3D6WA

Lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Dna binding protein
molecule keywords Methyl-accepting/DNA response regulator
total genus 21
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d6wA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6wA01
2HCIA 4IURA 1AP0A 2RVLA 1Y1VS 2NVYI 4X3UA 4DN4M 2B2YC 2B2WA 1WCMI 3GTPI 2RA4A 1U4RA 1HFGA 4R9WA 2P3YA 2KEDA 4R8IA 2FHTA 4X3TA 1F9SA 3HOXI 3VMIA 2KOLA 5T1GA 1WTQA 2JS4A 2MGSA 1QE6A 1MSGA 2F4MA 3Q6SA 4BXXI 1DOKA 2Q8TA 5T1IA 3UI2A 2RSNA 4CJ0B 3S2DI 4MH4A 4A3CI 2JYOA 2L4NA 2N55A 4XT1B 1DOLA 2DE6A 5DNFA 2B2TA 1HRJA 2RBLA 2HDMA 4MHEA 1TWAI 4IUPA 2VXWA 1F2LA 3FDTA 3S15I 3RZOI 3I3CA 1IKMA 1EIHA 3MTSA 4X3KA 2EPBA 3HOUI 1IL8A 1RJTA 4XDXA 1EL0A 2KPIA 1SFOI 3GTMS 1X3WA 4NBGA 2HUGA 2B2WC 2E2JI 4A3BI 3DEPA 3H0GI 1CA5A 2JNYA 4IUUA 4OIKA 3GTOI 1WD1A 1QNKA 1WTRA 1PFNA 2BDNA 2X6LA 3GV3A 2KVMA 2X6GA 2KEEA 2N88A 3GTMI 1ZXTA 1J9OA 4NB8A 1HUMA 1Y1VI 3VMGA 1DZ1A 1PFTA 1IKLA 3LUSA 1ILPA 2DY8A 1F9RA 5D65A 3P7JA 3I90A 4NBAA 4LMQD 3IL8A 4RAUC 2F4OA 1MI2A 2YU9I 2R93I 4CJ2C 3PO3S 1BO0A 1WVLA 1BNZA 1NR4A 2FINB 1DOMA 3S1NI 2D9UA 5COYA 3I8ZA 3LWEA 3S17I 3S1QI 1MSHA 2KUMA 2R7ZI 4XX2A 1HHVA 1X3ZA 2K5RA 2R92I 1ML0D 5D14A 1LV9A 1G2TA 3MWYW 5IP7I 2L12A 1SAPA 3S16I 1RO4A 3ONAB 2JA5I 1NAPA 1EQTA 1ICWA 4NBFA 1U4PA 1RTOA 3N52A 1K83I 2NZ1D 1VLAA 1A15A 1QYPA 1M8AA 1I6HI 3S14I 4NW2A 2EOTA 1VMPA 2K01A 1TWFI 1TWGI 4U68A 1KNAA 1E0BA 2X69A 4ZKBB 4NB9A 1X3PA 3GTGI 2K1BA 3G7LA 3M3YI 4XT3B 5JJZA 1F9QA 1JE4A 1RLYA 1I3QI 1EOTA 2L9HA 3HOVI 3FPUB 5AFWA 3PO3I 4HCSA 1CA6A 2E2HI 5C3EI 2B2UC 1O7YA 2DE7A 1X3QA 2HCCA 3EERA 2B63I 2DY7A 1TWHI 1HFNA 1XX8A 2H1EA 3TN2A 3IFDA 2RSOA 4RA8A 1DONA 1ML8A 1G2SA 1B2TA 2JA6I 2L1BA 2E2II 4QUCA 4A3FI 2K03A 3HOWI 3U50C 3S2HI 1WTPA 1WTOA 1GUWA 1HA6A 4A3II 4RWSC 2MJ8A 3KBXA 2JP1A 5C44I 4A3KI 4UAIA 1L1OC 2PK7A 1TFIA 4ZK9B 1S4ZA 1ZB9A 1ESRA 1B53A 2NVTI 4NBHA 1RHPA 3GCFA 4A3LI 1U4LA 1USPB 3GTQI 5CBAE 2L11A 1HUNA 4NBBA 1AZQA 2DE5A 1PDQA 2NVQI 1I50I 3GTJI 1USPA 2EE1A 1B3AA 1U4MA 1PFMA 3HOZI 1N2FA 1WW9A 3QO2A 1WTWA 3PO2I 4ZLTF 3R93A 4A3DI 2K28A 1B50A 2FMMA 2BJOA 2JA8I 2MPMA 2B2VA 3Q87A 4BBSI 4A93I 1O7ZA 2R3ZA 2FJ2A 1DL6A 4NBEA 2M2LA 5EPKA 4CJ1B 1JICA 1WTVA 1NCVA 2J7ZA 2B2TC 3F2UA 1SSOA 2J6AA 3KUPA 4MN3A 4IUTA 5CORA 2NWGA 5FLMI 2KECA 3HOYI 5C4XI 4QTTA 3I4NI 1SDFA 2IL8A 1C8CA 4A3GI 1NR2A 3I91A 3K7AI 4Y52I 5E4XA 1J8IA 1EIGA 2MP1A 5IP9I 4X6AI 3DM1A 2VUMI 1PLFA 1X32A 4NOZA 1TWCI 4ZKCB 3HP3A 2JA7I 1RODA 3ESWA 3S1RI 2B2VC 4A3MI 5CMDA 3S1MI 4OIJA 2NYZD 1WD0A 2SDFA 2B2UA 1LQLA 4NBDA 3FKII 2CVRA 3DEOA 4A3EI 1AZPA 2NVXI 4QUFA 4BY7I 1QG7A 4HEDA 4HSVA 2JR6A 5EQ0A 2FFKB 1RTNA 2HF1A 3I4MI 1F9PA 3VB9A 1XYIA 3M4OI 1BF4A 1Y1WI 1WTXA 3VMHA 4HAEA 2B2YA 1B4OA 1KNEA 1G91A 5E4WC 4A3JI 4IUQA 1MGSA 5EPLA 1BBXC 3GTKI 1Q3LA 2Q8RE 1PFBA 2AKLA 1VMCA 3H3VJ 2K05A 4BBRI 1ZB8A 1O80A 1CM9A 4X3SA 2K04A 4BY1I 5EKIA 5C4JI 1TVXA 3SVMA 1NUIA 5CM2M 3H91A 3TZDA 4NBCA 4ZAIA 3GV6A 1YUAA 1R9TI 5EPJA 1G6ZA 3D6WA 1ILQA 3GKQA 4O42A 4Y7NI 3I07A 3GTLI 2HDLA 4QTUA 5EJWA 2XIWA 4IUVA 3CQZI 3RZDI 5CBEE
chains in the Genus database with same CATH superfamily
