 5EBCA 4WRDA 4E33A 1CT1D 2JA5B 1LO5D 2MUYA 2RPRA 4FNFA 4MONA 1X0TA 3HKZA 3A8KE 3CCMZ 4J1MA 5HGTA 2KPIA 4BBRB 3RMHA 2B2UA 2FHTA 1QB5D 2NZ1D 2ZT9C 5CV6A 3GQBA 1QWYA 1HA6A 1QNUA 1DOKA 4OO1G 4KY6A 2OOXB 1SSOA 1IL8A 3VYTA 2EVBA 4LAAA 1WTXA 1VQ8Z 3C46A 1QVGZ 4X3SA 3CD61 3ND9A 1BCPC 1C48A 2EYPA 3HOVB 1Y1VB 2QR1B 1OXUA 3CCE1 3D9XA 1KNEA 2C5CA 1TWAB 3NSWA 5FLXf 1S4ZA 4RVFA 2SDFA 3MZKB 3PUYA 2HU9A 4MHEA 1QVFZ 3S1RB 2PW5A 3IF8A 5ELCA 2QDBA 4C2MB 3PIP3 1QNKA 2QREB 1S72Z 1Q3LA 4R9WA 2D9UA 3MFYA 1KDAA 5FLXE 1STAA 2E2DC 4CJ1B 2DN8A 2E2IB 1EEID 3QWUA 2NN6G 1AFPA 3CHBD 3HOVI 2VF1A 1Y8NB 1C4QA 2JS4A 1FNWA 2XRQD 2NTTA 4B9WA 2F4OA 4HMIA 5A2Qb 5JVG3 4KHVA 3J7AV 1WVLA 5ELEA 1SE2A 3ONAB 4A3II 4AYBA 1CK1A 2KEEA 5C3WA 3NHHA 4FXKC 3A54A 5C0XJ 2L12A 5CORA 4A3JI 2EYFA 2OT2A 4ME5A 2QA4Z 3SHLA 5FO8B 1RHPA 3E0JA 3T13A 4Q0FA 2F0QA 4KKUA 2NVQI 5HURA 2B8FA 1F9SA 4QMGA 4OO1I 4KD3A 1PMRA 4C1NI 1ZB8A 1EU3A 3I90A 3HOZI 1USPA 3HGBA 3GD7A 4CKCA 5IGCA 3FKIB 2X6LA 1E2ZA 4RKBA 4BY7B 4MH4A 5TSSA 1TS2A 2M2LA 4XXEA 3D8GA 5C6AA 5CMDA 3GTLB 2A5HA 4CHTB 1TU2B 2LY7A 3CQZI 1PZJD 3K5MA 2J0TD 5IODA 4H7BA 2JA6I 4L8JA 3SR1A 4QUFA 2IX1A 5C44B 1LV9A 1D6EC 1TY0A 4IZ8A 4A3BI 3QO2A 2D5DA 3HOYI 2KECA 4NFRA 2JEBI 2KVMA 2O4XA 5DEHA 2O5IC 1IKMA 1FYCA 3EEDA 2JXMB 5A2QE 5COYA 3H91A 2R92I 1PTOF 1Q90A 5IGBA 3J7AF 3S1QI 2BA0A 1QVFY 2RQXA 2L11A 5JPNC 1TWGB 4MIUA 2RIQA 3OMGA 4A3EB 2YYZA 2XSCA 4QB4A 3LNNA 3G6JB 3MC0B 1Q821 3EJIA 2F0MA 2HCIA 4ZRZA 3E5SA 1OXXK 3GTPB 5T67A 1H9RA 3CKIB 3BG3A 3GTMI 4A3LI 1SYGA 3K5OA 2B2WA 1HFGA 4HMJA 4U673 2O53A 5FO7B 5EKKA 3BG0B 2Z4HA 4S3SA 1MD2D 4A3DB 2WINB 1IW7C 1GOZA 1RKNA 5A35A 5CBAE 4C3HG 2K5RA 4N9PA 3FKII 4RGTA 4BY1B 1QJOA 4NH1C 1ILQA 3M7GA 3FRPB 2JA8I 4IFDG 2D2CC 2F0TA 1WTPA 1EY9A 1V1OA 3PO3S 1VQ81 1MBYA 3CCJZ 1GXDC 2NVYB 1VQ61 1BOSA 2A6EC 5CV8A 2ICIA 3T53B 1Q12A 2NN6I 4NOZA 3M4YA 2HDMA 3VR2A 3G6E1 3MZLB 2QLVB 1JWMD 4MN3A 1F9PA 4HSPA 2EY5A 2O5JC 2NVYI 1KC82 2QEX1 4A3FI 2HQEA 1KQSZ 3VMHA 1ILPA 1XX8A 1A2UA 3EERA 2VUMI 4KKTA 2BDNA 4HN7A 3CCJ1 1K731 3P20A 1Z01A 3S2DB 3S15I 3OW7A 2K5QA 3CU7A 2I46A 3L9AX 4NW2A 4NBHA 2F0FA 4DNTB 1EZ6A 3FQMA 3KBGA 4K2LA 4HAEA 3CXCY 3HEJA 2EOTA 2YU9I 4CKEA 1PLFA 1KQSY 1EWCA 3TP7A 2EY2A 2J4XA 1WTVA 1J8IA 3H6MA 3G71Z 1A6XA 1IKLA 1Z03A 4A3DI 3GV3A 5G3LF 4A3FB 1HXYD 2EYOA 1Z02A 3OIPA 1B9NA 2KHSA 2L9HA 4C56C 3D3RA 1VQ51 4XX2A 3I55Z 3PV0A 2X6GA 1TWAI 1K8A1 4NBEA 1I6HB 1V43A 3HOWI 2F0JA 2G9DA 3I91A 3SK8A 4HGYA 4H0LC 2W03A 1TWGI 3D4WA 4WJWA 1ZB9A 2F0OA 5BN4A 2WACA 3R3OA 4UAIA 3CCR1 1R4QB 5CV4A 1KTKA 2JA8B 3SK6A 2NVTB 2KCCA 1D1IA 1SAPA 3I4MB 4BY1I 2F0SA 4BBRI 3A8JE 1SJHD 4FF1A 1XXGA 4RVDA 4E6IA 5KGUA 2WB1B 2V4DA 2L4NA 4H13C 5C0XG 2DY7A 4KN7C 2KI7B 2GTIA 3J81b 2OZKA 1JORA 2PZWA 2JUBA 2B2YC 5CV7A 5E4WC 2LMCB 1BCPB 2RDFA 1TIID 1SNDA 3GTKB 3QB3A 2XRSD 2VXWA 4J6HA 1YHQ1 4HCEA 2KUMA 1EYAA 3N6RA 4DU9A 1G2TA 1LTTD 1EZ8A 2N88A 4Z9CB 1GUNA 1EYDA 3NBIA 4K8JA 3CCLZ 2OTLZ 5K36H 1MGSA 4XT1B 1EFID 2WAQA 1LT5D 4MRIA 2BCOA 3S16I 1HRJA 2F3WA 1T5EA 1V1PB 1C8CA 3CC4Z 3D31A 3OSOA 1VQ91 2KCNA 2SOBA 5JEAG 4RA8A 3GTQI 3IFTA 3A55A 3RZOI 3I4NB 2K28A 1RCVD 1ENFA 2W04A 1TS3A 1CZWA 3CCQZ 3D6WA 5C44I 5IT9f 2Z4IA 4CJ0B 5I6WA 1I3QI 5KNBA 3S1MB 3CQZB 3S14I 4F8MA 1IHZA 5LL6X 2L5TA 2JSOA 3HOWB 1XWEA 2PO4A 5JEAJ 3TP6A 5C0XI 1AW7A 1W6KA 2Q8IB 4C3HB 2C9OA 4IURA 4PMWA 2E2II 2ZXRA 1CA5A 5IGGA 1BCPF 3KIHA 1BCPD 1RNIA 4DNRB 1I6VC 1Z7TA 3NTKA 3CPWY 3GTMS 3EFXD 2EYJA 1ZXTA 5BN3A 1QCBD 2IJ0A 1II3A 3D4DA 3J81E 2IL8A 4DF7A 5I6YA 2YU9B 3K5NA 4XYQA 4ZYSA 5JPMC 3SK5A 4XQJA 2B2TC 2XN9C 1JOOA 1VQMZ 1KD11 2PMZB 1MSHA 5A2QL 1BUVT 5EKIA 2NTSA 2QEXZ 2KJXA 3FPPA 1VMCA 5DM63 1RO4A 4KJNA 1WIIA 3EA6A 5C3EB 2OTJZ 3U50C 3VYUA 3R93A 4QTTA 1M8AA 2K1BA 1FNUA 3VMGA 3GTJB 1SMYD 4PQXA 3H3VC 4DK0A 1QYPA 1YNJC 2QKDA 4DAPA 4BWGB 1IYUA 2A6HD 2KA7A 3HG9A 3IAYA 3IKJA 1JOQA 1YJ9Z 1QF8A 5D14A 1AEXA 4Y7NB 2PW7A 1NP6A 4R8NA 3I8ZA 1KDCA 1LLRD 1QG7A 1TVXA 1WD0A 2A68C 5G3LD 2EYLA 1YI21 4TQUS 3S2HI 4RVHA 3QG1A 4DAVA 5KNDA 3AMUA 5CR3A 3PO2I 4C1NK 4F88A 2F0IA 1I3QB 3T16A 3J81L 3GTPI 4HCSA 1VQ41 3NPPA 3M85A 4HH4A 1WCMI 2AQ2B 4IFDI 3RZOB 2LKVA 1TFIA 1H9JA 1DONA 4ODGA 3J7A4 3SXHA 4FYDA 3SEBA 4TRDA 2LS01 4RGMA 4O1NA 1CI3M 2R61A 1H9KA 2B2VA 2M6NA 2X69A 3R2IA 2XVSA 3ITPA 3HOXB 3CME1 1SFOI 1XYIA 1N8R2 1SBBB 3T51B 2R92B 3HZXA 1VQ4Z 1EIGA 1NR2A 1I50I 2HDLA 2MPMA 1LTRD 2WV6D 5C4JI 4O42A 1R9TI 2VNUD 1J9OA 2JA7B 5EJWA 2F0LA 3TDQA 4A3BB 5IP7I 4NDXA 1VQLZ 4DK1A 4E32A 1M1K1 2BDOA 2JA6B 1X3QA 1QE6A 4C3IG 3KLSX 1JJ2Z 4ZK9B 4X3UA 2JP1A 4XQNA 5IT9E 2F4IA 5C4XB 2HCCA 2DE6A 3PMFA 1WTOA 1BXTA 5C4JB 3J81f 1KLUD 1D5MC 5IOCA 3HOZB 2NVTI 3M7NA 2EYMA 4MD7A 2MGSA 3MHBA 2BE5C 4V0BA 1D5ZC 1EWHA 4H44C 2HF1A 3MXNA 1ET9A 1LT6D 1JJ2Y 4DFAA 4DQYB 1NR4A 2NVXB 4E2WA 3WOEA 3M4OB 1XTCD 1K9M1 4HGZA 4OHJA 3EQLC 2JEAI 4RCOA 1WTQA 1Q8IA 2M48A 2OEOA 1LT3D 1T5XD 1STHA 1D5XC 1B2TA 3Q6SA 3QOJA 3HP3A 1JB3A 3K5LA 3U9SA 3NTIA 4KN4C 3S2HB 4BY7I 4ULLA 5T1IA 1EY4A 2QRDB 3HOUI 2EDGA 3KUPA 1S5DD 1RO0A 5IT9b 1HHVA 3C1EA 2G2KA 1V1PA 4NBAA 4Y7NI 3S15B 3VR6A 3K0YA 3BZDB 4F87A 2VUMB 1EQTA 2NVQB 5I9PA 1JQYD 1ML8A 1YJWZ 1YJ91 4K6DA 5T1GA 3PUZA 1Q1EA 3H0GI 3C2PA 3OPOA 3S1RI 4NKLA 2HUGA 2Q51A 1YITZ 1ZH1A 4FVMA 4DN4M 3BDLA 4K14A 4A3GB 2J6AA 4PV1C 1YI2Z 1Q812 2E9HA 5C3EI 4K8IA 4EWCA 3NP8A 1EU4A 3MEHA 2ID0A 1B1ZA 4FXDA 3MTSA 3VR5A 1HQRD 2A6ED 1PRTC 1B9MA 3L3OC 1Q1BA 3OIQA 2CW0C 2OXPA 1UEAB 2SNSA 4KV6A 3TSSA 3VYSA 3DXJC 1KC81 2VB3X 3R2TA 2B2VC 3PUWA 4IN3A 3Q22A 1VQ7Z 2H4OA 1GHKA 2WKDA 3LUSA 1PRTD 5JEAH 3OHXC 2EY1A 1OO9B 3V2TA 3CC71 3NDIA 3DWPA 1O7ZA 2MP1A 2K5WA 1Q811 1SYDA 2F03A 2XWBB 1DZ1A 2B2WC 3GTMB 4Q5VA 3AU7A 3CXCZ 1S7MA 3CCRZ 3FPUB 2PMZA 4N9TA 2JE6I 1SYBA 1ENCA 4X3KA 1VQ71 1Q7Y2 3CCU1 1SE4A 4RVGA 1JOKA 4IUTA 1U4MA 4A3EI 5M3MB 4ZUJA 3K59A 3CCQ1 1R4PB 1TQOA 3S1MI 5M9OA 1HUNA 1SYFA 2PZTA 1EY0A 1F2ZA 1VF7A 4ZAIA 2KEDA 3KBXA 1F2YA 3CCEZ 2L0CA 1W2BZ 4ILWA 2PK7A 2PQEA 3J80L 1DOMA 1SNOA 2V8IA 2F0DA 4XDXA 1YIJ1 5DNFA 2FINB 3HOYB 1KDBA 5FO9B 3NFZA 2JA5I 1Q7Y1 3NWSA 3P1HA 1NSNS 3F2UA 4WORA 4P2CB 4MD9A 2D62A 1L1OC 1PDQA 5E4XA 2F0HA 1Y1WB 4MD8A 1S5CD 2F0GA 2G9HD 1A3VA 2I07B 4DA2A 3F3FC 2F0VA 3V96A 1VQ9Z 2B2UC 5LHY1 1DM0B 1U4RA 2BOSA 4RCNA 4EGVA 3VA5A 3GTOB 4TNUA 4RV9A 4NB8A 4AYBB 4X6AI 1E2WA 3I70A 4M8AA 4QUCA 1P9NA 1O7YA 1VQ6Z 3GTOI 1CQVA 2OTJ1 3I07A 1D2BA 1PTOC 1U4LA 2SNMA 4XTCS 1YUAA 4A3JB 4CBVA 1LTAD 1GUOA 2PYKA 3TZDA 2EXZA 2F0EA 4IUVA 1BF4A 4NBDA 3MA2B 2F1MA 5KEEA 3I4LA 4A3IB 5EBDA 3S9WA 5JVH3 2CVRA 2KOLA 2V8JA 3IL8A 1BNZA 3RZDI 5FKAC 2R3ZA 1SEBD 5ELFA 1HFNA 1I4XA 3VB9A 1IYVA 2Y0SB 1LT4D 1G6ZA 1AP0A 5CGKA 1I6HI 5IIFA 1ESRA 1TWFI 1EL0A 1EOTA 4NBCA 3URYA 1G91A 3VR3A 1CFMA 2QILA 4F7XA 3H94A 3UI2A 5I9OA 1GUWA 4L6TB 3C3LA 5D65A 3TP5A 3J80b 4BS9A 2EGTA 3K7AB 4RWSC 1ZKOA 4BA1I 1LTSD 3BS1A 4A3MI 2EJGC 3BYYB 1JCKB 2K5DA 2F0KA 2PCFB 3OW2Y 1I4PA 4IUUA 2TSSA 2NBFA 1Q861 2DE5A 2Z8LA 1TR5A 4RH6A 2A69C 5T6BA 1JR0D 2FMMA 1Y1VI 3S2DI 4OO1H 1RDPD 1VMPA 3QJYA 1PRTB 1FNVA 3HKZB 1B44D 1H9SA 5C5MA 2BE5D 2OF1A 3MZ5A 2PM9A 1ML0D 3J80f 1BBXC 1ICWA 1MSGA 2K7VA 2R7ZI 3TE5B 1S5BD 1DCZA 1G8ZD 3GTGI 4IALA 1WD1A 5ISRA 1UNSA 3K6OA 3OMCA 2GTHA 4A93I 3I3CA 2WKCA 1Y8PB 1KABA 2H85A 2OTL1 4ZQ3A 2PNRC 5LL6f 2F0UA 1VQPZ 1PRTF 4C3IB 4I65A 5EQ0A 4RHSA 