1UAPA 4R4QA 1IW7C 3VR6A 4IALA 1Y1VS 1BCPF 3IX0A 1ET6A 1HA5A 4HJ5A 2MUYA 1C48A 1TS5A 1U5KA 2B2YC 4MXUA 2N78A 2L5TA 2RA4A 1QXFA 3J81L 1U4RA 1K8GA 5J22A 2XRSD 4R9WA 3BDLA 4PMBA 2LMCB 2R92H 5F2DA 3J7AF 3EVQA 2KEDA 1RO2A 4N8FA 3HOXI 1ICFB 2KOLA 3DMUA 1EYCA 2KHIA 3E6ZX 2WKCA 4NMZA 2OXPA 2EIFA 2V45A 3CMAA 2QF7A 4YIJA 2IWHA 2F3WA 2P5ZX 3AQQA 1W2BY 3QOLA 3S2DI 1YIJZ 3TP8A 1VQPZ 4X64L 3I4LA 2RBMA 2PM9A 4MH4A 4LF6L 1S72A 3HOUH 2N55A 1PH2A 1PV4A 5KYIA 1PRTB 3S2DB 5BN4A 4BA2I 1CZGA 2B2TA 3CP0A 2LFUA 2L15A 4EGVA 1HRJA 4MHEA 3KLSA 2PZUA 5IT9E 1TWAI 4LWCA 5M3FH 1F2LA 3UDIA 5KNCA 4FO2A 3J81f 1RIPA 2E2HB 4FP5D 3JAME 3CQZB 5I6YA 1D8LA 2EPBA 4G57A 1VQOA 3CCQ1 3HOUI 1PRTC 3HOXG 4B3TL 5EKKA 1FJGQ 1TWAB 3I2ZA 1FJGL 5C0XH 1EL0A 3T4NB 5DAUA 1B3QA 1BQQT 2F0UA 2HUGA 2K5HA 5TSSA 4XTCS 3NDIA 2E2JI 4A3BI 1D5ZC 2E2JH 2JNYA 4FF2A 3IRBA 5JPMC 5IP7G 1I4GA 3PO2B 1WD1A 3H0GB 3J7AV 1U9RA 1YHQ1 1KDAA 1LT4D 4C3HB 1TY0A 1QZGA 3C46A 2BDNA 4NKLA 3GV3A 4LF8L 4KY6A 3MEHA 4A3IB 1Y8NB 2H85A 4BY1B 3CCUZ 2K50A 1TKWB 3NDJA 4HSPA 3CXCA 2Q2UA 3CD6Z 1SNDA 4BY1G 4AQYQ 3VMGA 1TY2A 3OMGA 3FKIG 1STHA 2C5CA 3KF6A 4LK1C 4F7XA 3SR1A 2DY8A 1F9RA 2F0PA 3I90A 1N33L 1VQMZ 1IYUA 1YNXA 3IL8A 1C7YA 1W2BA 4CKCA 4MD7A 1Q811 3J80i 2R93I 4TVAB 3PO3S 4DV5Q 1G8ZD 1GHKA 2HQEA 3BZKA 1UWVA 1BO0A 3PUWA 1WVLA 1TS3A 3LX0A 4GOPA 1BNZA 4JI4Q 1NR4A 1UEAB 3J81c 3CXCY 2UUBQ 3D6CA 3LWEA 3S17I 2KBNA 4RCOA 4DAYB 1TQOA 2A74C 3PQIA 3HKZA 1S5BD 3OW7A 1ML0D 1K9M1 4ZCKA 1MIUA 1PTOF 1X55A 2Z4IA 2OTL1 1LV9A 5M3MB 3T1HQ 1DYQA 3OWEB 3C1FA 4GN5A 1E2VA 2L12A 4DUZL 5LL6f 2NVYH 4NB3A 1SAPA 4MTNA 1RO4A 4DU9A 3KJOA 1LT6D 4E2YA 2ZJQA 3GTOB 2JA5I 1EEID 1EY7A 2OQ0A 4O2DA 4C3JB 1V1PB 1WIIA 3D8GA 2LY7A 1ICWA 1NNXA 4KHVA 4JI4L 5GAHC 3N52A 2PPBC 3MC0B 3K5OA 3A8IE 3NQIA 4ZUJA 3CXCZ 1VLAA 1GOZA 5C4XH 4KLKA 1EZ6A 1HTPA 3VR5A 3DWAA 1M8AA 1I4XA 1I6HI 4OEMB 4NW2A 1GUSA 5FO8B 3C2PA 4JI6Q 3F8TA 2VPYA 3S14B 3HG9A 5FLXL 1I6VC 4I7AA 2K5QA 1E0BA 2N49A 3UE0A 4TSSA 4DV0Q 3PUVA 4R4TA 2KCTA 2EY2A 1X3PA 5JOBA 4TRDA 3H3VH 5G3LF 1KD1C 3A8JE 5KNDA 4HJAA 2E2IB 3T13A 1RLYA 4C1NK 3CPWY 3FKIH 2KCMA 2VUGA 1XPUA 1HNWQ 2C9OA 2L9HA 1JWMD 1H9MA 4A3KH 1AE3A 1IBMQ 4BBRB 5LMNQ 1CA6A 1PHJA 5JVH3 4P75A 2E2HI 3EJIA 3D4RA 2F0LA 3OWFA 5GAEC 3RUZA 3IF8A 1ZYRC 5KGUA 1TWHI 4C3JG 2C35B 3M85A 3C3LA 1HFNA 1EU4A 1S72Z 4J1MA 4HCEA 2JA6B 3BU2A 1D6EC 1VQPA 2KHJA 1ML8A 5M5WH 5IWAQ 2N3SA 2L1BA 4IFDG 1MBYA 4P71A 1JJ2Z 1IBKQ 2K6AA 4AYBB 1T5XD 4A3FI 3NPPA 1Q12A 4DAVA 3FPPA 4MONA 1LTBD 3EFXD 1WTOA 2PI2E 1TWHH 2XWJB 1GVPA 2W04A 2CWAA 4A3II 4RWSC 1H95A 1KABA 5E7NA 2Y0SA 1YZ6A 2EYPA 4X65L 4GOPC 1JT8A 2F0VA 1RD9D 5AN9F 1D5XC 5C44I 1PTOH 4RV9A 1KXLA 3I72A 3D2LA 4UAIA 5C4XG 4ODGA 1R9TB 4JI0L 1Q16A 1JR0D 5IP9H 1ASYA 1EIYB 3CPFA 4YWKA 1II3A 4NBHA 4GKJQ 4Y52H 5C5LA 2OEOA 4YY3L 4A93H 2E9HA 3X3NA 3GCFA 3VA7A 1LTID 2IX0A 4DV7L 1U4LA 1Q1BA 3OHXC 2JK8A 4DR5Q 1NY4A 5J39A 4A3DH 3G4SZ 4K2LA 1TS2A 2L11A 4NBBA 3WOEA 1NJI1 4HJ8A 3L9AX 4I65A 2WAQA 3J80L 1I50I 4KY5A 1HNZL 3CCE1 1Y1WG 1U4MA 4J15A 3VR2A 1N2FA 1WTWA 3PO3H 3R93A 2K28A 4DAMA 3S1NB 2G2KA 1JJ2Y 1GUOA 2PW7A 3PIP3 3TDHB 4DV2Q 3JAML 1TS4A 4HMIA 3GTLB 3RN2A 5AJ3Q 1A2TA 4YCVA 2EY5A 4EWCA 1LO5D 4DR1L 3AB9A 1KC81 2R3ZA 3JC66 1YITZ 5ELEA 5EPKA 1FNUA 3DWPA 3PO3G 1N34Q 3CCS1 3SXHA 4HH4A 1VF5C 2CHBD 2B2TC 4HR7B 1VQDA 4CDDC 3ND9A 3VTNA 1PYSB 1XMOQ 3KUPA 3BYYB 3CW2C 2OTLA 2WKDA 1FVIA 4CDCC 1NMGA 1OXVA 1SRUA 3T53B 4DR5L 3OYYA 1YIJ1 1EQQA 2YU9H 5C4XI 3G6EZ 3CCSZ 1SDFA 5C44G 2VB3X 3P5JB 5CC4A 2EQSA 2A69C 2IL8A 4CGYB 3HOYB 4A93B 4JG2A 4PG3A 2NVXB 4DR2L 4K14A 3I4NG 4ILWA 2N8NA 4LJZC 2VQEQ 1E24A 1VQ4A 1PYWD 4HIDA 2VUMI 1PLFA 2B29A 4MIUA 5CV6A 2NN6G 3QOJA 4YWLA 2D0PA 3K5LA 3HP3A 5C44H 2QA41 1QB5D 3OW2A 1K0RA 3S1RI 3KDFB 4PQXA 5CMDA 3S17H 3S1MI 3ER0A 2EXDA 4OIJA 3HOVH 3AFPA 4QJFA 5FKAC 5IGCA 2QEJC 4BBSB 1LQLA 1S5ED 4TNUA 2W03A 3MHBA 1N32Q 3TZUA 2CVRA 2M00A 3OMCA 1VQ8A 2JE6I 1SYGA 3S2HH 2DNCA 2K14A 4CDFC 2KCCA 1PMRA 5GQOA 4QUFA 4BY7I 3SK6A 1QG7A 3K0XA 5I4DA 3S15B 2V8KA 2JA6H 4KKSA 5ELBA 1DCZA 2JR6A 1QVCA 2AWNA 2WB1E 2XNAC 5CR3A 2VPZA 2HF1A 1F9PA 3RZOH 3S15H 2WB1A 3VB9A 1XYIA 3CCL1 5BR8L 1KD11 4HAEA 1E1OA 1SIWA 1CKNA 3M7NA 1PH7A 4CKEA 4UP7A 1FGUA 1K8OA 1SNCA 1K83H 5K36G 2F4IA 1CUKA 3W5OA 3AEVA 2ATWA 3R2IA 3SGIA 2CQAA 1QZHA 3NK9A 2HU9A 3RZDB 5H1SE 2YTYA 3K6OA 3KF8B 4DQYB 4BY1I 4X3SA 3M4OB 3OTOQ 5C4JI 1TVXA 3SVMA 2IZ4A 3FQMA 1L2FA 3O13A 3TZDA 1B70B 1EQVA 2RHSB 2LSSA 4HTHA 3GV6A 1EFID 1FL0A 2RHBA 2R7ZH 1VQP1 3HOZB 3PUZA 1T9HA 2UUCL 2WINB 3NHHA 1S5FD 3S1QB 1TWFH 3EIVA 5E3FA 1ILQA 3HEJA 5IOCA 2VUMG 4Y7NI 3I07A 3CCRA 1STAA 5C4XB 1GJXA 4KJOA 3CPWA 2MHVA 3VYSA 1K9MC 2XIWA 1B8AA 4BY7B 5I2XA 2R92G 1M1K2 3P75A 1RKNA 3RR5A 3GTQB 2R7ZB 3CQZI 1V8QA 1KDCA 1KRSA 1VQ7A 3K58A 4IZ8A 1O7IA 1M1K1 4IURA 1FDIA 5BN3A 2OTJZ 3FMCA 3ERSX 4A3EG 1J5EQ 1H9SA 4X3UA 2NVQB 5IT9c 4DN4M 3RN5A 4OX9Q 3SK4A 2B2WA 2IY5B 1SXTA 4K5WA 3CHBD 4NXML 1Y1VH 1VQ51 3I561 3BG3A 5L37A 3I55A 1PFSA 3QWNA 1SROA 1RL2A 4IN3A 3IAYA 3A7LA 2P3YA 1M4VA 3ZJYC 3K7UC 2FHTA 4X3TA 1F9SA 3D3RA 3URYA 4A75A 4DK1A 3BVMA 3VMIA 2RDHA 1Q7YC 3S1NH 1WTQA 1E3PA 3NTKA 1LTGD 4A3IG 1HZCA 1MSGA 1VCIA 2AHOB 3BDOA 4DNRB 2HIVA 3UI2A 4JI5L 4DGZA 2O4HA 1GUGA 1L0WA 1F2MA 1Z03A 1Y8CA 4YCUA 2P28A 2JA5B 1H9SB 1RF2D 5CV5A 2JYOA 4DR3Q 1ENCA 3FHWA 4XT1B 3PUXA 1DOLA 4NP5A 3RMHA 3SEBA 3NTHA 4DFAA 5IWAL 3S2HB 4M1UB 5A2Qf 2MO0A 1KD12 2EYMA 3I4NB 1F2ZA 3CCLZ 1SYBA 3RZOI 1VQ9Z 5ELDA 3S17B 3CF5A 3K57A 4POFA 4LFBQ 3UE1A 1RJTA 2F0NA 4JI1Q 5C44B 4XDXA 2KPIA 1K28A 1SFOI 5IYBG 5CV4A 4IFDJ 3DWQA 1BVSA 1KRTA 3GTMS 2ES2A 4XYOA 2J4XA 5IGFA 1DXMA 3X3MA 2K5DA 3BG1B 4IJHA 1CA5A 3IKJA 4BA1I 3V2TA 1KIXA 2B8FA 4S1TA 5C0XI 1KLUD 1PZID 2Q4ZA 4A3CG 1Q1EA 3STBD 3S1MH 5CV9A 1J5EL 2X6GA 1HH2P 2IHEA 4JV5Q 5IYBH 1BBUA 4DV0L 2YU9B 4B3TQ 1J9OA 2M9VA 4L5QA 1HUMA 1Y1VI 5D3DA 4OGQC 4LF5L 2QLVB 2K52A 1EIFA 1PFTA 3CCJA 2NTTA 4J8QA 1QUQB 2GU2A 1ILPA 5M5YB 1YNND 3TEHB 1EYDA 1JB3A 1PH3A 4NBAA 2ZXOA 4RAUC 1RDPD 3PGZA 3CC2Z 1YJNZ 1MI2A 2AQ3B 4RFBA 3DLLA 1Q812 1DGSA 4CJ2C 2UUAL 1G6PA 1YJW1 4JOIC 2O5JC 1I4RA 3GTLH 5GADC 1DOMA 3CCQZ 1AEXA 4XQNA 1NSNS 1VQ5Z 1FNVA 4RGOS 3CCQA 1MSHA 3S1RH 4H7BA 3OIQA 1KC8C 1AFPA 3D9XA 4PZ8A 2R7ZI 4DK6C 1WJ2A 1HHVA 2K5RA 5D1OB 1N9WA 4P74A 1EFWA 4RHSA 1GUNA 2VNUD 1BOSA 4RKLA 2A6ED 2KHSA 3KDFA 1G2TA 1KRLA 3MWYW 5DEHA 1Q822 1E2WA 1XMQQ 3CCMA 3S16I 2JA8B 2JSOA 4OWWB 5IGDA 2NAPA 4CL1A 1EY0A 1NAPA 2K5NA 3IFUA 3A55A 3KBGA 4NBFA 1Z02A 4GLVB 2Q2IA 3PV0A 2UXDL 3SHLA 2Z9HA 4JI3Q 1I4HA 4QQBX 2VB2X 1MJCA 3DHQA 2HQLA 1I3QB 3NH5A 3CC41 1EY4A 3HOZH 1QWYA 2B3GA 2ZXRA 3S14I 1LLRD 2AYDA 1KQSY 3G6E1 1QUQA 4HIKA 1Y1WH 1BDOA 2KA7A 3HOXB 1I6HB 1NJI2 1R9TH 5D1PA 2HIXA 1KLGD 2GA4B 3FQQA 4YCWA 1PTOB 2X69A 4ZKBB 3DXJC 1SMYD 3UDGA 4Q5VA 1JQYD 2JIRA 1E22A 2F0KA 3E0JA 5KEEA 4A3DG 2I46A 3ITPA 3M3YI 1QVFZ 4A76A 1LTRD 4B3ML 5FLMG 3AFQA 5C4JH 1JE4A 1HZBA 2V8JA 1H9JA 4K5VA 1LYLA 1JWSD 2BH8A 5JJKA 1SLJA 2IPKD 1M1KC 3G4S1 3ULLA 5DM73 1SR3A 1S5DD 2CW0C 3NEMA 2SNMA 3HOVI 3P20A 4KD3A 3FPUB 4A3MH 1SYFA 2IJ0A 5J1ZA 3A56A 2WB1G 5C3EB 1X56A 4GOPB 1YI2Z 1Y8PB 3W2DA 4FDBA 4OX9L 1O7YA 2EXZA 4RGTA 3M7GA 2YYZA 4WJ3M 1VQ5A 4P72A 1E1TA 4B9WA 2OOYB 1VQK1 1UNSA 1GO3E 3Q8DA 4RA8A 3RLNA 1G2SA 4KMUC 2VF1A 1W6JA 1Z9FA 2JA8G 4JI6L 2Y0SG 2EY1A 5M5XH 3TS2A 1XNRQ 4C3HH 3A0JA 4C2MH 1YIT1 2F52A 1JJGA 3AYHB 4DV1Q 4NXNL 2EYFA 4OXPA 4C3IB 1HA6A 2BDOA 4CBVA 1D1IA 4C3IG 1VQ41 1YJWZ 3HOWG 3KBXA 5NUCA 4RVDA 3OIPA 4FF4A 1I5FA 1YNNC 3MA2B 4JYAQ 1SNPA 4A3KI 3J81b 2PK7A 2GTHA 3HOZG 1TFIA 2XRQD 3ZYYX 1WCMB 2E74C 1N34L 3FRPB 4GN4B 1VQ7Z 1B53A 4DGLA 2NVTI 2Y0SB 2NZOA 4MD9A 3E5SA 5LMUQ 1SE2A 2LFNA 1HR0W 2KQ3A 4DV7Q 3HOUG 4HJ7A 3TP5A 3TBIB 1D1KA 1S3OA 5LL6S 5HY6A 3HOUB 4AYBA 1X54A 4HIMA 1EQRA 3F2BA 2QCPX 3OTOL 5FLMH 3GDEA 5BR8Q 4HIOA 1LT3D 2B39A 4R4IA 1CI3M 1GD7A 1A6XA 1USPA 1VQ9A 3L0OA 3JAMb 1IW7D 1HNZQ 3CCLA 1PFMA 3C1EA 3PIOA 2EYOA 3CRKC 1JMCA 3K8AA 3PO2I 4ZLTF 1C9OA 2I0QA 4PMCA 4RG1A 1KQSZ 