4EQNA 2VB2X 2GA4B 1S5FD 4KJOA 3K58A 1WTWA 2FMCA 5ELBA 1PTOH 2AKLA 1N2FA 1SYEA 4A3GI 1FR3A 3DM1A 2E2JB 1RTOA 4RGNA 3OWEB 1K732 1X3ZA 1DD2A 3E6ZX 1LTID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJW A;  2BJO A;  1AZP A;  2HCI A;  3G7L A;  5IP7 I;  1BO0 A;  3ESW A;  4A3K I;  2F4M A;  3GTM I;  3S17 I;  4A3L I;  4NBG A;  2B2Y A;  2B2W A;  1X3Q A;  1HFG A;  1QE6 A;  1G2S A;  1TWH I;  2J7Z A;  4ZK9 B;  4X3U A;  4HED A;  2JP1 A;  1CA6 A;  5CBA E;  2K5R A;  2DE6 A;  2HCC A;  1WTO A;  1X3W A;  3FKI I;  1MI2 A;  2NVT I;  1ILQ A;  1Y1V S;  2MGS A;  2JA8 I;  3FDT A;  2JR6 A;  5EPK A;  1WTP A;  3MWY W;  3PO3 S;  2HF1 A;  2N55 A;  1AZQ A;  1WTR A;  1NR4 A;  2K04 A;  1F9Q A;  3GTJ I;  1E0B A;  4R8I A;  4NOZ A;  4IUP A;  2HDM A;  1WTQ A;  4A3C I;  5JJZ A;  4MN3 A;  1F9P A;  2NVY I;  1DL6 A;  4A3F I;  1B2T A;  3Q6S A;  3VMH A;  3HP3 A;  3GV6 A;  3GTL I;  1XX8 A;  3EER A;  5AFW A;  2VUM I;  1B4O A;  1ILP A;  2BDN A;  4CJ2 C;  1ROD A;  3S15 I;  2NYZ D;  2K01 A;  1CM9 A;  4BY7 I;  5T1I A;  4NW2 A;  4NBH A;  3HOU I;  3KUP A;  4NBF A;  1HHV A;  4HAE A;  3N52 A;  2EOT A;  2YU9 I;  5C4X I;  1PLF A;  4NBA A;  4Y7N I;  1J8I A;  1WTV A;  1IKL A;  4A3D I;  1LQL A;  2DY8 A;  1EQT A;  2FJ2 A;  1RJT A;  4XT3 B;  3GV3 A;  1ML8 A;  1U4P A;  5T1G A;  4HSV A;  4ZKB B;  3H0G I;  3S1R I;  2HUG A;  2L9H A;  2L1B A;  1NCV A;  4XX2 A;  1X3P A;  2EPB A;  4DN4 M;  2X6G A;  2Q8T A;  1KNA A;  1TWA I;  4NBE A;  3HOW I;  2J6A A;  2MJ8 A;  3I91 A;  5C3E I;  1TWG I;  2NVX I;  1B3A A;  3MTS A;  1ZB9 A;  3PO3 I;  4OIJ A;  1X32 A;  2E2H I;  4UAI A;  5CM2 M;  4IUQ A;  4BBS I;  3TN2 A;  2B2V C;  1HUM A;  3S1N I;  1SAP A;  4BY1 I;  4BBR I;  3LUS A;  4U68 A;  3SVM A;  1A15 A;  1USP B;  2JYO A;  1PFM A;  2L4N A;  2DY7 A;  1O7Z A;  2MP1 A;  3LWE A;  3IFD A;  1DZ1 A;  2B2W C;  2B2Y C;  4QTU A;  3GKQ A;  1K83 I;  1VLA A;  3FPU B;  5E4W C;  1DOL A;  5EPJ A;  3DEO A;  2RBL A;  5EPL A;  2VXW A;  4X3K A;  1RTN A;  2KUM A;  3H3V J;  2R93 I;  2E2J I;  4RAU C;  1G2T A;  4IUT A;  1U4M A;  1RLY A;  4A3E I;  2N88 A;  2K03 A;  1Y1W I;  2EE1 A;  1PFN A;  4NBB A;  3S1M I;  1MGS A;  1HUN A;  3HOX I;  4XT1 B;  2NWG A;  2K05 A;  4ZAI A;  2KED A;  3KBX A;  2RSN A;  3S16 I;  3GCF A;  1HRJ A;  2PK7 A;  4X3T A;  1DOM A;  1C8C A;  2KPI A;  4RA8 A;  4XDX A;  2B2U A;  2FHT A;  5DNF A;  2NZ1 D;  3GTQ I;  2FIN B;  3RZO I;  2JA5 I;  1JE4 A;  1HA6 A;  2K28 A;  2XIW A;  1DOK A;  3F2U A;  1SSO A;  3D6W A;  1IL8 A;  5C44 I;  1WTX A;  4CJ0 B;  1I3Q I;  1L1O C;  1JIC A;  4X3S A;  2RA4 A;  1PDQ A;  5E4X A;  3S14 I;  5IP9 I;  1KNE A;  3VMI A;  3DEP A;  4IUR A;  3Q87 A;  5CBE E;  2E2I I;  1CA5 A;  1S4Z A;  2SDF A;  1SDF A;  2B2U C;  2FFK B;  1U4R A;  1F2L A;  4MHE A;  4NB8 A;  3K7A I;  1B53 A;  4X6A I;  3GTM S;  4LMQ D;  4Y52 I;  4BXX I;  1QNK A;  1ZXT A;  4QUC A;  1PFB A;  1Q3L A;  1O7Y A;  4R9W A;  2D9U A;  3GTO I;  3I07 A;  1U4L A;  2IL8 A;  1YUA A;  3M3Y I;  1F9R A;  4CJ1 B;  3TZD A;  4IUV A;  1BF4 A;  4NBD A;  1TWC I;  2B2T C;  3HOV I;  2H1E A;  1MSH A;  2CVR A;  2JS4 A;  2KOL A;  5EKI A;  3IL8 A;  1BNZ A;  3RZD I;  1VMC A;  2R3Z A;  2F4O A;  1HFN A;  1WVL A;  1RO4 A;  3VB9 A;  3I4N I;  3ONA B;  4A3I I;  3U50 C;  1G6Z A;  1AP0 A;  3R93 A;  2KEE A;  1I6H I;  1ESR A;  4QTT A;  1TWF I;  1EL0 A;  1EOT A;  1M8A A;  4NBC A;  2L12 A;  1NAP A;  5COR A;  2K1B A;  4A3J I;  3VMG A;  1G91 A;  3M4O I;  1QYP A;  4NB9 A;  1RHP A;  3UI2 A;  2DE7 A;  1GUW A;  5D65 A;  2NVQ I;  4RWS C;  5D14 A;  1F9S A;  4A3M I;  1EIH A;  1ZB8 A;  4ZLT F;  3I90 A;  3HOZ I;  3I8Z A;  4IUU A;  1USP A;  1QG7 A;  2DE5 A;  1TVX A;  1WD0 A;  5FLM I;  2X6L A;  2RVL A;  4MH4 A;  3GTK I;  3P7J A;  3S2H I;  2M2L A;  2FMM A;  1PFT A;  1Y1V I;  3S2D I;  1VMP A;  5CMD A;  2JNY A;  2P3Y A;  3PO2 I;  2RSO A;  3CQZ I;  2JA6 I;  4QUF A;  1LV9 A;  3GTP I;  4HCS A;  1ML0 D;  1BBX C;  1NUI A;  4A3B I;  1ICW A;  1WCM I;  3QO2 A;  1MSG A;  3HOY I;  2R7Z I;  2KEC A;  1TFI A;  2JA7 I;  1DON A;  2KVM A;  1IKM A;  3GTG I;  3I4M I;  1WD1 A;  5COY A;  3H91 A;  4A93 I;  2R92 I;  3I3C A;  2B2V A;  2X69 A;  2B63 I;  3S1Q I;  1B50 A;  1SFO I;  1XYI A;  2Q8R E;  2L11 A;  5EQ0 A;  1WTW A;  1O80 A;  1EIG A;  1NR2 A;  4OIK A;  1I50 I;  2AKL A;  1N2F A;  2HDL A;  1WW9 A;  2MPM A;  4ZKC B;  4A3G I;  3DM1 A;  1RTO A;  1X3Z A;  5C4J I;  2B2T A;  4O42 A;  1R9T I;  1J9O A; 
#chains in the Genus database with same CATH topology
 4YHH Q;  3RUZ A;  2A74 C;  1PYB A;  3S1R H;  1AZP A;  2QCP X;  3J80 c;  1BO0 A;  1K83 B;  3ESW A;  5FLX b;  3H0G B;  5J22 A;  4DV5 L;  4A3K I;  2F4M A;  2JIQ A;  3S17 I;  1ENA A;  4NBG A;  1PH6 A;  5LMN L;  1OXT A;  2AWN A;  4JW0 A;  4A3F G;  1JC7 A;  4KKS A;  3PO3 H;  2DNC A;  1TWH I;  2B63 H;  2J7Z A;  4WJ4 A;  4HED A;  1UAP A;  3SK4 A;  2BH2 A;  4ZUI A;  3D2L A;  2CHB D;  2E2J H;  1CQF A;  2E2I H;  3KLR A;  1VQK Z;  5IGE A;  1M4V A;  1EQV A;  4DV3 Q;  2OOY B;  4HR7 B;  3I56 1;  2DNE A;  3HOU B;  2ZXO A;  1R9T H;  1Q86 2;  1ASY A;  2A19 A;  2YTV A;  3D4R A;  4P73 A;  3CPW Z;  1BR9 A;  3CPW A;  5K36 G;  1LAB A;  5D3D A;  2BA1 A;  1DGS A;  4KD4 A;  4XYO A;  2HIV A;  2F0N A;  1EYC A;  1L1O B;  1JMC A;  2E2H B;  2ZXP A;  3PO3 B;  4B3S L;  1CHP D;  1ZYR C;  1NY4 A;  3T1Y L;  1QIL A;  1PH9 A;  2B63 B;  1VS0 A;  5M5X B;  2E74 C;  4YY3 L;  3A7A B;  1QVG Y;  1F9Q A;  2JA8 G;  2K14 A;  4IJH A;  4UP8 A;  1TWA H;  5DM7 3;  1E0B A;  5A2Q f;  4R8I A;  2YAD A;  3PIO 3;  1TWC H;  1IL2 A;  1A2T A;  1VQK 1;  3KK7 A;  3ERO A;  2L15 A;  5KNC A;  4B3T L;  4QIW E;  4IFD H;  1YJW 1;  2IT1 A;  2LIY A;  4JI4 Q;  2EJM A;  2K33 A;  2EJF C;  5JOB A;  3BVG A;  4X6A H;  1S3O A;  4DR1 Q;  2AUJ D;  4LF4 Q;  4PMB A;  5I2X A;  3GV6 A;  3GTL I;  1S72 1;  1LTB D;  3S17 H;  3S1M H;  1B4O A;  2IHF A;  1ROD A;  3TBI B;  2B63 G;  3CP0 A;  5F2D A;  4OON A;  4FF4 A;  3I72 A;  4A3E G;  2ZAE B;  2K01 A;  1RQF A;  1H9M A;  1L0Y B;  1TWC B;  2MO0 A;  4BY1 G;  1CHQ D;  4NBF A;  3HOZ G;  2B39 A;  1BVS A;  1QOH A;  1TS4 A;  5C4X I;  1G29 1;  3G6E Z;  3ERS X;  2JQO A;  2LFU A;  1VDZ A;  1VQM 1;  5AJ3 Q;  1HZB A;  1PTO D;  1LQL A;  1UWV A;  2FJ2 A;  4G4K A;  1RJT A;  3GTM H;  1FGB D;  3RN5 A;  1DXM A;  1U4P A;  3FMC A;  1K8O A;  3S17 B;  4HSV A;  4ZKB B;  4BA2 I;  3CXC A;  1Z47 A;  2WII B;  3NE5 B;  3CCV Z;  2L1B A;  1NCV A;  3CCJ A;  4G7O C;  1LTG D;  1X3P A;  2I3C A;  4KY7 A;  3J80 E;  3H15 A;  1C0A A;  2Q8T A;  1KNA A;  3VA7 A;  4OWT B;  1Y69 U;  3AQQ A;  4DR7 L;  1YEZ A;  2QA4 A;  1JWH C;  2AWO A;  3A7L A;  3NBH A;  3J80 i;  1IW7 D;  4DXG A;  3DHQ A;  4H02 A;  3MXG A;  2LFN A;  3A0J A;  3M4Q A;  4OIJ A;  2E2H I;  2A69 D;  1HTL D;  3T4N B;  4GOP B;  1STG A;  3T4A C;  4LK1 C;  2AQ3 B;  5CC4 A;  5K5P A;  4BBS I;  3WDN A;  4A3E H;  1KRL A;  3S1N I;  3P5J B;  2JIR A;  3GTG B;  5C0X H;  1V9P A;  3RZO H;  5E1F A;  3J81 c;  1WJJ A;  2QRC B;  1XTD A;  2JYO A;  4BBR G;  4UP7 A;  1GUT A;  2R7Z B;  1PFM A;  2RKS A;  3O13 A;  3JAM f;  1PXU A;  1WCM B;  1XNR L;  1GKH A;  1TWH B;  5D1P A;  4QQB X;  2M00 A;  1NUC A;  3BDC A;  5NUC A;  1RL2 A;  1VF5 C;  3VR4 A;  3BG1 B;  1V8Q A;  5KYI A;  1VQP 1;  3IFD A;  2K3R A;  3J7Y W;  2A1A A;  4QTU A;  4IJL A;  3GKQ A;  1DOL A;  2QEJ C;  3DEO A;  2RBL A;  3GTG H;  5DAU A;  5EPL A;  4G7Z C;  1PZI D;  4DV2 L;  2R93 B;  5JAV A;  1SE3 A;  1RTN A;  2AHO B;  3C1F A;  3H3V J;  2R93 I;  4RAU C;  1QVF A;  3ULJ A;  5C5L A;  1NJI 2;  1X56 A;  1RLY A;  1GJX A;  4JOI C;  3QOL A;  2LEX A;  4IFD J;  2VQF Q;  3UDG A;  1YJN Z;  3T1H L;  4E31 A;  3CCS Z;  4UDU C;  5HY6 A;  1KQS A;  2K05 A;  5FOB B;  5AN9 F;  2RSN A;  2QDL A;  3GCF A;  2RBM A;  2A8V A;  3W2D A;  2VQE L;  1YNJ D;  2CH4 A;  4X3T A;  2Y0S G;  1ET6 A;  4CDF C;  1UE5 A;  1Y8O B;  1UE7 A;  4A76 A;  3G48 A;  2WAQ B;  3NQT A;  2LXJ A;  2B8G A;  1JE4 A;  2XIW A;  1YUK A;  1VQL 1;  1UUP A;  3CCS 1;  1SYC A;  5IYB H;  1YJW A;  3HOX H;  3PCO B;  1JWU D;  1S40 A;  3T56 B;  1JIC A;  3JC6 6;  2RA4 A;  3A74 A;  1BDO A;  3Q0A A;  1X3F A;  1DJR D;  2RDG A;  5IP9 I;  1O7L A;  3EVQ A;  2NVX H;  4YWK A;  4DV7 L;  3CMA Z;  3VMI A;  4BY1 H;  2NB0 A;  4XQQ A;  1VQO 1;  3DEP A;  3Q87 A;  3M4O H;  5CBE E;  3NUC A;  3RLO A;  2ICE C;  4EQO A;  3RNU A;  1SDF A;  5M5Y B;  4G57 A;  2FFK B;  1ASZ A;  3WOF A;  5C4Z A;  3PF5 A;  1F2L A;  1AN8 A;  3BU2 A;  5CV9 A;  4A3M B;  1K9M C;  2IWH A;  1NJI 1;  1HCZ A;  3L7Z C;  3K7A I;  1B53 A;  1YNX A;  4LMQ D;  1KD1 2;  4Y52 I;  4BXX I;  3I4O A;  1D1K A;  3OW2 Z;  1PFB A;  4O0A A;  3Q23 A;  2V8K A;  3HS0 C;  1ZEQ X;  1TT2 A;  1ONL A;  4J8Q A;  4KHP Q;  3M3Y I;  1M90 2;  1F9R A;  1KHI A;  3OWF A;  3S2H H;  1I4Q A;  1TWC I;  4I7Z C;  4FF3 A;  3CC7 A;  4E2Y A;  2F3V A;  2N8N A;  3NH8 A;  1UEB A;  3NH4 A;  1JWS D;  3MXU A;  4CGY B;  4BBS B;  2A73 B;  5C3X A;  4B3M Q;  2H1E A;  3S14 B;  5GAG C;  1CTM A;  5D1O B;  4DXF A;  4G7H C;  1PYW D;  2ASB A;  3RZD B;  5BN5 A;  3KF8 A;  1Q8K A;  2A68 D;  4E2Z A;  2KBN A;  3DMU A;  3KF6 A;  3X3N A;  3I4N I;  4FXG C;  1STY A;  2EXD A;  2K5N A;  2NVT H;  1A63 A;  1VQ5 Z;  5J39 A;  5M5W B;  3GTQ B;  5IGF A;  1VQN Z;  4JI7 L;  5CYU A;  3BVZ A;  2E5L L;  1KAW A;  1YNN D;  5H1S E;  2ENB A;  1NAP A;  1M90 C;  3MXP A;  3AB9 A;  3TP8 A;  3M3Y B;  3M4O I;  3KF8 B;  1E2V A;  1X9N A;  1WI5 A;  3F3P C;  2AKW B;  4A3G H;  4NB9 A;  5GQO A;  1PV4 A;  4JK1 C;  1EY6 A;  4K5W A;  3S16 B;  2DE7 A;  4A3F H;  3UDX A;  4M1U B;  4LJZ C;  1I4R A;  5LMN W;  4JBW A;  3GO5 A;  2WAQ E;  1RF2 D;  3KOJ A;  1PA6 A;  4QIW B;  1PTO B;  2ALY B;  2WB1 A;  2KQ3 A;  1VQP A;  3F2D A;  2BH8 A;  4L5T A;  3JAM i;  3G4S 1;  1SMY C;  1F2M A;  1OXV A;  4XIG S;  1C7Y A;  1EIH A;  1O78 A;  4ZLT F;  3VTN A;  4EVO A;  3I55 1;  4UHV A;  1L0X B;  4WJ3 M;  3HFZ B;  3MON A;  4C3J G;  5FLM I;  1SNM A;  3BVM A;  3M3Y H;  2RVL A;  4E30 A;  3GP7 A;  1STE A;  1LAC A;  3GTK I;  1TKW B;  2E75 C;  3P7J A;  2OCE A;  2I5H A;  3NH5 A;  3H0G H;  4FO2 A;  1PFT A;  3TDH B;  3NQI A;  1U9R A;  3DLL A;  2CW0 D;  3S16 H;  3NXW A;  2JNY A;  4ABN A;  2P3Y A;  2Z1C A;  4K2K A;  2RSO A;  4P72 A;  3CME Z;  5M3F B;  2IZ4 A;  4A3K G;  5J1Z A;  3SE0 A;  3D0F A;  2JA8 H;  2JA6 G;  2NUC A;  3LWU A;  4FF2 A;  3QWN A;  5FLX L;  3Q24 A;  1NUI A;  4MTK A;  3QIA A;  4DPG A;  4ALP A;  4FP5 D;  3BYT B;  4E2X A;  2RDH A;  3G4S Z;  2F0P A;  1PFS A;  4NMZ A;  2JA7 I;  4IOC A;  1R9T B;  2GU2 A;  3KYH C;  5BR8 Q;  1MIU A;  3CCU Z;  3NEL A;  4C3J B;  4B3R Q;  1PH3 A;  1SXT A;  1Z6H A;  2Z9H A;  1IBK L;  3I4M I;  2KCM A;  5KIX A;  4DV6 Q;  3A8I E;  4JCV E;  1GUG A;  1K9M 2;  3H3V H;  3U4V A;  4GZY C;  4MXU A;  1QZG A;  1BQQ T;  4LF5 Q;  2I5M X;  1A3U A;  2B63 I;  3CCL 1;  2CQA A;  3CC2 Z;  1MJC A;  2VUG A;  1SFO B;  2OTL A;  4LF8 L;  2L55 A;  5IWA Q;  4IPH A;  5M5X H;  3CQZ H;  2JMO A;  1B50 A;  4R1J A;  2Q8R E;  1A3T A;  2OTJ A;  1W2B Y;  4L5R C;  1XNR Q;  2N49 A;  3MVV A;  2VL6 A;  2LSS A;  1PH5 A;  1YNN C;  3PO2 G;  4JBM A;  3D6C A;  2O2L D;  2B3G A;  1O80 A;  1KAA A;  4OIK A;  4OGQ C;  4LFC Q;  5CV5 A;  3CC4 1;  1WW9 A;  4OL7 A;  1VQB A;  4ZKC B;  4JI3 L;  1YHQ Z;  1SNQ A;  3NK9 A;  2B2T A;  2K4K A;  4QF4 A;  2IV2 X;  1YIJ Z;  1ZYR D;  1EQQ A;  2BJO A;  4X65 Q;  3RN2 A;  1YJN 1;  1H95 A;  3KIF A;  1B70 B;  5I2Y A;  1ESF A;  3G7L A;  3VYR A;  3FVQ A;  4R4Q A;  1EFW A;  2B2Y A;  2K50 A;  4OWW B;  2JJQ A;  4DR5 Q;  3OOC A;  4ID6 A;  2Z6B A;  1G2S A;  5C4H A;  2UXC L;  1PVO A;  1YHA A;  1K8A 2;  2VS1 A;  1CA6 A;  1HPC A;  4OEL B;  3P75 A;  3CMA 1;  1Y1W H;  1RO2 A;  1SJE D;  1X3W A;  4DAY A;  5L37 A;  4PNY A;  2PPB C;  2RT9 A;  1VQE A;  2RHB A;  4RS4 A;  2EY6 A;  4GKJ Q;  2UUB L;  1SMX A;  3I4N H;  1FGU A;  1MI2 A;  1GVP A;  4RKL A;  1IBL L;  5E3F A;  3S1N B;  1Y1V S;  2HQL A;  4KHZ A;  1EY8 A;  4IUN A;  3FDT A;  1GHJ A;  4PMC A;  4CDC C;  2JR6 A;  5EPK A;  1HTP A;  3SDZ A;  4KI0 A;  3NTH A;  1VQ8 A;  3MWY W;  3DM3 A;  5C44 G;  5IYC H;  1W6J A;  2QW7 A;  1XNQ L;  1VQ6 A;  2N55 A;  3A56 A;  4YIJ A;  3K0X A;  3MFG A;  3PQI A;  2QF7 A;  1WTR A;  1F77 A;  1AZQ A;  4JI3 Q;  2A6H C;  2K04 A;  4A93 B;  3IX0 A;  3GTJ I;  4POG A;  4A3C H;  4QCL A;  1HQM C;  4RGO S;  4QY7 A;  3RLF A;  1VQO Z;  5ELD A;  1TWF B;  4IUP A;  4A3C I;  4B08 A;  3GTJ H;  5IWA L;  3DWA A;  1I4H A;  5JJZ A;  2JK8 A;  5FJ8 H;  4LF8 Q;  3S1N H;  4BBS G;  3I56 Z;  1PZK D;  3V05 A;  5LMU Q;  1M1K 2;  3U9O A;  3K57 A;  3JAM L;  2IX0 A;  5FK9 C;  2F0W A;  1DL6 A;  3PUV A;  3UDI A;  4LFA Q;  1EEF D;  3CD6 A;  3ND8 A;  2K5V A;  4P71 A;  2VPY A;  2Q2U A;  1VQI A;  5AFW A;  3CRL C;  2E76 C;  3W3A A;  3I2Z A;  3CCV 1;  4CJ2 C;  2E7Z A;  4X62 L;  2K32 A;  4TSS A;  2NYZ D;  3L2P A;  4JV5 Q;  1CM9 A;  4GN3 B;  2Y0S A;  2UU9 Q;  2HT1 A;  1VQN 1;  3LX0 A;  2H5X A;  5IT9 L;  2VY3 A;  1TWF H;  3R8B A;  2YV5 A;  3H09 A;  4KMU C;  2NN6 H;  5T64 A;  5KRU A;  1WOC A;  2XWJ B;  1GO3 E;  1WCM H;  3I73 A;  3HRZ C;  2HHH Q;  5JJL A;  1S5E D;  3N52 A;  2FXQ A;  3JAM b;  4TKO B;  2WP8 J;  4DV4 L;  1V1Q A;  4JBJ A;  4L63 B;  5GAE C;  1XNQ Q;  3CRK C;  2DY8 A;  4DAM A;  3VDY A;  4XT3 B;  5ELN A;  4LFB Q;  3TZU A;  4LUZ A;  5C3E H;  2VZA A;  2EYH A;  2IX3 A;  3OW2 A;  4IPG A;  1SNP A;  3A5Z B;  3BDO A;  1FDI A;  5IYD H;  3X3M A;  1RD9 D;  3QR8 A;  2NVY H;  1T9H A;  3ZYY X;  4B9X A;  4KY5 A;  1Q82 2;  3ULL A;  3FQQ A;  2EZV A;  2EPB A;  1FD7 D;  2V45 A;  4DGZ A;  1N9W A;  2Q4Z A;  3CC7 Z;  1QUQ B;  1XMO Q;  3DWQ A;  2MJ8 A;  1IBM L;  1I50 B;  2QA4 1;  2AQ1 B;  4DV6 L;  4RFB A;  2IPK D;  2UXC Q;  3MAQ A;  2IZ3 A;  4K5X A;  2NVX I;  1B3A A;  4V19 0;  5D1O A;  3G71 1;  1NJI C;  3PO3 I;  2K6A A;  5LMU L;  3ERQ A;  1X32 A;  3STB C;  3JAM E;  2O4H A;  2Q2H A;  3KLS A;  3CCR A;  1PH8 A;  1CKN A;  3S1Q B;  1BBW A;  2ZTC A;  2E5L Q;  3NDJ A;  2R6G A;  3DUZ A;  5CM2 M;  2PQA A;  4IUQ A;  1TS5 A;  1Q7Y C;  2CCZ A;  4POF A;  4X66 Q;  1LUZ A;  3TN2 A;  4EQP A;  1HUM A;  4CL1 A;  2SEB D;  3NWT A;  1TY2 A;  1UE1 A;  2YTX A;  4NP5 A;  2XNA C;  4HJ8 A;  1YIT 1;  1CZG A;  3CC4 A;  1YHB A;  1SNC A;  4U68 A;  1OXS C;  3SVM A;  4AQY Q;  1A15 A;  1USP B;  4RHR A;  2UUC Q;  3RD4 A;  4HTH A;  1I4G A;  1STN A;  2UUA L;  1M90 1;  5IGD A;  3HOY G;  4DGL A;  1EY5 A;  2MHV A;  2TMP A;  1Y8C A;  1CSQ A;  1EY7 A;  5D3I B;  5EKL A;  4CKB A;  4WFN 3;  4KTA A;  2M9V A;  1VCI A;  1KLG D;  5ELO A;  3LWE A;  5LL6 S;  4A3K B;  1K8M A;  1H9S