1Y1WB 4LF8Q 2FMMA 2JA8I 2MPMA 5C0XG 3Q23A 2LEXA 4JK1C 1N8R2 2UUBL 1E2ZA 3Q87A 1I3QH 4A93I 5FLXb 4E31A 1O7ZA 3NFZA 3CC71 1IBLL 1XNQQ 4IPGA 1YHBA 5IP7H 4LUZA 1DL6A 4WRDA 4NBEA 2M2LA 4NFRA 3CKIB 1N8R1 4BBRG 1EY8A 1ZKOA 5I9PA 4JI7Q 1JICA 1CTMA 1K9M2 4XXEA 1E7ZA 5C3WA 4WFN3 2HT1A 2JA8H 1N32L 1NCVA 2J7ZA 1K732 1JCKB 1SN8A 3OPOA 4C3HG 1SSOA 2J6AA 2PQEA 2QA4A 4X66L 4DV4Q 3BZDB 4LFBL 1U0LA 4KK7A 2GVAA 4XIGS 4JVZA 1UE7A 2NWGA 1A0IA 1PZKD 1Z01A 2DGYA 2KECA 4KJNA 3I55Z 1OO9B 3HOWH 2QGQA 2D62A 3MXGA 1C8CA 4A3GI 2WB1B 3MZ5A 2OTJA 4DR2Q 4JI7L 4R8NA 4JC0A 3KIHA 1B44D 3M4QA 4Y52I 3TS0A 1J8IA 3J7ZC 1EIGA 1EWCA 5HURA 2R6MA 1ONLA 2TSSA 4LF6Q 2QRDB 3OW2Z 2YTXA 4K5XA 4KHZA 5M5YH 1M90C 3G71Z 4KY7A 4ZKCB 3JAMi 1RODA 2VW9A 2EJFC 2EGTA 2K5VA 2IW3A 4OL7A 2B2VC 3FP9A 2SOBA 1WD0A 3E9HA 4YHHL 2SDFA 1HNWL 2B2UA 2DN8A 3MVVA 4A3EB 1GM5A 2ZTDA 4PNYA 4UY8C 2NTSA 1K3RA 4A3EI 1Q8IA 2UU9Q 5M5WB 3G711 4L63B 1OXSC 3KJPA 3G6EA 1CKNB 1SFOH 4HEDA 1Y14B 4DXGA 5K36H 2PW5A 5IYCG 2O5IC 1BCPD 2QDLA 3T16A 3CCJ1 4DK3C 2JUBA 1HZAA 1BF4A 3H09A 2ZXPA 1Y1WI 3MZLB 1WTXA 1OXXK 4LAAA 1SNMA 2B2YA 2AUJD 1B4OA 1CKMA 1G91A 2I07B 2MQHA 2RIQA 1SMXA 5GROA 5HGTA 4LF4Q 3GTKB 1MGSA 4E30A 1CHQD 1FGBD 1YITA 4IQZA 3M9BA 1BBXC 4JV5L 2M48A 2ZT9C 1NUCA 2R92B 2Q8RE 3N6RA 1PFBA 2I3CA 3H3VJ 2HD3A 2K05A 4BBRI 4EQ5A 3CMEA 4OO1I 3BJUA 4K6LA 3T1YL 1H9RA 3D4WA 4RVGA 1O7LA 1K8A2 4YHHQ 3HS0C 4Q0FA 4H44C 3AU7A 3TSSA 2WV6D 2IX1A 4M8AA 3K5NA 2NVTB 4ZAIA 1VQ8Z 1MD2D 1I94L 3P1HA 2XN9C 4A3MB 2MFIA 4P2CB 4CHTB 3CD61 1TWGH 3D6WA 3J81E 5J3BA 3G4SA 2JIMA 4UHVA 4RVHA 1JOOA 1JWUD 4H13C 3NBIA 4KKTA 3ULPA 1PYBA 4QTUA 1H9KA 5EJWA 2R61A 1STYA 3OSOA 5K5PA 4FF3A 2RT9A 2F0FA 4ABNA 2WAQB 1STEA 4A3CH 4PV1C 4RCNA 3S16B 3SDZA 4IFDH 1FR3A 2WAQE 4EVOA 4DNTB 1IBML 2B8GA 3S16H 4AYBE 4A3BG 2G9DA 4OONA 5G3LD 3A8KE 2G9HD 2F3VA 2V4DA 1HFGA 3OOCA 2EDGA 3K81C 5EGTA 1VQAA 3MXNA 5T67A 4JI3L 3Q0AA 4R8IA 2OTLZ 4RMFA 5IYDG 1EY5A 2CH4A 5T1GA 3F1ZA 2PNRC 2MGSA 1X9NA 5IP9G 1WCMH 1QE6A 4WJWA 4RHRA 1KL9A 4RS4A 2F4MA 3Q6SA 3CC7A 4QB4A 2Q8TA 5T1IA 4E2XA 2PQAB 3KFUA 4A93G 3GTJB 2RSNA 2NZHA 2Q2TA 2JIPA 1KAWA 4IOCA 3DUZA 1EU3A 4A3CI 5IGEA 2L4NA 2PI2A 1ESFA 4GLXA 4FYDA 4HGZA 3WDNA 3GTPB 4DR6Q 2DE6A 4KI0A 2Q2HA 1VQKZ 2FXQA 1WCMG 2A69D 3I4OA 4DA2A 2RBLA 2HDMA 4Y7NH 5ISRA 4C2MB 4GNXA 1K83B 3NTIA 4QIWB 2OT2A 3PCOB 4RH6A 1VQ61 3S15I 3I3CA 3J7A4 4KD4A 4QIWE 3U4ZA 4DUZQ 5I6WA 1IKMA 1EIHA 3MTSA 4R4OA 4X3KA 1PA6A 4LF4L 1K73C 4AYBG 2UUAQ 2OTJ1 2PQAA 4F87A 4LF7L 3I73A 1CQFA 3K5MA 3VR4A 5D3IB 1WOCA 1SE8A 3PIPA 4JOIA 1SFOB 2JA5G 1TXYA 4B3SL 2Z0SA 3H0GI 1CSQA 4X62L 4OO1H 4IJLA 4K8IA 4B3RQ 1QNKA 2JXMB 3DM3A 4B9XA 4B3RL 1WTRA 1EOVA 1O78A 2X6LA 2KVMA 2LXJA 2JA9A 1L0XB 2KEEA 1V9PA 1KHIA 2N88A 5M3MG 1CK1A 4NH1C 2D5DA 4GLAC 1ZXTA 4JI8L 3EROA 1WJJA 4BS9A 4RKBA 2E2DC 3E3XA 3HKSA 2EZVA 1YJ9A 1WYDA 1IKLA 5JJLA 1N36Q 2OWOA 2XGTA 2ZTEA 1VQIA 5D65A 4A3MG 1EWHA 1LTLA 1VDZA 1Q861 5GAGC 1JJ2A 3I56Z 2PO4A 4LF7Q 2NBFA 1V1OA 1V1PA 2NN6H 3HOWB 1LTAD 1HQMC 2F0IA 3S1NI 2D9UA 5COYA 3S1QI 2JEBI 4O1NA 4RVFA 4XQQA 1WZNA 4XX2A 1VQ6A 2R92I 3FEWX 5D14A 4OWTB 2UXCL 1W2BZ 3A74A 2E75C 3NQTA 1QOHA 2AKWB 2F1MA 3HOYG 5IP7I 2EJGC 1EY6A 1VQMA 1GUTA 2M6NA 3H0GG 2VQEL 2K5WA 3QG1A 1Q86C 3ONAB 2A1AA 3K0YA 4E32A 2JA6G 1LUZA 3J80f 1UE6A 1RTOA 3F2CA 4DPGA 4B3MQ 1K83I 4E2WA 3W3AA 3CD6A 4H0LC 5IT9f 1A15A 4N9PA 4DV3Q 5E1FA 4ULLA 4OHJA 5C4ZA 1K8AC 2Z4HA 1VMPA 5C3EG 2WIIB 2RDFA 2K01A 2VZAA 2NVQH 1TWFI 1TWGI 2WP8J 4GNXC 2A5HA 4BBSG 3D4DA 2A6EC 3D0FA 4ZRZA 4J6HA 1RCVD 2VQFQ 4DUYQ 1P9NA 3E9IA 3A7AB 1L1OB 4LUOA 3GTGI 4GZYC 2Z8LA 3J7YW 1VQBA 4XT3B 1YEZA 4BY7H 4GS3A 1NP6A 3TMEA 5JJZA 2F0SA 3HKZE 4A3DB 4EX5A 3MFGA 3R2TA 4L5SA 4B3SQ 2GVBA 