B;  2P28 A;  3PO2 B;  4S1T A;  1K83 I;  1VLA A;  1GUS A;  3PUX A;  3IFU A;  5KYL A;  1IBK Q;  4C3I H;  5EGT A;  5EPJ A;  3CCM 1;  2IW3 A;  4KK7 A;  4K6L A;  1STB A;  5M5Y H;  2PZU A;  3E0E A;  1VQK A;  3TQY A;  5I4D A;  2E2J I;  4BBR H;  4OXP A;  2VPZ A;  1DYQ A;  3EBE A;  2CKZ B;  4ME3 A;  1PH4 A;  4K5V A;  3OTO L;  1K3B C;  2K03 A;  4IQZ A;  1Y1W I;  2HIX A;  2AUK A;  2EE1 A;  1HR0 L;  3PF4 A;  2R6M A;  1PFN A;  3FEW X;  3CC2 1;  1N8R 1;  4NBB A;  1YBY A;  1CKM A;  3TME A;  3HOX I;  2NWG A;  2QKI C;  3CD6 Z;  1HA5 A;  5EBC A;  4WRD A;  4E33 A;  5IP7 G;  1CT1 D;  2JA5 B;  1LO5 D;  2MUY A;  2RPR A;  1KD1 C;  4FNF A;  2CFM A;  4MON A;  1X0T A;  3HKZ A;  3A8K E;  3CCM Z;  4J1M A;  4A3J G;  5HGT A;  2KPI A;  3PGZ A;  4BBR B;  1KIX A;  1J6Q A;  3RMH A;  2B2U A;  4B3M L;  2FHT A;  4A3B H;  1QB5 D;  2NZ1 D;  2ZT9 C;  5CV6 A;  3GQB A;  1YI2 A;  3HOU H;  1QWY A;  1VQH A;  4A3I G;  1HA6 A;  3RZD H;  1QNU A;  1DOK A;  4OO1 G;  4KY6 A;  2OOX B;  1SSO A;  4GOP A;  1VQL A;  1IL8 A;  3VYT A;  2EVB A;  1Q16 A;  2K5H A;  1VQ8 Z;  4LAA A;  1WTX A;  1HNX Q;  4LF6 L;  3C46 A;  1QVG Z;  1QVG A;  4B3R L;  5GAH C;  4X3S A;  3CD6 1;  3ND9 A;  1BCP C;  1C48 A;  2EYP A;  4LF9 L;  3HOV B;  2JA5 G;  2Z0S A;  1Y1V B;  1OXU A;  2QR1 B;  2AYD A;  3CCE 1;  3D9X A;  1IYJ B;  1KNE A;  1HZ9 A;  2C5C A;  2GVB A;  1TWA B;  3NSW A;  4MNO A;  5FLX f;  1S4Z A;  4RVF A;  2SDF A;  5M3M G;  2WB1 G;  1XMQ Q;  3MZK B;  1XMQ L;  3PUY A;  2HU9 A;  4MHE A;  1QVF Z;  3S1R B;  2PW5 A;  3IF8 A;  4DR2 L;  5ELC A;  1PH2 A;  3W1B A;  2QDB A;  4C2M B;  4X64 Q;  3PIP 3;  1QNK A;  4JV5 L;  1D7Q A;  2QRE B;  1S72 Z;  1Q3L A;  1WYD A;  4R9W A;  2D9U A;  1W2B A;  3HOV H;  3MFY A;  1B8A A;  1KDA A;  5FLX E;  2G5D A;  1SR3 A;  1XPO A;  4DV3 L;  1STA A;  4AH6 A;  2E2D C;  4CJ1 B;  1K0R A;  2DN8 A;  2E2I B;  1XMO L;  2MNA A;  5IP9 H;  1EEI D;  3QWU A;  2NN6 G;  1AFP A;  3CHB D;  3HOV I;  5HGQ A;  2VF1 A;  1Y8N B;  1C4Q A;  2JS4 A;  1FNW A;  3FP9 A;  3AYH B;  4NXN L;  5LMN Q;  2XRQ D;  4C2M H;  2F4V Q;  1TXY A;  2VQE Q;  2NTT A;  4CDE C;  4B9W A;  2E2H H;  4DK6 C;  2F4O A;  4HMI A;  5A2Q b;  5JVG 3;  4KHV A;  4DV0 Q;  3J7A V;  1WVL A;  5ELE A;  1SE2 A;  2PNH A;  3ONA B;  4A3I I;  4AYB A;  5GRO A;  1CK1 A;  1GD7 A;  2KEE A;  3G6E A;  5C3W A;  3EIV A;  3NHH A;  4FXK C;  1SE8 A;  4DV7 Q;  3A54 A;  5C0X J;  3HOW H;  3K81 C;  2L12 A;  5COR A;  4A3J I;  3KF6 B;  3WWV A;  2EYF A;  2OT2 A;  4ME5 A;  2QA4 Z;  2VUM H;  3SHL A;  5FO8 B;  1X55 A;  1RHP A;  2NVQ H;  1ICF B;  3E0J A;  4HID A;  3T13 A;  4X62 Q;  5M3F G;  4EX5 A;  4Q0F A;  2F0Q A;  4KKU A;  2NVQ I;  5HUR A;  2B8F A;  4LFA L;  4YWM A;  5IYC G;  1F9S A;  4QMG A;  4A3L G;  4OO1 I;  3LGJ A;  4KD3 A;  1PMR A;  4C1N I;  1ZB8 A;  1EU3 A;  1NNX A;  3I90 A;  3HOZ I;  1USP A;  3HGB A;  3GD7 A;  3M4P A;  3CCM A;  3F2B A;  4CKC A;  5IGC A;  3FKI B;  4GLV B;  2X6L A;  1E2Z A;  4RKB A;  4BY7 B;  4MH4 A;  5TSS A;  1TS2 A;  3E3X A;  2JA7 G;  2M2L A;  1JJG A;  4XXE A;  3D8G A;  5C6A A;  2R7Z H;  5CMD A;  3GTL B;  2A5H A;  4CHT B;  4AYB G;  4NXM L;  1TU2 B;  2LY7 A;  3AFP A;  3CQZ I;  1PZJ D;  3PIP A;  2J0T D;  5IOD A;  4H7B A;  3K5M A;  2JA6 I;  1TWH H;  4L8J A;  3SR1 A;  4QUF A;  1YZ6 A;  2IX1 A;  1P8L A;  5C44 B;  4DR3 Q;  1XJV A;  2ZM6 Q;  1VQ4 A;  1LV9 A;  1D6E C;  1TY0 A;  2MO1 A;  4IZ8 A;  2UXB Q;  4A3B I;  3QO2 A;  2D5D A;  3HOY I;  1N34 Q;  2EQS A;  2KEC A;  4NFR A;  2KHI A;  4EQ5 A;  2JEB I;  2KVM A;  1SLJ A;  2O4X A;  5DEH A;  2O5I C;  1IKM A;  1FYC A;  3EED A;  1K8A C;  2JXM B;  3FKI G;  4BY7 H;  3HOY H;  4N8F A;  5A2Q E;  5COY A;  3H91 A;  2Q2I A;  2R92 I;  1PTO F;  1Q90 A;  1VQC A;  4JI5 Q;  5IGB A;  3J7A F;  3S1Q I;  2BA0 A;  1QVF Y;  2CWA A;  2RQX A;  3TRE A;  4A93 H;  2N3S A;  2L11 A;  4X64 L;  1YJ9 A;  1NBW A;  3NEM A;  4APV A;  5JPN C;  1TWG B;  1NMG A;  3IRB A;  4MIU A;  2RIQ A;  3OMG A;  4A3E B;  4LFB L;  1VQJ A;  1FVI A;  3I56 A;  4X65 L;  1X65 A;  2WB1 E;  2YYZ A;  2XSC A;  4QB4 A;  5FLM G;  5M3M H;  3LNN A;  3G6J B;  3MC0 B;  1Q82 1;  3EJI A;  2F0M A;  3L0O A;  4GLA C;  2HCI A;  4ZRZ A;  3E5S A;  3GTO H;  1OXX K;  2IHE A;  3GTP B;  3T1H Q;  5T67 A;  1H9R A;  3CKI B;  3BG3 A;  3GTM I;  4A3L I;  1SYG A;  3K5O A;  2B2W A;  1HFG A;  1M1K C;  4HMJ A;  4U67 3;  2O53 A;  4HJ9 A;  5FO7 B;  5EKK A;  3BG0 B;  2Z4H A;  2PI2 A;  4S3S A;  1MD2 D;  4A3D B;  2WIN B;  1IW7 C;  1GOZ A;  1RKN A;  2C35 B;  4DR1 L;  5A35 A;  5CBA E;  4C3H G;  2K5R A;  4DR7 Q;  1FDO A;  4YWL A;  4N9P A;  4JI4 L;  1CUK A;  1K28 A;  3FKI I;  4RGT A;  1X54 A;  4BY1 B;  1QJO A;  4NH1 C;  4A3I H;  5BR8 L;  4CDD C;  1ILQ A;  3M7G A;  4DV5 Q;  3FRP B;  2JA8 I;  1HJP A;  4IFD G;  1A0I A;  2D2C C;  2F0T A;  2ZTE A;  1WTP A;  4N8X 1;  1EY9 A;  2UXB L;  1V1O A;  3PO3 S;  1VQ8 1;  1MBY A;  3CCJ Z;  1GXD C;  5AJ3 L;  2NVY B;  1VQ6 1;  1BOS A;  1EWI A;  3KJO A;  2A6E C;  4NXM Q;  3I55 A;  4LFC L;  4JI2 Q;  3H3V I;  5CV8 A;  2ICI A;  3T53 B;  1Q12 A;  2NN6 I;  4NOZ A;  2DJF C;  3M4Y A;  4PZ8 A;  3KJP A;  2HDM A;  3VR2 A;  4GNX B;  3G6E 1;  4RMF A;  2ZJP A;  1VQ7 A;  3W1G A;  3MZL B;  2QLV B;  1JWM D;  4MN3 A;  4QGU A;  1F9P A;  2K75 A;  2D0P A;  4HSP A;  2EY5 A;  2UUB Q;  2O5J C;  3B6Y A;  2NVY I;  1KC8 2;  3S1Q H;  1BBU A;  2QEX 1;  4A3F I;  2HQE A;  1KQS Z;  1L1O A;  1EUJ A;  3VMH A;  4OWX B;  1ILP A;  1XX8 A;  1A2U A;  3EER A;  2VUM I;  4KKT A;  2GN5 A;  2BDN A;  4HN7 A;  3CCJ 1;  1K73 1;  3P20 A;  1Z01 A;  3S2D B;  3S15 I;  2WFW A;  3OW7 A;  2K5Q A;  3CU7 A;  2I46 A;  3L9A X;  3HKS A;  4NW2 A;  4NBH A;  2F0F A;  4PG3 A;  4DNT B;  1EZ6 A;  1E3P A;  4DR2 Q;  3FQM A;  3KBG A;  4PZ7 A;  5M5W H;  4K2L A;  4HAE A;  3CXC Y;  3HEJ A;  2EOT A;  2YU9 I;  4CKE A;  1PLF A;  2ZTD A;  1KQS Y;  1EWC A;  3TP7 A;  2EY2 A;  2J4X A;  1WTV A;  4JI7 Q;  1J8I A;  4B3S Q;  3H6M A;  3HOZ H;  3G71 Z;  4PZ6 A;  1A6X A;  1IKL A;  1Z03 A;  4A3D I;  4A3K H;  4JG2 A;  2PI2 E;  4DV0 L;  3GV3 A;  2CH4 W;  5G3L F;  1E22 A;  4A3F B;  1HXY D;  4DV1 L;  2EYO A;  1PH1 A;  3CPF A;  1Z02 A;  3OIP A;  3S2D H;  1B9N A;  2KHS A;  3KDF A;  2L9H A;  4C56 C;  4NXN Q;  3D3R A;  1HNX L;  1VQ5 1;  4XX2 A;  3I55 Z;  3PV0 A;  2X6G A;  4R4C A;  2HD3 A;  4JYA Q;  5FLX c;  1TWA I;  1K8A 1;  4NBE A;  1I6H B;  1N33 Q;  1V43 A;  3HOW I;  2F0J A;  2G9D A;  3I91 A;  3SK8 A;  4HGY A;  4H0L C;  2W03 A;  1TWG I;  3D4W A;  1Z9F A;  1MKH A;  4WJW A;  1ZB9 A;  4I7A A;  2AMC B;  2F0O A;  5BN4 A;  3G71 A;  2WAC A;  3PO3 G;  3R3O A;  4UAI A;  2JA5 H;  3CCR 1;  1R4Q B;  3TEH B;  2VPX A;  4DK3 C;  5CV4 A;  1KTK A;  1E1T A;  2JA8 B;  3CMA A;  3SK6 A;  2D0O A;  4DNI A;  2NVT B;  2KCC A;  1D1I A;  1SAP A;  3I4M B;  4BY1 I;  2F0S A;  3GTQ H;  4BBR I;  4DR6 Q;  1UE6 A;  3T1Y Q;  3A8J E;  1SJH D;  4FF1 A;  1XXG A;  4RVD A;  1KL9 A;  2VPW A;  4E6I A;  2WB1 B;  5KGU A;  4IOA A;  2V4D A;  2L4N A;  4H13 C;  5C0X G;  4R4T A;  2QGQ A;  2DY7 A;  4KN7 C;  2KI7 B;  1HNW L;  2GTI A;  3J81 b;  2OZK A;  1JOR A;  4QL5 A;  2PZW A;  3CAM A;  2JUB A;  4HIM A;  2B2Y C;  5CV7 A;  5E4W C;  3AFQ A;  1HR0 W;  2LMC B;  1BCP B;  2RDF A;  1TII D;  1Y1W G;  3SGI A;  3KLW A;  1SND A;  1N33 L;  