3BZCA 4IPHA 2VL6A 1NTGA 3ERQA 3Q22A 2UXCQ 4H02A 2IX3A 3RD4A 1EOTA 3S1MB 4L5TA 5IT9b 2R7ZG 4A3GG 1C0AA 3PO3I 4HCSA 1Y69U 4A3GB 1CT1D 3QWUA 1UE1A 1UE5A 5C3EI 1VQKA 1VQ6Z 2B2UC 2WFWA 3H6MA 4IUNA 2DE7A 5EAYA 4V190 1X3QA 2VUMH 2F0QA 2GN5A 2HCCA 2B63I 2DY7A 3M4OH 1QILA 4CKBA 3IFDA 1HNXL 4A3JB 5AJ3L 4C3IH 3U9SA 5FLXf 4LF9Q 1YIJA 1VQL1 2E76C 4POGA 1B2TA 2JA6I 4A3LH 3I56A 1TWHB 1SJHD 4FXKC 3CC7Z 2KCNA 1XNRL 2R6GA 2E2II 1STGA 5IGBA 5M5XB 4FXGC 3I4NH 2K03A 3EA6A 3HOWI 1KDBA 5CGKA 2PYKA 3S2HI 5LMUL 1WTPA 2BCOA 3A5UA 3K59A 4E2ZA 3T4AC 5A2Qb 3BG0B 2RCNA 3U58A 1YJ9Z 4AQYL 1X6OA 2A8VA 3OW2Y 1TT2A 3CCUA 2JIOA 4JYAL 3JAMc 1ENAA 2XTIA 1OTCA 2K4KA 2Z6BA 3I4MB 3GTMB 5FO9B 4OWXB 5EBDA 1TR5A 3VYRA 2CW0D 1KAAA 1X3EA 2HHHL 4DKAC 3AMUA 4BBSH 5LMNW 3T51B 1RHPA 1EYGA 1SYEA 3M3YH 4GKKL 3HKZG 1HXYD 3FKIB 5C4JB 2Z6KC 5IYCH 3GTGH 4A3LI 4EQOA 3PIO3 3VYTA 1USPB 1K731 4G7HC 5CBAE 4PZ7A 1XWEA 1HUNA 2F4VQ 3QJYA 2QEX1 4Z9CB 2DE5A 4MD8A 2VY3A 1PXUA 3G6JB 5FK9C 4C1NI 1PDQA 1VQOZ 2NVQI 1SMYC 2JJQA 5FJ8H 1UEBA 2VPXA 3RLOA 1I6HH 3HOZI 1WW9A 2A68D 3QO2A 1VQN1 2JQOA 3GTQH 4A3DI 2VPWA 2ICIA 4DV6Q 4ALPA 1Z7TA 4IOAA 2H4OA 4WORA 2YTVA 1CQVA 4E33A 3E0EA 2DJFC 1SNOA 1VQEA 1KC82 1LTSD 4LFCQ 1HR0L 3V96A 1HTLD 4DV3L 2V8IA 1B9MA 1N36L 1UUPA 2Q51A 2FJ2A 3TE5B 2NB0A 4CJ1B 3H3VI 2K75A 4FF1A 1FD7D 1VQCA 3VA5A 1WFQA 3KF8A 2O53A 4A3LG 3CMAZ 4JI2Q 3H3VC 3HRZC 5HGQA 4APVA 1RO0A 1XMOL 2ZTCA 1SE4A 4DV6L 4MN3A 1JC7A 1L1OA 1PH1A 2E7ZA 3NENA 3S1RB 3PF4A 2XSCA 2K33A 4IUTA 2LS01 5CORA 2WACA 5KNBA 2OQKA 3PMFA 4A3FB 4XYQA 5FO7B 4QTTA 2FMCA 2ZM6L 2PMZE 4O0AA 4C56C 1K0SA 5C4HA 3K7AI 1PZJD 1N8RC 4LFAL 5E4XA 1PVOA 2NUCA 1V1QA 4KV6A 2MP1A 2E5LL 2IV2X 1GXDC 1WTHA 5IP9I 3RZOB 4X6AI 1Q862 3CCEA 2CWPA 4NOZA 4A3FG 3KOJA 3MAQA 4LF5Q 4KHPQ 2KI7B 1A3TA 1F77A 3M4PA 3CCM1 1JJCB 3ESWA 3T1YQ 1IYVA 3NWSA 4DF7A 3J80b 2I5HA 4A3IH 2V3VA 4BWGB 5ELCA 2NN6I 4NBDA 3EQLC 1LT5D 3DEOA 3R3OA 3STBC 1JOQA 5IY0A 2K32A 5I2YA 1X65A 4A3BH 4QCLA 1YHQZ 4DV1L 4N8X1 1BUVT 3HOVB 5T6BA 1I4PA 1VQHA 2AQ2B 3A5ZB 1RNIA 2NVXI 2JEAI 1MJEA 5IE8A 4HSVA 4WJ4A 2AUKA 5A35A 3NUCA 3CMEZ 3CCU1 1J6QA 5KRUA 5IODA 2VUMB 4U673 3I4MI 2PCFB 4MZ9A 5LL6X 4MTKA 1TWAH 3VMHA 4JBKA 4KKUA 2QRCB 4ID6A 4A3BB 3ICEA 5E4WC 4JI2L 5BN5A 2E2HH 2BH2A 2KENA 1YHAA 4GKJL 1SYDA 2UU9L 2IZ3A 5EPLA 5FLXc 1XTCD 1IHZA 5M3FB 3CME1 2EYJA 2RDGA 3GTKI 1PH9A 1Q3LA 2E8GA 5ELOA 5FLXE 2WAQG 3S2DH 1PH6A 1Q46A 3EN2A 1ZB8A 1EZ8A 3CAMA 1CFMA 2JA5H 2F4VL 5EKIA 4OO1G 5D1OA 4G4KA 4BXXH 4P73A 4DAYA 2RKSA 2L0CA 5CM2M 3H91A 3KYHC 1V43A 2SEBD 3BS1A 4HJ9A 2OOXB 1YBYA 1SBBB 3TRZA 4A3KG 2L55A 2UXBL 2D0OA 3A54A 1R9TI 5ELFA 3I70A 3V05A 1M901 1Y8OB 3CCVA 4G7ZC 3GKQA 2ALYB 2A73B 1QCBD 2F0WA 2RF4A 4O42A 3GTLI 2H5XA 3G71A 2HDLA 3LGJA 4DR3L 1BR9A 1Y1VB 2QEXA 4F8MA 3CU7A 1YJ91 1PRTD 3KF6B 4RGNA 2LKVA 1EEFD 4QMGA 5JAVA 1ENFA 3RZDI 4CDEC 5CBEE 4K0KL 2RHQB 1MHWC 5IYDH 2ZAEB 2HCIA 2SNSA 1AP0A 2RVLA 2NVYI 2RPRA 3J81i 3W1GA 3TP7A 1WCMI 3GTPI 3NH8A 4DV2L 3J7A5 3J80c 2G5DA 3KK7A 3LNNA 1YJWA 4QL5A 3IR7A 4LF9L 3NH4A 3MXUA 2BE5D 1YNJC 1PTOC 1TWFB 3S1QH 2QA4Z 3HOVG 4KTAA 2JS4A 2Q8IB 2LIYA 3QR8A 3GD7A 4FNFA 3GTOH 2I5LX 3SE0A 3M4YA 4E6IA 4BXXI 1SEBD 2NVYB 3MXNB 1DOKA 1STBA 3MONA 4R4CA 3T56B 1IXRA 4CJ0B 2Y0SE 2ID0A 3EEDA 1VS0A 1LABA 3RZDH 1ZH1A 3CC4Z 1MKHA 1JOKA 1R4QB 2CQOA 1DD2A 1A8VA 4N9TA 1VQLA 3K80C 5KYLA 1X3GA 4HMJA 5CYUA 5DNFA 3BVZA 1VQGA 3BDCA 1KQSA 1YI2A 4BXXG 3QB3A 4IUPA 2VXWA 3FDTA 4YWMA 1B7YB 4DNIA 3GTMH 3I4MH 3J80E 4DR7L 5A2QL 1IL8A 1QVFY 3H94A 1M902 1PTOD 4B08A 5JEAJ 2O4XA 5I9OA 3S9WA 2Z6KA 1X3WA 4NBGA 1XJVA 2B2WC 3DEPA 2VS1A 3TDQA 4X62Q 4IUUA 4BBRH 4OIKA 3GTOI 3U4VA 1W6KA 4LUVA 3TQYA 4A3KB 1GKHA 1PFNA 2BA1A 3HFZB 1EYAA 