3GTK B;  3QB3 A;  2XRS D;  2VXW A;  4J6H A;  1YHQ 1;  4HCE A;  2KUM A;  1B7Y B;  1D8L A;  1EYA A;  3N6R A;  4DU9 A;  1G2T A;  2JIO A;  4HJA A;  1LTT D;  1EZ8 A;  1HZA A;  2N88 A;  4Z9C B;  1EIY B;  1GUN A;  1EYD A;  4DV1 Q;  3NBI A;  3CCS A;  1QZH A;  4K8J A;  1KC8 C;  3CCL Z;  1N32 Q;  5GAD C;  2OTL Z;  5K36 H;  1MGS A;  3CC2 A;  5M3F H;  4XT1 B;  1EFI D;  1VQA A;  2WAQ A;  1LT5 D;  4MRI A;  2BCO A;  3S16 I;  3HOV G;  1HRJ A;  2F3W A;  1T5E A;  1V1P B;  4OX9 L;  4L5S A;  1VQN A;  1HR0 Q;  3GTK H;  3HOW G;  1C8C A;  3CC4 Z;  3D31 A;  3OSO A;  1VQ9 1;  2KCN A;  2SOB A;  5JEA G;  4MTN A;  4RA8 A;  3GTQ I;  3IFT A;  3A55 A;  1SIW A;  3RZO I;  3TRZ A;  1E1O A;  3I4N B;  2K28 A;  1RCV D;  1ENF A;  2W04 A;  1TS3 A;  3CME A;  1CZW A;  3CCQ Z;  3D6W A;  5C44 I;  5IT9 f;  2Z4I A;  3K7U C;  4CJ0 B;  5I6W A;  1I3Q I;  5KNB A;  3A5U A;  3S1M B;  3CQZ B;  1U5K A;  2OQ0 A;  4DR5 L;  4GOP C;  1E24 A;  3JAM c;  3S14 I;  4F8M A;  4JI8 L;  1EQR A;  1IHZ A;  2Y0S E;  5LL6 X;  1K8G A;  2L5T A;  2JSO A;  3HOW B;  1XWE A;  1PHJ A;  2PO4 A;  1N8R C;  5JEA J;  3TP6 A;  5C0X I;  1AW7 A;  1W6K A;  4R4O A;  2Q8I B;  2C9O A;  4IUR A;  4C3H B;  4PMW A;  2E2I I;  2ZXR A;  1CA5 A;  3BJU A;  2UUC L;  2NZH A;  2R7Z G;  5IGG A;  1BCP F;  3KIH A;  1A62 A;  1BCP D;  2VW9 A;  1RNI A;  4DNR B;  2CQO A;  2RHQ B;  1I6V C;  1Z7T A;  3NTK A;  3CPW Y;  3GTM S;  3ULP A;  3EFX D;  3J81 i;  2UU9 L;  2CWP A;  1G51 A;  1ZXT A;  2EYJ A;  5BN3 A;  1QCB D;  2IJ0 A;  1II3 A;  5JJI A;  4DV2 Q;  1LM0 A;  3D4D A;  3J81 E;  5C3E G;  4K0K L;  4GKK L;  2IL8 A;  4HJ7 A;  4DF7 A;  5I6Y A;  3FKI H;  2YU9 B;  4LF5 L;  4LUO A;  3K5N A;  4DR4 Q;  4XYQ A;  4ZYS A;  4DR4 L;  1VQ5 A;  2RHS B;  2B29 A;  3CF5 A;  1VQF A;  1VQO A;  5JPM C;  3SK5 A;  4XQJ A;  2B2T C;  1JB7 A;  2XN9 C;  3CW2 C;  1JOO A;  1VQM Z;  1KD1 1;  1HH2 P;  2RCN A;  1MSH A;  2PMZ B;  5A2Q L;  2ES2 A;  1X3G A;  1BUV T;  5C44 H;  5EKI A;  1EIF A;  2NTS A;  5DLQ E;  2QEX Z;  3IR7 A;  2KJX A;  3FPP A;  1LYL A;  1VMC A;  3ICE A;  5DM6 3;  1CKO A;  1RO4 A;  4KJN A;  1K3R A;  1WII A;  1Q46 A;  3EA6 A;  5C3E B;  2OTJ Z;  1Y14 B;  3U50 C;  3VYU A;  3U58 A;  3R93 A;  4GNX A;  4QTT A;  4JI6 L;  1IZ6 A;  1M8A A;  4BY7 G;  2K1B A;  1LTL A;  1FNU A;  3VMG A;  3GTJ B;  1SMY D;  4PQX A;  3H3V C;  1IBL Q;  4A3M G;  1FJG L;  1WTH A;  4DK0 A;  1QYP A;  1YNJ C;  3TS2 A;  2QKD A;  4DAP A;  1WFQ A;  4BWG B;  4Y52 H;  1IYU A;  2A6H D;  2KA7 A;  3HG9 A;  3IAY A;  3IKJ A;  2VUM G;  1X3E A;  1JOQ A;  4AYB E;  1I3Q H;  4JBK A;  1YJ9 Z;  1SRU A;  1QF8 A;  5D14 A;  1AEX A;  1Q82 C;  4Y7N B;  3I4M G;  2PW7 A;  1NP6 A;  4R8N A;  3I8Z A;  1KDC A;  1LLR D;  4UP9 A;  1QG7 A;  4A75 A;  1TVX A;  1WD0 A;  2A68 C;  4GN5 A;  1YHQ A;  5G3L D;  2EYL A;  1YI2 1;  4TQU S;  3STB D;  3S2H I;  4YHH L;  4RVH A;  3KFU A;  3CCL A;  2IY5 B;  3QG1 A;  4DAV A;  5KND A;  2ZM6 L;  3AMU A;  2XTI A;  5CR3 A;  3PO2 I;  4C1N K;  4F88 A;  1I94 Q;  2WAQ G;  2F0I A;  3H0G G;  1JJ2 A;  1I3Q B;  3T16 A;  3J81 L;  3ZJY C;  5IYD G;  3GTP I;  4HCS A;  1VQ4 1;  3NPP A;  3CCE A;  3M85 A;  4HH4 A;  1WCM I;  2AQ2 B;  4IFD I;  2EIF A;  3RZO B;  2LKV A;  1TFI A;  1H9J A;  1DON A;  4ODG A;  3J7A 4;  3SXH A;  4YCU A;  2NAP A;  1FL0 A;  4FYD A;  3SEB A;  4TRD A;  2JA7 H;  3HOU G;  2LS0 1;  4JI1 L;  4RGM A;  4O1N A;  4A3B G;  4KHP L;  1CI3 M;  1I50 H;  2R61 A;  1H9K A;  2B2V A;  2M6N A;  3OYY A;  2X69 A;  3FHW A;  3R2I A;  1VQM A;  2XVS A;  3ITP A;  4RG1 A;  3HOX B;  3CME 1;  5J3B A;  1SFO I;  1XYI A;  1N8R 2;  2JA6 H;  2UXD L;  1SBB B;  3E9H A;  3T51 B;  1FJG Q;  2R92 B;  3K7A H;  4LUV A;  3HZX A;  1VQ4 Z;  1EIG A;  1NR2 A;  2R93 H;  1I50 I;  4OX9 Q;  2HDL A;  2MPM A;  3F1Z A;  1LTR D;  3PIO A;  2WV6 D;  4DAY B;  2Q2T A;  5C4J I;  4O42 A;  1R9T I;  1RIP A;  1J9O A;  2VNU D;  2JA7 B;  2PQA B;  5EJW A;  4IPD A;  2F0L A;  3TDQ A;  4MZ9 A;  4A3B B;  5IP7 I;  4NDX A;  1VQL Z;  3S24 A;  4KLK A;  2F4V L;  4DK1 A;  4E32 A;  4HIK A;  1M1K 1;  2BDO A;  5IY0 A;  2OWO A;  1X3Q A;  2JA6 B;  1QE6 A;  5IT9 c;  1B3Q A;  3AEV A;  4LF6 Q;  2JN4 A;  4DUY L;  4C3I G;  2R92 H;  4QJF A;  3KLS X;  1JJ2 Z;  4ZK9 B;  4X3U A;  2JP1 A;  4XQN A;  5IT9 E;  2F4I A;  4J15 A;  2ZJQ A;  5C4X B;  2HCC A;  2DE6 A;  2XGT A;  3PMF A;  1Y1V H;  1WTO A;  1BXT A;  5C4J B;  3J81 f;  1JE5 A;  1KLU D;  1D5M C;  4P75 A;  5IOC A;  3HOZ B;  2NVT I;  4JC0 A;  3M7N A;  2EYM A;  3CCQ A;  4BBS H;  4MD7 A;  2MGS A;  3MHB A;  2BE5 C;  4YCV A;  4V0B A;  3TS0 A;  3I4N G;  1JJC B;  1D5Z C;  1EWH A;  4H44 C;  1MJE A;  3F2C A;  2HF1 A;  3MXN A;  1ET9 A;  1LT6 D;  2MFI A;  1JJ2 Y;  4DFA A;  1BKB A;  4DQY B;  1NR4 A;  2NVX B;  4E2W A;  3WOE A;  5C4X H;  3M4O B;  3RR5 A;  1XTC D;  3OTO Q;  1K9M 1;  1Q86 C;  5C4J H;  4HGZ A;  2E8G A;  4OHJ A;  3EQL C;  2R7D A;  1N36 L;  2JEA I;  3J81 j;  4RCO A;  1WTQ A;  4UY8 C;  1Q8I A;  4JI8 Q;  2M48 A;  4P74 A;  4YCW A;  2OEO A;  1LT3 D;  1T5X D;  3MEF A;  4LNQ A;  4JI1 Q;  1STH A;  1D5X C;  1B2T A;  3Q6S A;  4BXX H;  3F8T A;  3K80 C;  3QOJ A;  3MXN B;  1A8V A;  3HP3 A;  1E7Z A;  1JB3 A;  3K5L A;  3U9S A;  3ER0 A;  3NTI A;  4KN4 C;  4A3C G;  1IXR A;  3S2H B;  2YTY A;  4BY7 I;  4ULL A;  5T1I A;  1EY4 A;  2QRD B;  2KEN A;  3HOU I;  2UUA Q;  2EDG A;  3KUP A;  1S5D D;  4JI2 L;  1RO0 A;  5IT9 b;  1HHV A;  1L0W A;  3C1E A;  2G2K A;  1WZN A;  1V1P A;  4NBA A;  4Y7N I;  3M9B A;  3S15 B;  3VR6 A;  2ATW A;  3K0Y A;  1WCM G;  3BZD B;  4F87 A;  2VUM B;  1EQT A;  2NVQ B;  5I9P A;  1JQY D;  1ML8 A;  1SRO A;  1YJW Z;  1YJ9 1;  4K6D A;  5T1G A;  3PUZ A;  1Q1E A;  3H0G I;  1YVC A;  3C2P A;  3OPO A;  3S1R I;  4R4I A;  4NKL A;  2HUG A;  2Q51 A;  1YIT Z;  1ZH1 A;  2DGY A;  4FVM A;  4GS3 A;  4DN4 M;  1VQG A;  1IBM Q;  3BDL A;  2V3V A;  1PYS B;  4K14 A;  3UE1 A;  4A3G B;  5IE8 A;  2J6A A;  4PV1 C;  1YI2 Z;  2F3I A;  1Q81 2;  3S15 H;  1U0L A;  2E9H A;  5C3E I;  4K8I A;  4EWC A;  3NP8 A;  1K73 C;  1EU4 A;  3KDF B;  3MEH A;  2ID0 A;  3J7A 5;  3HKZ G;  1B1Z A;  4FXD A;  3MTS A;  3VR5 A;  1HQR D;  2A6E D;  4DKA C;  1PRT C;  1B9M A;  3L3O C;  1Q1B A;  2NZO A;  4O2D A;  4BXX G;  2JIM A;  4GN4 B;  4DUZ Q;  3OIQ A;  1NTG A;  2CW0 C;  2OXP A;  3GDE A;  4JI6 Q;  1UEA B;  2SNS A;  4KV6 A;  3TSS A;  3VYS A;  3DXJ C;  1KC8 1;  2VB3 X;  3U4Z A;  3R2T A;  1P16 A;  2B2V C;  4HJ5 A;  2I0Q A;  2OQK A;  3PUW A;  4IN3 A;  3Q22 A;  1VQ7 Z;  2H4O A;  1GHK A;  2WKD A;  4JI0 Q;  3LUS A;  1PRT D;  2HHH L;  5JEA H;  2LXK A;  3OHX C;  5FLM H;  4A3G G;  2EY1 A;  1OO9 B;  4JVZ A;  3V2T A;  1GM5 A;  3CC7 1;  1C9O A;  3NDI A;  2DJG C;  5IP9 G;  2UXD Q;  3BZC A;  4GLX A;  1Q81 C;  4AIM A;  3DWP A;  1O7Z A;  2MP1 A;  2K5W A;  1Q81 1;  1SYD A;  2F03 A;  2XWB B;  4LF4 L;  1DZ1 A;  2B2W C;  3GTM B;  4Q5V A;  3AU7 A;  3CXC Z;  1S7M A;  3CCR Z;  3FPU B;  2PMZ A;  4C3H H;  4N9T A;  2JE6 I;  4GKK Q;  2Z6K A;  4C3J H;  1XPR A;  4JYA L;  1SYB A;  1ENC A;  4X3K A;  1VQ7 1;  1Q7Y 2;  1G6P A;  3I7F A;  3CCU 1;  1SE4 A;  4RVG A;  1YIT A;  1JOK A;  4IUT A;  1U4M A;  4A3E I;  5M3M B;  1WJ2 A;  1HNZ L;  4ZUJ A;  3EN2 A;  2KCT A;  3K59 A;  1SFO H;  3CCQ 1;  1R4P B;  1TQO A;  2QEX A;  4YY3 Q;  3S1M I;  3GTL