3MFYA 3PSIA 1Z6HA 3GQBA 3GTMI 1RQFA 2BA0A 4DUYL 4TQUS 4BY7G 4NB8A 1TWCH 4MRIA 1STNA 3GTPH 3MXPA 4X6AH 1CSPA 4EQNA 1QF8A 1IZ6A 1DZ1A 2F0JA 3NE5B 3LUSA 4ZQ3A 1B1ZA 2BOSA 2K3RA 2CH4W 1PH4A 1TU2B 4IFDI 3P7JA 4A3GH 3CCMZ 1B9NA 3MEFA 3CQZH 4LMQD 2NVXH 5DLQE 1AA6A 2ZJPA 1NMFA 2JMOA 2F4OA 2QDBA 2UXBQ 1A63A 1IYJB 3S24A 2R7DA 2YU9I 3HOYH 4AIMA 4LNQA 4JI1L 2TMPA 1VQNZ 4GKKQ 1Y1VG 2FINB 3PUYA 4K2KA 2ZJRA 2F3IA 3I8ZA 2R93B 5M9OA 3HZXA 2KUMA 1BXTA 1K8MA 1HR0Q 3IFTA 1X3ZA 5JPNC 2RCFA 3VDYA 3CC21 1YJN1 2AWOA 1YJNA 3CC2A 1G291 4A4IA 4DXFA 2XWBB 3SK5A 4DK0A 4DR7Q 1EWIA 1OXUA 1AE2A 4JBWA 2GTIA 2A6HC 3I4MG 2DNEA 2JN4A 2EJMA 1EQTA 3CCR1 4PMWA 1U4PA 3ND8A 3GTGB 1D2BA 1QVFA 2JA7G 2NZ1D 1BBWA 2RQXA 3I7FA 4RGMA 4QGUA 2PZWA 1QYPA 1QVGA 1D7QA 2MO1A 3PO3B 2EOTA 4QY7A 4UDUC 4TKOB 3T1HL 2LXKA 5LHY1 1VQO1 4K6DA 1HCZA 2F0OA 1T5EA 1KNAA 3EBEA 4U68A 5M3FG 1XPOA 1IL2A 1A2UA 1XMQL 1K3BC 2PZTA 4JI8Q 1QVGZ 2Z1CA 4YY3Q 1HZ9A 1G51A 4NB9A 3I551 2EVBA 3RNUA 1NBWA 2K1BA 4IPDA 3G7LA 1EUJA 3JAMf 4A3JG 1CZWA 1SNQA 4DR4Q 1HNXQ 1X0TA 1SE3A 1P16A 1F9QA 4DR6L 4BY1H 3B6YA 1LTTD 5T64A 1I3QI 5IIFA 1N33Q 1AW7A 3GTKH 2V1CC 1VQJA 1PH8A 5AFWA 3PO2H 1FYCA 4K8JA 2O2LD 5C5MA 3WOFA 2VQFL 4MNOA 4A3JH 2OZKA 3TP6A 5KIXA 2E2JB 1XTDA 1YUKA 1I50H 2XVSA 3ULJA 4X65Q 3EERA 1A62A 4KHPL 1XX8A 2H1EA 3TN2A 2RSOA 1LACA 1DONA 3KLRA 3NELA 1VQNA 3K7AH 1VQM1 1Z47A 3L2PA 4G7OC 4UP8A 1YI21 1YNJD 1CHPD 3PO2G 4QUCA 1IBKL 2EY6A 3U50C 2JIQA 2CKZB 3W1BA 4A3EH 2AMCB 1FDOA 1PRTF 2QILA 4X66Q 1GUWA 3CCJZ 1VQ71 3K7AB 2KJXA 1Q7Y1 2MJ8A 2ASBA 3NBHB 1QVGY 1ZYRD 3NSWA 4JBJA 4LFCL 2JP1A 5JEAH 3WWVA 2JA7H 3F3FC 4JW0A 3NWTA 2F0HA 2MNAA 1L1OC 4JPBW 3KLSX 4ZK9B 4ZYSA 1S4ZA 1ZB9A 1ESRA 5FJ8G 5LMNL 2B63G 4UPAA 1Q82C 3KIFA 4A3FH 3QIAA 2E2IH 1AN8A 1R4PB 2QKIC 2CCZA 1VQFA 3CPWZ 1NE3A 5DM63 1EY9A 1K8A1 5C6AA 4GNXB 2F0MA 3GTQI 3CCRZ 5IT9L 3H15A 4JBMA 1S5CD 1AZQA 4QF4A 3CCVZ 2YV5A 1TIID 5EKLA 1BCPB 3TREA 3GTJI 3D31A 3GTJH 4IO9A 2B63B 1W3SA 2EE1A 1B3AA 4JCVE 3S14H 5C0XJ 1SYCA 4R1JA 4ME3A 2F0GA 4JI5Q 2QR1B 2PMZB 4UP9A 1HQRD 2OF1A 1PH5A 1A3VA 1HJPA 1B50A 2YADA 2BJOA 1HPCA 1S721 3VYUA 3HGBA 2B2VA 1VQLZ 1BCPC 3CCV1 1ZEQX 4NDXA 3FVQA 1SJED 3Q24A 4BBSI 4DR4L 3CC4A 1F2YA 1WI5A 5A2QE 1X3FA 4GN3B 4C3JH 4DR1Q 1S40A 5CV8A 1AH9A 5ELNA 3NBHA 1Q7Y2 1WTVA 1CKOA 4XQJA 3RLFA 2D2CC 5M3MH 3U9OA 3F2UA 3UDXA 4L5RC 4DV5L 1Q821 1A3UA 3R8BA 3F2DA 3UDFA 4NXMQ 4X64Q 2J0TD 5FLMI 3KLWA 2F0EA 4KN4C 3M3YB 2R93H 3HOYI 4FVMA 3I4NI 2QW7A 3L3OC 2BE5C 1P8LA 2I5MX 1FNWA 2PNHA 2ZM6Q 1QNUA 5JEAG 1DJRD 2IHFA 1YHQA 3BVGA 1NR2A 3I91A 1JWHC 2ENBA 1KTKA 2R7FA 4ME5A 1JB7A 2NVTH 3GP7A 2E5LQ 3J81j 5JJIA 2B63H 3DM1A 1QJOA 1VQ91 1D5MC 1L0YB 2QEXZ 1Q8KA 1X32A 2R93G 1TWCI 1Q81C 4EQPA 3CRLC 4AH6A 2JA7I 3MZKB 3VR3A 1XPRA 5JVG3 3CCEZ 4A3MI 1OXTA 4ZUIA 2A6HD 4HN7A 2F0DA 2NYZD 4F88A 1TWCB 2F0TA 1I4QA 4JI0Q 5CV7A 3FKII 3LWUA 2OCEA 4Y7NB 3H0GH 1BKBA 4LFAQ 1AZPA 3CMA1 5EBCA 4NXNQ 3CCSA 2A68C 2CFMA 2JA7B 4IPCA 1JORA 5EQ0A 4L6TB 2DUDA 1IBLQ 2FFKB 1RTNA 3M4OI 3BYTB 2DJGC 4FXDA 4K0KQ 1KNEA 5IGGA 5C3EH 4A3JI 1LM0A 3PF5A 2F03A 4IUQA 1GHJA 4L8JA 2HHHQ 1C4QA 4OELB 4V0BA 2EYLA 4DV4L 1DM0B 3F3PC 2QKDA 4DAPA 1NJIC 2AKLA 1VMCA 2UXDQ 4S3SA 3L7ZC 1O80A 1S7MA 3NP8A 1CM9A 2K04A 2ICEC 3HKZB 2QREB 1ASZA 1NUIA 1I50B 1XNQL 2EYHA 5C3XA 4LW1A 2A19A 4NBCA 4KN7C 3HOXH 1I94Q 1Q90A 1YUAA 5EPJA 2K7VA 2UUCQ 4NPSA 1G6ZA 3NXWA 5FOBB 2IT1A 2PMZA 2AQ1B 1ET9A 4I7ZC 1YVCA 1TWGB 4PZ6A 1VF7A 3GO5A 4IUVA 1VQ81 1VQ4Z 1XXGA 1JE5A 3SK8A 3G48A 4HGYA
chains in the Genus database with same CATH topology
1UAPA 1IW7C 3VR6A 4IALA 1Y1VS 1BCPF 3IX0A 1ET6A 1HA5A 2MUYA 1C48A 1TS5A 2B2YC 4MXUA 2L5TA 2RA4A 3J81L 1U4RA 5J22A 2XRSD 4R9WA 3BDLA 4PMBA 2LMCB 5F2DA 3J7AF 3EVQA 2KEDA 1RO2A 3HOXI 2KOLA 3DMUA 1EYCA 3E6ZX 2WKCA 4NMZA 2OXPA 2QF7A 4YIJA 2IWHA 2F3WA 1W2BY 3QOLA 3S2DI 1YIJZ 3TP8A 1VQPZ 3I4LA 2RBMA 2PM9A 4MH4A 2N55A 5KYIA 1PRTB 3S2DB 5BN4A 4BA2I 1CZGA 2B2TA 2LFUA 4EGVA 1HRJA 4MHEA 3KLSA 2PZUA 5IT9E 1TWAI 1F2LA 5KNCA 4FO2A 3J81f 2E2HB 4FP5D 3JAME 3CQZB 5I6YA 2EPBA 4G57A 3CCQ1 3HOUI 1PRTC 5EKKA 1TWAB 1EL0A 5C0XH 3T4NB 5DAUA 1BQQT 2F0UA 2HUGA 5TSSA 4XTCS 3NDIA 2E2JI 4A3BI 1D5ZC 2JNYA 4FF2A 5JPMC 1I4GA 3PO2B 1WD1A 3H0GB 3J7AV 1U9RA 1YHQ1 1KDAA 1LT4D 4C3HB 1TY0A 3C46A 2BDNA 4NKLA 3GV3A 4KY6A 3MEHA 4A3IB 1Y8NB 2H85A 4BY1B 3CCUZ 1TKWB 3NDJA 4HSPA 3CD6Z 1SNDA 3VMGA 1TY2A 3OMGA 1STHA 2C5CA 4LK1C 4F7XA 3SR1A 2DY8A 1F9RA 2F0PA 3I90A 1VQMZ 1IYUA 3IL8A 4CKCA 4MD7A 1Q811 2R93I 3PO3S 1G8ZD 1GHKA 2HQEA 1BO0A 3PUWA 1WVLA 1TS3A 3LX0A 1BNZA 1NR4A 1UEAB 3CXCY 3D6CA 3LWEA 3S17I 4RCOA 1TQOA 2A74C 3HKZA 1S5BD 3OW7A 1ML0D 1K9M1 1PTOF 2Z4IA 5M3MB 2OTL1 1LV9A 1DYQA 3OWEB 3C1FA 1E2VA 2L12A 5LL6f 1SAPA 1RO4A 4DU9A 1LT6D 4E2YA 3GTOB 2JA5I 1EEID 1EY7A 4C3JB 1V1PB 1WIIA 3D8GA 2LY7A 1ICWA 4KHVA 3N52A 2PPBC 3MC0B 3K5OA 3A8IE 3NQIA 4ZUJA 3CXCZ 1VLAA 1GOZA 1EZ6A 1HTPA 3VR5A 3DWAA 1M8AA 1I4XA 1I6HI 4NW2A 1GUSA 5FO8B 3C2PA 3S14B 3HG9A 5FLXL 1I6VC 2K5QA 1E0BA 4TSSA 3PUVA 2EY2A 1X3PA 5JOBA 4TRDA 5G3LF 3A8JE 5KNDA 2E2IB 3T13A 1RLYA 4C1NK 3CPWY 2VUGA 2C9OA 2L9HA 1JWMD 1H9MA 4BBRB 1CA6A 5JVH3 2E2HI 3EJIA 3D4RA 2F0LA 3OWFA 3RUZA 3IF8A 1ZYRC 5KGUA 1TWHI 4C3JG 3M85A 3C3LA 1HFNA 1EU4A 1S72Z 4J1MA 4HCEA 2JA6B 1D6EC 1ML8A 2L1BA 4IFDG 1MBYA 1JJ2Z 2K6AA 4AYBB 1T5XD 4A3FI 3NPPA 1Q12A 4DAVA 3FPPA 4MONA 1LTBD 3EFXD 1WTOA 2XWJB 2W04A 4A3II 4RWSC 1KABA 2Y0SA 2EYPA 2F0VA 1RD9D 5AN9F 1D5XC 5C44I 1PTOH 4RV9A 3I72A 4UAIA 4ODGA 1R9TB 1JR0D 1II3A 4NBHA 5C5LA 2OEOA 2E9HA 3X3NA 3GCFA 3VA7A 1LTID 2IX0A 1U4LA 1Q1BA 3OHXC 5J39A 3G4SZ 4K2LA 1TS2A 2L11A 4NBBA 3WOEA 1NJI1 3L9AX 4I65A 2WAQA 3J80L 1I50I 4KY5A 3CCE1 1U4MA 3VR2A 1N2FA 1WTWA 3R93A 2K28A 3S1NB 2G2KA 1JJ2Y 1GUOA 2PW7A 3PIP3 3TDHB 3JAML 1TS4A 4HMIA 3GTLB 1A2TA 2EY5A 4EWCA 1LO5D 3AB9A 1KC81 2R3ZA 1YITZ 5ELEA 5EPKA 1FNUA 3DWPA 3CCS1 3SXHA 4HH4A 1VF5C 2CHBD 2B2TC 4HR7B 3ND9A 3VTNA 3KUPA 3BYYB 2WKDA 1OXVA 3T53B 1YIJ1 5C4XI 3G6EZ 3CCSZ 1SDFA 3P5JB 2VB3X 5CC4A 2A69C 2IL8A 4CGYB 3HOYB 4A93B 2NVXB 4K14A 4ILWA 4LJZC 1PYWD 2VUMI 1PLFA 4MIUA 5CV6A 2NN6G 3QOJA 3K5LA 3HP3A 2QA41 1QB5D 3S1RI 4PQXA 5CMDA 3S1MI 4OIJA 5FKAC 5IGCA 2QEJC 4BBSB 1LQLA 1S5ED 4TNUA 2W03A 3MHBA 3TZUA 2CVRA 2M00A 3OMCA 2JE6I 1SYGA 2DNCA 2KCCA 1PMRA 4QUFA 4BY7I 3SK6A 1QG7A 5I4DA 3S15B 2V8KA 4KKSA 5ELBA 1DCZA 2JR6A 2AWNA 2XNAC 5CR3A 2HF1A 1F9PA 2WB1A 3VB9A 1XYIA 3CCL1 1KD11 4HAEA 3M7NA 4CKEA 1K8OA 1SNCA 5K36G 2F4IA 3R2IA 2CQAA 3NK9A 2HU9A 3RZDB 3K6OA 4X3SA 4DQYB 4BY1I 3M4OB 5C4JI 1TVXA 3SVMA 2IZ4A 3FQMA 3O13A 3TZDA 1EQVA 4HTHA 3GV6A 1EFID 2RHBA 1VQP1 3HOZB 3PUZA 2WINB 3NHHA 1S5FD 3S1QB 5E3FA 1ILQA 3HEJA 5IOCA 4Y7NI 3I07A 5C4XB 1STAA 1GJXA 4KJOA 2MHVA 3VYSA 2XIWA 4BY7B 5I2XA 1M1K2 3P75A 1RKNA 2R7ZB 3GTQB 3CQZI 1V8QA 1KDCA 3K58A 4IZ8A 1M1K1 4IURA 5BN3A 2OTJZ 3FMCA 1H9SA 4X3UA 2NVQB 4DN4M 3SK4A 2B2WA 1SXTA 4K5WA 3CHBD 1VQ51 3I561 3BG3A 3QWNA 4IN3A 3IAYA 3A7LA 2P3YA 1M4VA 2FHTA 4X3TA 1F9SA 3D3RA 3URYA 4DK1A 3BVMA 3VMIA 2RDHA 1WTQA 3NTKA 1LTGD 1MSGA 1VCIA 3BDOA 4DNRB 3UI2A 4DGZA 2O4HA 1GUGA 1F2MA 1Z03A 2P28A 2JA5B 1H9SB 1RF2D 5CV5A 2JYOA 1ENCA 4XT1B 3PUXA 1DOLA 4NP5A 3RMHA 3SEBA 3NTHA 4DFAA 3S2HB 4M1UB 5A2Qf 1KD12 2EYMA 3I4NB 1F2ZA 3CCLZ 1SYBA 3RZOI 1VQ9Z 5ELDA 3S17B 3K57A 1RJTA 2F0NA 5C44B 4XDXA 2KPIA 1SFOI 5CV4A 4IFDJ 3DWQA 3GTMS 4XYOA 2J4XA 5IGFA 1DXMA 3X3MA 2K5DA 3BG1B 1CA5A 3IKJA 4BA1I 3V2TA 2B8FA 4S1TA 5C0XI 1KLUD 1PZID 2Q4ZA 1Q1EA 