H;  5M9O A;  1HUN A;  1SYF A;  2PZT A;  3GTP H;  1EY0 A;  1F2Z A;  1VF7 A;  4ZAI A;  2KED A;  3KBX A;  3HOX G;  4DV4 Q;  2YU9 H;  2F52 A;  1F2Y A;  3CCE Z;  2L0C A;  1CKN B;  1W2B Z;  4DUZ L;  4ILW A;  2PK7 A;  2PQE A;  3J80 L;  3G4S A;  4HIO A;  4A3D H;  1DOM A;  1SNO A;  2VQF L;  1OTC A;  3HKZ E;  2V8I A;  2F0D A;  1NMF A;  4XDX A;  1YIJ 1;  5DNF A;  2K52 A;  2FIN B;  3HOY B;  1KDB A;  5FO9 B;  4UPA A;  3UDF A;  3NFZ A;  4LWC A;  5JJK A;  2JA5 I;  3PSI A;  4JI5 L;  1Q7Y 1;  1JT8 A;  3F2U A;  3NWS A;  1NSN S;  3P1H A;  1KXL A;  4WOR A;  4P2C B;  4MD9 A;  2ZJR A;  2D62 A;  4K0K Q;  1L1O C;  1PDQ A;  5E4X A;  2F0H A;  1Y1W B;  4MD8 A;  1EOV A;  1AE2 A;  1S5C D;  2F0G A;  1TWG H;  2G9H D;  1A3V A;  2I07 B;  4DA2 A;  3F3F C;  2F0V A;  1MHW C;  4A3J H;  3E9I A;  3V96 A;  2N78 A;  1VQ9 Z;  2B2U C;  5LHY 1;  1SN8 A;  1DM0 B;  1U4R A;  4JI0 L;  2BOS A;  4RCN A;  4EGV A;  1AE3 A;  1W3S A;  1I94 L;  2JA9 A;  3VA5 A;  3GTO B;  4TNU A;  4RV9 A;  4NB8 A;  4AYB B;  4X6A I;  4NPS A;  1KRT A;  4TVA B;  1E2W A;  3I70 A;  3RLN A;  2P5Z X;  1O7I A;  4M8A A;  4QUC A;  1P9N A;  1QUQ A;  4Y7N H;  1O7Y A;  1VQ6 Z;  3GTO I;  1CQV A;  2OTJ 1;  3I07 A;  1D2B A;  1PTO C;  2RCF A;  1U4L A;  2SNM A;  4GKJ L;  4XTC S;  1YUA A;  1X6O A;  4A3J B;  4CBV A;  1LTA D;  1GUO A;  2PYK A;  3TZD A;  2EXZ A;  2F0E A;  4IUV A;  1BF4 A;  4NBD A;  3MA2 B;  2F1M A;  5KEE A;  3I4L A;  4B3T Q;  4A3I B;  5EBD A;  3S9W A;  4IO9 A;  2RF4 A;  5JVH 3;  1VQD A;  2CVR A;  2KOL A;  1YJN A;  5E7N A;  1N36 Q;  2V8J A;  1QVC A;  4NB3 A;  3IL8 A;  1BNZ A;  3RZD I;  5FKA C;  1L2F A;  2R3Z A;  1SEB D;  5ELF A;  1HFN A;  1K0S A;  1I4X A;  2R92 G;  3VB9 A;  1IYV A;  2JIP A;  2Y0S B;  1LT4 D;  1G6Z A;  1AP0 A;  5CGK A;  1I6H I;  5IIF A;  1ESR A;  1TWF I;  5FJ8 G;  1EL0 A;  1N32 L;  1EOT A;  4NBC A;  3URY A;  2GVA A;  1EYG A;  1G91 A;  4GNX C;  1HNZ Q;  3VR3 A;  1I6H H;  1CFM A;  2QIL A;  4F7X A;  3H94 A;  3UI2 A;  5I9O A;  1GUW A;  4L6T B;  3C3L A;  5D65 A;  3TP5 A;  4A3L H;  2DUD A;  4A3M H;  2MQH A;  3J80 b;  1S72 A;  4BS9 A;  2V1C C;  2EGT A;  3K7A B;  4RWS C;  1ZKO A;  4BA1 I;  5IP7 H;  1LTS D;  3BS1 A;  4JPB W;  4A3M I;  2EJG C;  1Y1V G;  3BYY B;  4DUY Q;  1JCK B;  2K5D A;  1VQ9 A;  2F0K A;  2PCF B;  3OW2 Y;  1I4P A;  2I5L X;  4IUU A;  2TSS A;  2NBF A;  1Q86 1;  2DE5 A;  2Z8L A;  5EAY A;  1QXF A;  1N34 L;  3I4M H;  1HZC A;  1TR5 A;  4RH6 A;  2A69 C;  3CCU A;  1XPU A;  4IPC A;  5T6B A;  1JR0 D;  2FMM A;  1Y1V I;  3S2D I;  4OO1 H;  1RDP D;  1VMP A;  2Z6K C;  3QJY A;  4DR3 L;  1J5E Q;  4LF7 Q;  5IYB G;  2PMZ E;  1PRT B;  1FNV A;  3HKZ B;  1B44 D;  1H9S A;  3S14 H;  3K8A A;  5C5M A;  2BE5 D;  2OF1 A;  3MZ5 A;  1KRS A;  3NBH B;  2PM9 A;  1ML0 D;  4L5Q A;  3J80 f;  1BBX C;  1ICW A;  4LW1 A;  4A3D G;  1NE3 A;  3CCV A;  1AA6 A;  1MSG A;  2K7V A;  2R7Z I;  3TE5 B;  4LF9 Q;  3Q8D A;  2R7F A;  1S5B D;  3NEN A;  1DCZ A;  1G8Z D;  3GTG I;  3BZK A;  4IAL A;  1WD1 A;  5ISR A;  1UNS A;  3K6O A;  1YIJ A;  3OMC A;  3UE0 A;  2GTH A;  4A93 I;  3I3C A;  1Y8P B;  2WKC A;  1KAB A;  2H85 A;  2OTL 1;  1K83 H;  1CSP A;  1AH9 A;  4OEM B;  4ZQ3 A;  3PO2 H;  1HNW Q;  2PNR C;  5LL6 f;  2F0U A;  1VQP Z;  1PRT F;  4C3I B;  4I65 A;  5EQ0 A;  4RHS A;  4EQN A;  2VB2 X;  2GA4 B;  4A4I A;  1S5F D;  4KJO A;  4ZCK A;  3K58 A;  1WTW A;  3W5O A;  4A93 G;  2FMC A;  5ELB A;  1PTO H;  2AKL A;  5C4X G;  4AQY L;  1N2F A;  1I5F A;  3J7Z C;  4DR6 L;  2KHJ A;  4JOI A;  1SYE A;  4A3G I;  1FR3 A;  3DM1 A;  2E2J B;  1RTO A;  4RGN A;  1PH7 A;  4FDB A;  1K73 2;  3OWE B;  1X3Z A;  1J5E L;  4LF7 L;  1DD2 A;  3E6Z X;  2R93 G;  4X66 L;  1LTI D; 
#chains in the Genus database with same CATH homology
 3RUZ A;  2A74 C;  1AZP A;  2QCP X;  1BO0 A;  1K83 B;  3ESW A;  5FLX b;  3H0G B;  5J22 A;  4A3K I;  2F4M A;  3S17 I;  1ENA A;  4NBG A;  1OXT A;  2AWN A;  1JC7 A;  4KKS A;  2DNC A;  1TWH I;  2J7Z A;  4HED A;  1UAP A;  3SK4 A;  4ZUI A;  2CHB D;  1CQF A;  3KLR A;  1VQK Z;  5IGE A;  1M4V A;  1EQV A;  2OOY B;  4HR7 B;  3I56 1;  2DNE A;  3HOU B;  2ZXO A;  1Q86 2;  3D4R A;  5K36 G;  3CPW Z;  1BR9 A;  1LAB A;  5D3D A;  2BA1 A;  4KD4 A;  4XYO A;  2F0N A;  1EYC A;  2E2H B;  2ZXP A;  3PO3 B;  1CHP D;  1ZYR C;  1QIL A;  2B63 B;  5M5X B;  2E74 C;  3A7A B;  1QVG Y;  1F9Q A;  5DM7 3;  1E0B A;  5A2Q f;  4R8I A;  2YAD A;  3PIO 3;  1A2T A;  1VQK 1;  3KK7 A;  3ERO A;  5KNC A;  4IFD H;  1YJW 1;  2IT1 A;  2LIY A;  2EJM A;  2K33 A;  2EJF C;  5JOB A;  3BVG A;  2AUJ D;  4PMB A;  5I2X A;  3GV6 A;  3GTL I;  1S72 1;  1LTB D;  1B4O A;  1ROD A;  3TBI B;  5F2D A;  4FF4 A;  3I72 A;  2ZAE B;  2K01 A;  1RQF A;  1H9M A;  1L0Y B;  1TWC B;  1CHQ D;  4NBF A;  2B39 A;  1QOH A;  1TS4 A;  5C4X I;  1G29 1;  3G6E Z;  2LFU A;  1VDZ A;  1VQM 1;  1PTO D;  1LQL A;  2FJ2 A;  4G4K A;  1RJT A;  1FGB D;  1DXM A;  1U4P A;  3FMC A;  1K8O A;  3S17 B;  4HSV A;  4ZKB B;  4BA2 I;  3NE5 B;  1Z47 A;  2WII B;  3CCV Z;  2L1B A;  1NCV A;  4G7O C;  1LTG D;  1X3P A;  2I3C A;  4KY7 A;  3J80 E;  2Q8T A;  1KNA A;  3VA7 A;  1Y69 U;  1JWH C;  2AWO A;  3A7L A;  3NBH A;  1IW7 D;  4DXG A;  3DHQ A;  3MXG A;  2LFN A;  4OIJ A;  2E2H I;  2A69 D;  1HTL D;  3T4N B;  1STG A;  3T4A C;  4LK1 C;  2AQ3 B;  5CC4 A;  5K5P A;  4BBS I;  3WDN A;  1KRL A;  3S1N I;  3P5J B;  3GTG B;  5C0X H;  5E1F A;  2QRC B;  2JYO A;  1GUT A;  2R7Z B;  1PFM A;  2RKS A;  3O13 A;  3JAM f;  1PXU A;  1WCM B;  1TWH B;  5D1P A;  2M00 A;  1NUC A;  3BDC A;  5NUC A;  1VF5 C;  3VR4 A;  3BG1 B;  1V8Q A;  5KYI A;  1VQP 1;  3IFD A;  2K3R A;  3J7Y W;  4QTU A;  3GKQ A;  1DOL A;  2QEJ C;  3DEO A;  2RBL A;  5DAU A;  5EPL A;  4G7Z C;  1PZI D;  2R93 B;  5JAV A;  1SE3 A;  1RTN A;  3C1F A;  3H3V J;  2R93 I;  4RAU C;  5C5L A;  1NJI 2;  1RLY A;  1GJX A;  4IFD J;  3QOL A;  1YJN Z;  4E31 A;  3CCS Z;  4UDU C;  2K05 A;  5FOB B;  5AN9 F;  2RSN A;  3GCF A;  2RBM A;  3W2D A;  1YNJ D;  4X3T A;  1ET6 A;  1Y8O B;  2WAQ B;  3NQT A;  2B8G A;  1JE4 A;  2XIW A;  1YUK A;  1VQL 1;  1UUP A;  3CCS 1;  1SYC A;  1JWU D;  3T56 B;  1JIC A;  2RA4 A;  1BDO A;  3Q0A A;  1DJR D;  2RDG A;  5IP9 I;  1O7L A;  3EVQ A;  3CMA Z;  3VMI A;  2NB0 A;  4XQQ A;  1VQO 1;  3DEP A;  3Q87 A;  5CBE E;  3NUC A;  2ICE C;  4EQO A;  1SDF A;  5M5Y B;  4G57 A;  2FFK B;  3WOF A;  5C4Z A;  1F2L A;  1AN8 A;  5CV9 A;  4A3M B;  2IWH A;  1NJI 1;  1HCZ A;  3L7Z C;  3K7A I;  1B53 A;  4LMQ D;  1KD1 2;  4Y52 I;  4BXX I;  1D1K A;  3OW2 Z;  1PFB A;  3Q23 A;  2V8K A;  3HS0 C;  1ZEQ X;  1TT2 A;  1ONL A;  4J8Q A;  3M3Y I;  1M90 2;  1F9R A;  3OWF A;  1I4Q A;  1TWC I;  4I7Z C;  4FF3 A;  4E2Y A;  2F3V A;  3NH8 A;  3NH4 A;  1JWS D;  3MXU A;  4CGY B;  4BBS B;  2A73 B;  5C3X A;  2H1E A;  3S14 B;  1CTM A;  5D1O B;  4DXF A;  4G7H C;  1PYW D;  3RZD B;  5BN5 A;  3KF8 A;  2A68 D;  4E2Z A;  3DMU A;  3X3N A;  3I4N I;  4FXG C;  1STY A;  1VQ5 Z;  5J39 A;  5M5W B;  3GTQ B;  5IGF A;  1VQN Z;  5CYU A;  3BVZ A;  1YNN D;  2ENB A;  1NAP A;  3MXP A;  3AB9 A;  3TP8 A;  3M3Y B;  3M4O I;  1E2V A;  3F3P C;  4NB9 A;  4JK1 C;  1EY6 A;  4K5W A;  3S16 B;  2DE7 A;  4M1U B;  4LJZ C;  1I4R A;  4JBW A;  3GO5 A;  1RF2 D;  4QIW B;  1PTO B;  2KQ3 A;  2WB1 A;  3G4S 1;  1SMY C;  1F2M A;  1OXV A;  4XIG S;  1EIH A;  1O78 A;  4ZLT F;  3VTN A;  4EVO A;  3I55 1;  1L0X B;  3MON A;  4C3J G;  5FLM I;  1SNM A;  3BVM A;  2RVL A;  4E30 A;  3GP7 A;  1STE A;  1LAC A;  3GTK I;  1TKW B;  2E75 C;  3P7J A;  4FO2 A;  3NH5 A;  1PFT A;  3TDH B;  3NQI A;  1U9R A;  2CW0 D;  3NXW A;  2JNY A;  4ABN A;  2P3Y A;  2Z1C A;  4K2K A;  2RSO A;  3CME Z;  5M3F B;  2IZ4 A;  5J1Z A;  3SE0 A;  2NUC A;  3LWU A;  4FF2 A;  3QWN A;  5FLX L;  3Q24 A;  1NUI A;  3QIA A;  4FP5 D;  3BYT B;  4E2X A;  2RDH A;  3G4S Z;  2F0P A;  4NMZ A;  2JA7 I;  1R9T B;  2GU2 A;  3CCU Z;  4C3J B;  1SXT A;  1Z6H A;  3I4M I;  5KIX A;  3A8I E;  4GZY C;  1GUG A;  1K9M 2;  4MXU A;  1BQQ T;  1A3U A;  2B63 I;  3CCL 1;  2CQA A;  3CC2 Z;  2VUG A;  1SFO B;  2L55 A;  2JMO A;  1B50 A;  2Q8R E;  1A3T A;  1W2B Y;  3MVV A;  1YNN C;  3D6C A;  2O2L D;  1O80 A;  1KAA A;  4OIK A;  4OGQ C;  5CV5 A;  3CC4 1;  1WW9 A;  4OL7 A;  4ZKC B;  1YHQ Z;  1SNQ A;  3NK9 A;  2B2T A;  4QF4 A;  1YIJ Z;  1ZYR D;  2BJO A;  1YJN 1;  3KIF A;  5I2Y A;  1ESF A;  3G7L A;  3VYR A;  3FVQ A;  2B2Y A;  3OOC A;  4ID6 A;  1G2S A;  5C4H A;  1K8A 2;  1CA6 A;  1HPC A;  3P75 A;  3CMA 1;  1RO2 A;  1SJE D;  1X3W A;  4DAY A;  2PPB C;  4PNY A;  2RT9 A;  2RHB A;  4RS4 A;  2EY6 A;  1MI2 A;  4RKL A;  5E3F A;  3S1N B;  1Y1V S;  4KHZ A;  1EY8 A;  4IUN A;  3FDT A;  1GHJ A;  4PMC A;  2JR6 A;  5EPK A;  1HTP A;  3SDZ A;  4KI0 A;  3NTH A;  3MWY W;  1W6J A;  2N55 A;  3A56 A;  4YIJ A;  3MFG A;  1AZQ A;  2QF7 A;  1WTR A;  1F77 A;  2A6H C;  2K04 A;  4A93 B;  3IX0 A;  3GTJ I;  4QCL A;  1HQM C;  4RGO S;  3RLF A;  1VQO Z;  5ELD A;  1TWF B;  4IUP A;  4A3C I;  4B08 A;  3DWA A;  1I4H A;  5JJZ A;  3I56 Z;  1PZK D;  3V05 A;  1M1K 2;  3U9O A;  3K57 A;  3JAM L;  2IX0 A;  5FK9 C;  2F0W A;  1DL6 A;  3PUV A;  1EEF D;  3ND8 A;  5AFW A;  3CRL C;  2E76 C;  3W3A A;  4CJ2 C;  3CCV 1;  2K32 A;  4TSS A;  2NYZ D;  1CM9 A;  2Y0S A;  1VQN 1;  3LX0 A;  5IT9 L;  3R8B A;  3H09 A;  4KMU C;  2NN6 H;  5T64 A;  5KRU A;  2XWJ B;  3I73 A;  3HRZ C;  1S5E D;  3N52 A;  3JAM b;  4TKO B;  2WP8 J;  4L63 B;  3CRK C;  2DY8 A;  4XT3 B;  3TZU A;  2IX3 A;  2EYH A;  1SNP A;  3BDO A;  3X3M A;  1RD9 D;  4B9X A;  3ZYY X;  4KY5 A;  1Q82 2;  3FQQ A;  2EZV A;  2EPB A;  1FD7 D;  4DGZ A;  2Q4Z A;  3CC7 Z;  3DWQ A;  2MJ8 A;  1I50 B;  2QA4 1;  2AQ1 B;  4RFB A;  2IPK D;  3MAQ A;  2IZ3 A;  4K5X A;  2NVX I;  1B3A A;  4V19 0;  5D1O A;  3G71 1;  3PO3 I;  2K6A A;  3ERQ A;  1X32 A;  3JAM E;  2O4H A;  3KLS A;  3S1Q B;  3NDJ A;  2R6G A;  3DUZ A;  5CM2 M;  4IUQ A;  1TS5 A;  3TN2 A;  4EQP A;  1HUM A;  4CL1 A;  2SEB D;  3NWT A;  1TY2 A;  4NP5 A;  2XNA C;  1YIT 1;  1CZG A;  4U68 A;  1SNC A;  3SVM A;  1OXS C;  1A15 A;  1USP B;  4RHR A;  3RD4 A;  4HTH A;  1I4G A;  1STN A;  1M90 1;  5IGD A;  4DGL A;  1EY5 A;  2MHV A;  2TMP A;  1EY7 A;  5D3I B;  5EKL A;  4CKB A;  4WFN 3;  4KTA A;  2M9V A;  1VCI A;  1KLG D;  3LWE A;  5LL6 S;  4A3K B;  1K8M A;  1H9S B;  2P28 A;  3PO2 B;  4S1T A;  1K83 I;  1VLA A;  1GUS A;  3PUX A;  3IFU A;  5KYL A;  5EGT A;  5EPJ A;  3CCM 1;  2IW3 A;  4KK7 A;  4K6L A;  1STB A;  2PZU A;  5I4D A;  2E2J I;  1DYQ A;  4K5V A;  4IQZ A;  2K03 A;  1Y1W I;  2AUK A;  2EE1 A;  2R6M A;  1PFN A;  3FEW X;  3CC2 1;  1N8R 1;  4NBB A;  3TME A;  3HOX I;  2NWG A;  2QKI C;  3CD6 Z;  1HA5 A;  5EBC A;  4WRD A;  4E33 A;  1CT1 D;  2JA5 B;  1LO5 D;  2MUY A;  2RPR A;  4FNF A;  4MON A;  1X0T A;  3HKZ A;  3A8K E;  3CCM Z;  4J1M A;  5HGT A;  2KPI A;  4BBR B;  3RMH A;  2B2U A;  2FHT A;  1QB5 D;  2NZ1 D;  2ZT9 C;  5CV6 A;  3GQB A;  1QWY A;  1HA6 A;  1QNU A;  1DOK A;  4OO1 G;  4KY6 A;  2OOX B;  1SSO A;  1IL8 A;  3VYT A;  2EVB A;  4LAA A;  1WTX A;  1VQ8 Z;  3C46 A;  1QVG Z;  4X3S A;  3CD6 1;  3ND9 A;  1BCP C;  1C48 A;  2EYP A;  3HOV B;  1Y1V B;  2QR1 B;  1OXU A;  3CCE 1;  3D9X A;  1KNE A;  2C5C A;  1TWA B;  3NSW A;  5FLX f;  1S4Z A;  4RVF A;  2SDF A;  3MZK B;  3PUY A;  2HU9 A;  4MHE A;  1QVF Z;  3S1R B;  2PW5 A;  3IF8 A;  5ELC A;  2QDB A;  4C2M B;  3PIP 3;  1QNK A;  2QRE B;  1S72 Z;  1Q3L A;  4R9W A;  2D9U A;  3MFY A;  1KDA A;  5FLX E;  1STA A;  2E2D C;  4CJ1 B;  2DN8 A;  2E2I B;  1EEI D;  3QWU A;  2NN6 G;  1AFP A;  3CHB D;  3HOV I;  2VF1 A;  1Y8N B;  1C4Q A;  2JS4 A;  1FNW A;  2XRQ D;  2NTT A;  4B9W A;  2F4O A;  4HMI A;  5A2Q b;  5JVG 3;  4KHV A;  3J7A V;  1WVL A;  5ELE A;  1SE2 A;  3ONA B;  4A3I I;  4AYB A;  1CK1 A;  2KEE A;  5C3W A;  3NHH A;  4FXK C;  3A54 A;  5C0X J;  2L12 A;  5COR A;  4A3J I;  2EYF A;  2OT2 A;  4ME5 A;  2QA4 Z;  3SHL A;  5FO8 B;  1RHP A;  3E0J A;  3T13 A;  4Q0F A;  2F0Q A;  4KKU A;  2NVQ I;  5HUR A;  2B8F A;  1F9S A;  4QMG A;  4OO1 I;  4KD3 A;  1PMR A;  4C1N I;  1ZB8 A;  1EU3 A;  3I90 A;  3HOZ I;  1USP A;  3HGB A;  3GD7 A;  4CKC A;  5IGC A;  3FKI B;  2X6L A;  1E2Z A;  4RKB A;  4BY7 B;  4MH4 A;  5TSS A;  1TS2 A;  2M2L A;  4XXE A;  3D8G A;  5C6A A;  5CMD A;  3GTL B;  2A5H A;  4CHT B;  1TU2 B;  2LY7 A;  3CQZ I;  1PZJ D;  3K5M A;  2J0T D;  5IOD A;  4H7B A;  2JA6 I;  4L8J A;  3SR1 A;  4QUF A;  2IX1 A;  5C44 B;  1LV9 A;  1D6E C;  1TY0 A;  4IZ8 A;  4A3B I;  3QO2 A;  2D5D A;  3HOY I;  2KEC A;  4NFR A;  2JEB I;  2KVM A;  2O4X A;  5DEH A;  2O5I C;  1IKM A;  1FYC A;  3EED A;  2JXM B;  5A2Q E;  5COY A;  3H91 A;  2R92 I;  1PTO F;  1Q90 A;  5IGB A;  3J7A F;  3S1Q I;  2BA0 A;  1QVF Y;  2RQX A;  2L11 A;  5JPN C;  1TWG B;  4MIU A;  2RIQ A;  3OMG A;  4A3E B;  2YYZ A;  2XSC A;  4QB4 A;  3LNN A;  3G6J B;  3MC0 B;  1Q82 1;  3EJI A;  2F0M A;  2HCI A;  4ZRZ A;  3E5S A;  1OXX K;  3GTP B;  5T67 A;  1H9R A;  3CKI B;  3BG3 A;  3GTM I;  4A3L I;  1SYG A;  3K5O A;  2B2W A;  1HFG A;  4HMJ A;  4U67 3;  2O53 A;  5FO7 B;  5EKK A;  3BG0 B;  2Z4H A;  4S3S A;  1MD2 D;  4A3D B;  2WIN B;  1IW7 C;  1GOZ A;  1RKN A;  5A35 A;  5CBA E;  4C3H G;  2K5R A;  4N9P A;  3FKI I;  4RGT A;  4BY1 B;  1QJO A;  4NH1 C;  1ILQ A;  3M7G A;  3FRP B;  2JA8 I;  4IFD G;  2D2C C;  2F0T A;  1WTP A;  1EY9 A;  1V1O A;  3PO3 S;  1VQ8 1;  1MBY A;  3CCJ Z;  1GXD C;  2NVY B;  1VQ6 1;  1BOS A;  2A6E C;  5CV8 A;  2ICI A;  3T53 B;  1Q12 A;  2NN6 I;  4NOZ A;  3M4Y A;  2HDM A;  3VR2 A;  3G6E 1;  3MZL B;  2QLV B;  1JWM D;  4MN3 A;  1F9P A;  4HSP A;  2EY5 A;  2O5J C;  2NVY I;  1KC8 2;  2QEX 1;  4A3F I;  2HQE A;  1KQS Z;  3VMH A;  1ILP A;  1XX8 A;  1A2U A;  3EER A;  2VUM I;  4KKT A;  2BDN A;  4HN7 A;  3CCJ 1;  1K73 1;  3P20 A;  1Z01 A;  3S2D B;  3S15 I;  3OW7 A;  2K5Q A;  3CU7 A;  2I46 A;  3L9A X;  4NW2 A;  4NBH A;  2F0F A;  4DNT B;  1EZ6 A;  3FQM A;  3KBG A;  4K2L A;  4HAE A;  3CXC Y;  3HEJ A;  2EOT A;  2YU9 I;  4CKE A;  1PLF A;  1KQS Y;  1EWC A;  3TP7 A;  2EY2 A;  2J4X A;  1WTV A;  1J8I A;  3H6M A;  3G71 Z;  1A6X A;  1IKL A;  1Z03 A;  4A3D I;  3GV3 A;  5G3L F;  4A3F B;  1HXY D;  2EYO A;  1Z02 A;  3OIP A;  1B9N A;  2KHS A;  2L9H A;  4C56 C;  3D3R A;  1VQ5 1;  4XX2 A;  3I55 Z;  3PV0 A;  2X6G A;  1TWA I;  1K8A 1;  4NBE A;  1I6H B;  1V43 A;  3HOW I;  2F0J A;  2G9D A;  3I91 A;  3SK8 A;  4HGY A;  4H0L C;  2W03 A;  1TWG I;  3D4W A;  4WJW A;  1ZB9 A;  2F0O A;  5BN4 A;  2WAC A;  3R3O A;  4UAI A;  3CCR 1;  1R4Q B;  5CV4 A;  1KTK A;  2JA8 B;  3SK6 A;  2NVT B;  2KCC A;  1D1I A;  1SAP A;  3I4M B;  4BY1 I;  2F0S A;  4BBR I;  3A8J E;  1SJH D;  4FF1 A;  1XXG A;  4RVD A;  4E6I A;  5KGU A;  2WB1 B;  2V4D A;  2L4N A;  4H13 C;  5C0X G;  2DY7 A;  4KN7 C;  2KI7 B;  2GTI A;  3J81 b;  2OZK A;  1JOR A;  2PZW A;  2JUB A;  2B2Y C;  5CV7 A;  5E4W C;  2LMC B;  1BCP B;  2RDF A;  1TII D;  1SND A;  3GTK B;  3QB3 A;  2XRS D;  2VXW A;  4J6H A;  1YHQ 1;  4HCE A;  2KUM A;  1EYA A;  3N6R A;  4DU9 A;  1G2T A;  1LTT D;  1EZ8 A;  2N88 A;  4Z9C B;  1GUN A;  1EYD A;  3NBI A;  4K8J A;  3CCL Z;  2OTL Z;  5K36 H;  1MGS A;  4XT1 B;  1EFI D;  2WAQ A;  1LT5 D;  4MRI A;  2BCO A;  3S16 I;  1HRJ A;  2F3W A;  1T5E A;  1V1P B;  1C8C A;  3CC4 Z;  3D31 A;  3OSO A;  1VQ9 1;  2KCN A;  2SOB A;  5JEA G;  4RA8 A;  3GTQ I;  3IFT A;  3A55 A;  3RZO I;  3I4N B;  2K28 A;  1RCV D;  1ENF A;  2W04 A;  1TS3 A;  1CZW A;  3CCQ Z;  3D6W A;  5C44 I;  5IT9 f;  2Z4I A;  4CJ0 B;  5I6W A;  1I3Q I;  5KNB A;  3S1M B;  3CQZ B;  3S14 I;  4F8M A;  1IHZ A;  5LL6 X;  2L5T A;  2JSO A;  3HOW B;  1XWE A;  2PO4 A;  5JEA J;  3TP6 A;  5C0X I;  1AW7 A;  1W6K A;  2Q8I B;  4C3H B;  2C9O A;  4IUR A;  4PMW A;  2E2I I;  2ZXR A;  1CA5 A;  5IGG A;  1BCP F;  3KIH A;  1BCP D;  1RNI A;  4DNR B;  1I6V C;  1Z7T A;  3NTK A;  3CPW Y;  3GTM S;  3EFX D;  2EYJ A;  1ZXT A;  5BN3 A;  1QCB D;  2IJ0 A;  1II3 A;  3D4D A;  3J81 E;  2IL8 A;  4DF7 A;  5I6Y A;  2YU9 B;  3K5N A;  4XYQ A;  4ZYS A;  5JPM C;  3SK5 A;  4XQJ A;  2B2T C;  2XN9 C;  1JOO A;  1VQM Z;  1KD1 1;  2PMZ B;  1MSH A;  5A2Q L;  1BUV T;  5EKI A;  2NTS A;  2QEX Z;  2KJX A;  3FPP A;  1VMC A;  5DM6 3;  1RO4 A;  4KJN A;  1WII A;  3EA6 A;  5C3E B;  2OTJ Z;  3U50 C;  3VYU A;  3R93 A;  4QTT A;  1M8A A;  2K1B A;  1FNU A;  3VMG A;  3GTJ B;  1SMY D;  4PQX A;  3H3V C;  4DK0 A;  1QYP A;  1YNJ C;  2QKD A;  4DAP A;  4BWG B;  1IYU A;  2A6H D;  2KA7 A;  3HG9 A;  3IAY A;  3IKJ A;  1JOQ A;  1YJ9 Z;  1QF8 A;  5D14 A;  1AEX A;  4Y7N B;  2PW7 A;  1NP6 A;  4R8N A;  3I8Z A;  1KDC A;  1LLR D;  1QG7 A;  1TVX A;  1WD0 A;  2A68 C;  5G3L D;  2EYL A;  1YI2 1;  4TQU S;  3S2H I;  4RVH A;  3QG1 A;  4DAV A;  5KND A;  3AMU A;  5CR3 A;  3PO2 I;  4C1N K;  4F88 A;  2F0I A;  1I3Q B;  3T16 A;  3J81 L;  3GTP I;  4HCS A;  1VQ4 1;  3NPP A;  3M85 A;  4HH4 A;  1WCM I;  2AQ2 B;  4IFD I;  3RZO B;  2LKV A;  1TFI A;  1H9J A;  1DON A;  4ODG A;  3J7A 4;  3SXH A;  4FYD A;  3SEB A;  4TRD A;  2LS0 1;  4RGM A;  4O1N A;  1CI3 M;  2R61 A;  1H9K A;  2B2V A;  2M6N A;  2X69 A;  3R2I A;  2XVS A;  3ITP A;  3HOX B;  3CME 1;  1SFO I;  1XYI A;  1N8R 2;  1SBB B;  3T51 B;  2R92 B;  3HZX A;  1VQ4 Z;  1EIG A;  1NR2 A;  1I50 I;  2HDL A;  2MPM A;  1LTR D;  2WV6 D;  5C4J I;  4O42 A;  1R9T I;  2VNU D;  1J9O A;  2JA7 B;  5EJW A;  2F0L A;  3TDQ A;  4A3B B;  5IP7 I;  4NDX A;  1VQL Z;  4DK1 A;  4E32 A;  1M1K 1;  2BDO A;  2JA6 B;  1X3Q A;  1QE6 A;  4C3I G;  3KLS X;  1JJ2 Z;  4ZK9 B;  4X3U A;  2JP1 A;  4XQN A;  5IT9 E;  2F4I A;  5C4X B;  2HCC A;  2DE6 A;  3PMF A;  1WTO A;  1BXT A;  5C4J B;  3J81 f;  1KLU D;  1D5M C;  5IOC A;  3HOZ B;  2NVT I;  3M7N A;  2EYM A;  4MD7 A;  2MGS A;  3MHB A;  2BE5 C;  4V0B A;  1D5Z C;  1EWH A;  4H44 C;  2HF1 A;  3MXN A;  1ET9 A;  1LT6 D;  1JJ2 Y;  4DFA A;  4DQY B;  1NR4 A;  2NVX B;  4E2W A;  3WOE A;  3M4O B;  1XTC D;  1K9M 1;  4HGZ A;  4OHJ A;  3EQL C;  2JEA I;  4RCO A;  1WTQ A;  1Q8I A;  2M48 A;  2OEO A;  1LT3 D;  1T5X D;  1STH A;  1D5X C;  1B2T A;  3Q6S A;  3QOJ A;  3HP3 A;  1JB3 A;  3K5L A;  3U9S A;  3NTI A;  4KN4 C;  3S2H B;  4BY7 I;  4ULL A;  5T1I A;  1EY4 A;  2QRD B;  3HOU I;  2EDG A;  3KUP A;  1S5D D;  1RO0 A;  5IT9 b;  1HHV A;  3C1E A;  2G2K A;  1V1P A;  4NBA A;  4Y7N I;  3S15 B;  3VR6 A;  3K0Y A;  3BZD B;  4F87 A;  2VUM B;  1EQT A;  2NVQ B;  5I9P A;  1JQY D;  1ML8 A;  1YJW Z;  1YJ9 1;  4K6D A;  5T1G A;  3PUZ A;  1Q1E A;  3H0G I;  3C2P A;  3OPO A;  3S1R I;  4NKL A;  2HUG A;  2Q51 A;  1YIT Z;  1ZH1 A;  4FVM A;  4DN4 M;  3BDL A;  4K14 A;  4A3G B;  2J6A A;  4PV1 C;  1YI2 Z;  1Q81 2;  2E9H A;  5C3E I;  4K8I A;  4EWC A;  3NP8 A;  1EU4 A;  3MEH A;  2ID0 A;  1B1Z A;  4FXD A;  3MTS A;  3VR5 A;  1HQR D;  2A6E D;  1PRT C;  1B9M A;  3L3O C;  1Q1B A;  3OIQ A;  2CW0 C;  2OXP A;  1UEA B;  2SNS A;  4KV6 A;  3TSS A;  3VYS A;  3DXJ C;  1KC8 1;  2VB3 X;  3R2T A;  2B2V C;  3PUW A;  4IN3 A;  3Q22 A;  1VQ7 Z;  2H4O A;  1GHK A;  2WKD A;  3LUS A;  1PRT D;  5JEA H;  3OHX C;  2EY1 A;  1OO9 B;  3V2T A;  3CC7 1;  3NDI A;  3DWP A;  1O7Z A;  2MP1 A;  2K5W A;  1Q81 1;  1SYD A;  2F03 A;  2XWB B;  1DZ1 A;  2B2W C;  3GTM B;  4Q5V A;  3AU7 A;  3CXC Z;  1S7M A;  3CCR Z;  3FPU B;  2PMZ A;  4N9T A;  2JE6 I;  1SYB A;  1ENC A;  4X3K A;  1VQ7 1;  1Q7Y 2;  3CCU 1;  1SE4 A;  4RVG A;  1JOK A;  4IUT A;  1U4M A;  4A3E I;  5M3M B;  4ZUJ A;  3K59 A;  3CCQ 1;  1R4P B;  1TQO A;  3S1M I;  5M9O A;  1HUN A;  1SYF A;  2PZT A;  1EY0 A;  1F2Z A;  1VF7 A;  4ZAI A;  2KED A;  3KBX A;  1F2Y A;  3CCE Z;  2L0C A;  1W2B Z;  4ILW A;  2PK7 A;  2PQE A;  3J80 L;  1DOM A;  1SNO A;  2V8I A;  2F0D A;  4XDX A;  1YIJ 1;  5DNF A;  2FIN B;  3HOY B;  1KDB A;  5FO9 B;  3NFZ A;  2JA5 I;  1Q7Y 1;  3NWS A;  3P1H A;  1NSN S;  3F2U A;  4WOR A;  4P2C B;  4MD9 A;  2D62 A;  1L1O C;  1PDQ A;  5E4X A;  2F0H A;  1Y1W B;  4MD8 A;  1S5C D;  2F0G A;  2G9H D;  1A3V A;  2I07 B;  4DA2 A;  3F3F C;  2F0V A;  3V96 A;  1VQ9 Z;  2B2U C;  5LHY 1;  1DM0 B;  1U4R A;  2BOS A;  4RCN A;  4EGV A;  3VA5 A;  3GTO B;  4TNU A;  4RV9 A;  4NB8 A;  4AYB B;  4X6A I;  1E2W A;  3I70 A;  4M8A A;  4QUC A;  1P9N A;  1O7Y A;  1VQ6 Z;  3GTO I;  1CQV A;  2OTJ 1;  3I07 A;  1D2B A;  1PTO C;  1U4L A;  2SNM A;  4XTC S;  1YUA A;  4A3J B;  4CBV A;  1LTA D;  1GUO A;  2PYK A;  3TZD A;  2EXZ A;  2F0E A;  4IUV A;  1BF4 A;  4NBD A;  3MA2 B;  2F1M A;  5KEE A;  3I4L A;  4A3I B;  5EBD A;  3S9W A;  5JVH 3;  2CVR A;  2KOL A;  2V8J A;  3IL8 A;  1BNZ A;  3RZD I;  5FKA C;  2R3Z A;  1SEB D;  5ELF A;  1HFN A;  1I4X A;  3VB9 A;  1IYV A;  2Y0S B;  1LT4 D;  1G6Z A;  1AP0 A;  5CGK A;  1I6H I;  5IIF A;  1ESR A;  1TWF I;  1EL0 A;  1EOT A;  4NBC A;  3URY A;  1G91 A;  3VR3 A;  1CFM A;  2QIL A;  4F7X A;  3H94 A;  3UI2 A;  5I9O A;  1GUW A;  4L6T B;  3C3L A;  5D65 A;  3TP5 A;  3J80 b;  4BS9 A;  2EGT A;  3K7A B;  4RWS C;  1ZKO A;  4BA1 I;  1LTS D;  3BS1 A;  4A3M I;  2EJG C;  3BYY B;  1JCK B;  2K5D A;  2F0K A;  2PCF B;  3OW2 Y;  1I4P A;  4IUU A;  2TSS A;  2NBF A;  1Q86 1;  2DE5 A;  2Z8L A;  1TR5 A;  4RH6 A;  2A69 C;  5T6B A;  1JR0 D;  2FMM A;  1Y1V I;  3S2D I;  4OO1 H;  1RDP D;  1VMP A;  3QJY A;  1PRT B;  1FNV A;  3HKZ B;  1B44 D;  1H9S A;  5C5M A;  2BE5 D;  2OF1 A;  3MZ5 A;  2PM9 A;  1ML0 D;  3J80 f;  1BBX C;  1ICW A;  1MSG A;  2K7V A;  2R7Z I;  3TE5 B;  1S5B D;  1DCZ A;  1G8Z D;  3GTG I;  4IAL A;  1WD1 A;  5ISR A;  1UNS A;  3K6O A;  3OMC A;  2GTH A;  4A93 I;  3I3C A;  2WKC A;  1Y8P B;  1KAB A;  2H85 A;  2OTL 1;  4ZQ3 A;  2PNR C;  5LL6 f;  2F0U A;  1VQP Z;  1PRT F;  4C3I B;  4I65 A;  5EQ0 A;  4RHS A;  4EQN A;  2VB2 X;  2GA4 B;  1S5F D;  4KJO A;  3K58 A;  1WTW A;  2FMC A;  5ELB A;  1PTO H;  2AKL A;  1N2F A;  1SYE A;  4A3G I;  1FR3 A;  3DM1 A;  2E2J B;  1RTO A;  4RGN A;  3OWE B;  1K73 2;  1X3Z A;  1DD2 A;  3E6Z X;  1LTI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...