5CV9A 2X6GA 2YU9B 1J9OA 2M9VA 1HUMA 1Y1VI 5D3DA 4OGQC 2QLVB 1PFTA 2NTTA 4J8QA 1ILPA 2GU2A 5M5YB 1YNND 1EYDA 1JB3A 4NBAA 2ZXOA 4RAUC 1RDPD 3CC2Z 1YJNZ 1MI2A 2AQ3B 4RFBA 1Q812 4CJ2C 1YJW1 2O5JC 1I4RA 1DOMA 3CCQZ 1AEXA 4XQNA 1NSNS 1VQ5Z 1FNVA 4RGOS 1MSHA 4H7BA 3OIQA 1AFPA 3D9XA 2R7ZI 1HHVA 2K5RA 5D1OB 4RHSA 1GUNA 2VNUD 1BOSA 4RKLA 2A6ED 2KHSA 1G2TA 1KRLA 3MWYW 5DEHA 1Q822 1E2WA 3S16I 2JA8B 2JSOA 5IGDA 4CL1A 1EY0A 1NAPA 3IFUA 3A55A 3KBGA 4NBFA 1Z02A 3PV0A 3SHLA 1I4HA 2VB2X 3DHQA 1I3QB 3NH5A 3CC41 1EY4A 1QWYA 2ZXRA 3S14I 1LLRD 1KQSY 3G6E1 1BDOA 2KA7A 3HOXB 1I6HB 1NJI2 5D1PA 1KLGD 2GA4B 3FQQA 1PTOB 2X69A 4ZKBB 3DXJC 1SMYD 4Q5VA 1JQYD 2F0KA 3E0JA 5KEEA 2I46A 3ITPA 3M3YI 1QVFZ 1LTRD 1JE4A 2V8JA 1H9JA 4K5VA 1JWSD 2IPKD 3G4S1 5DM73 2CW0C 1S5DD 2SNMA 3HOVI 3P20A 4KD3A 3FPUB 1SYFA 2IJ0A 5J1ZA 3A56A 5C3EB 1YI2Z 1Y8PB 3W2DA 1O7YA 2EXZA 4RGTA 3M7GA 2YYZA 4B9WA 2OOYB 1VQK1 1UNSA 4RA8A 1G2SA 4KMUC 2VF1A 1W6JA 2EY1A 1YIT1 2EYFA 4C3IB 1HA6A 2BDOA 4CBVA 1D1IA 4C3IG 1VQ41 1YJWZ 3KBXA 5NUCA 4RVDA 3OIPA 4FF4A 1YNNC 3MA2B 1SNPA 4A3KI 3J81b 2PK7A 2GTHA 1TFIA 2XRQD 3ZYYX 1WCMB 2E74C 3FRPB 1VQ7Z 1B53A 4DGLA 2NVTI 2Y0SB 4MD9A 3E5SA 1SE2A 2LFNA 2KQ3A 3TP5A 3TBIB 1D1KA 5LL6S 3HOUB 4AYBA 2QCPX 1LT3D 2B39A 1CI3M 1A6XA 1USPA 3JAMb 1IW7D 1PFMA 3C1EA 2EYOA 3CRKC 3PO2I 4ZLTF 4PMCA 1KQSZ 1Y1WB 2FMMA 2JA8I 2MPMA 5C0XG 3Q23A 4JK1C 1N8R2 1E2ZA 3Q87A 4A93I 5FLXb 4E31A 1O7ZA 3NFZA 3CC71 1DL6A 4WRDA 4NBEA 2M2LA 4NFRA 3CKIB 1N8R1 1EY8A 1ZKOA 5I9PA 1JICA 1CTMA 1K9M2 4XXEA 4WFN3 5C3WA 1NCVA 2J7ZA 1K732 1JCKB 3OPOA 4C3HG 1SSOA 2J6AA 2PQEA 3BZDB 4KK7A 4XIGS 2NWGA 2KECA 1PZKD 1Z01A 4KJNA 3I55Z 1OO9B 2D62A 3MXGA 1C8CA 4A3GI 2WB1B 3MZ5A 4R8NA 3KIHA 1B44D 4Y52I 1J8IA 1EIGA 1EWCA 5HURA 2R6MA 1ONLA 2TSSA 2QRDB 3OW2Z 4K5XA 4KHZA 3G71Z 4KY7A 4ZKCB 1RODA 2EJFC 2EGTA 2IW3A 4OL7A 2B2VC 2SOBA 1WD0A 2SDFA 2B2UA 2DN8A 3MVVA 4A3EB 4PNYA 2NTSA 4A3EI 1Q8IA 5M5WB 3G711 4L63B 1OXSC 4HEDA 4DXGA 5K36H 2PW5A 2O5IC 1BCPD 3T16A 3CCJ1 2JUBA 1BF4A 3H09A 2ZXPA 1Y1WI 3MZLB 1WTXA 1OXXK 4LAAA 1SNMA 2B2YA 2AUJD 1B4OA 1G91A 2I07B 2RIQA 5HGTA 3GTKB 1MGSA 4E30A 1CHQD 1FGBD 1BBXC 4IQZA 2M48A 2ZT9C 1NUCA 2R92B 2Q8RE 3N6RA 1PFBA 2I3CA 3H3VJ 2K05A 4BBRI 4OO1I 4K6LA 1H9RA 3D4WA 4RVGA 1O7LA 1K8A2 3HS0C 4Q0FA 4H44C 3AU7A 3TSSA 2WV6D 2IX1A 4M8AA 3K5NA 2NVTB 4ZAIA 1VQ8Z 1MD2D 3P1HA 2XN9C 4A3MB 4P2CB 4CHTB 3CD61 3D6WA 3J81E 4RVHA 1JOOA 1JWUD 4H13C 3NBIA 4KKTA 4QTUA 1H9KA 5EJWA 2R61A 1STYA 3OSOA 5K5PA 4FF3A 2RT9A 2F0FA 4ABNA 2WAQB 1STEA 4PV1C 4RCNA 3S16B 3SDZA 4IFDH 1FR3A 4EVOA 4DNTB 2B8GA 2G9DA 5G3LD 3A8KE 2G9HD 2F3VA 2V4DA 1HFGA 3OOCA 2EDGA 5EGTA 3MXNA 5T67A 3Q0AA 4R8IA 2OTLZ 1EY5A 5T1GA 2PNRC 2MGSA 1QE6A 4WJWA 4RHRA 4RS4A 2F4MA 3Q6SA 4QB4A 2Q8TA 5T1IA 4E2XA 3GTJB 2RSNA 3DUZA 1EU3A 4A3CI 5IGEA 2L4NA 1ESFA 4FYDA 4HGZA 3WDNA 3GTPB 2DE6A 4KI0A 1VQKZ 2A69D 4DA2A 2RBLA 2HDMA 5ISRA 4C2MB 1K83B 3NTIA 4QIWB 2OT2A 4RH6A 1VQ61 3S15I 3I3CA 3J7A4 4KD4A 5I6WA 1IKMA 1EIHA 3MTSA 4X3KA 2OTJ1 4F87A 3I73A 1CQFA 3K5MA 3VR4A 5D3IB 1SFOB 3H0GI 4OO1H 4K8IA 1QNKA 2JXMB 4B9XA 1WTRA 1O78A 2X6LA 2KVMA 1L0XB 2KEEA 2N88A 1CK1A 4NH1C 2D5DA 1ZXTA 3EROA 4BS9A 4RKBA 2E2DC 2EZVA 1IKLA 5D65A 1EWHA 1VDZA 1Q861 3I56Z 2PO4A 2NBFA 1V1OA 1V1PA 2NN6H 3HOWB 1LTAD 1HQMC 2F0IA 3S1NI 2D9UA 5COYA 3S1QI 2JEBI 4O1NA 4RVFA 4XQQA 4XX2A 2R92I 3FEWX 5D14A 1W2BZ 2E75C 3NQTA 1QOHA 2F1MA 5IP7I 2EJGC 1EY6A 1GUTA 2M6NA 2K5WA 3QG1A 3ONAB 3K0YA 4E32A 3J80f 1RTOA 1K83I 4E2WA 3W3AA 4H0LC 5IT9f 1A15A 4N9PA 5E1FA 4ULLA 4OHJA 5C4ZA 2Z4HA 1VMPA 2WIIB 2RDFA 2K01A 1TWFI 1TWGI 2WP8J 2A5HA 3D4DA 2A6EC 4ZRZA 4J6HA 1RCVD 1P9NA 3A7AB 3GTGI 4GZYC 2Z8LA 3J7YW 4XT3B 3TMEA 1NP6A 5JJZA 2F0SA 4A3DB 3MFGA 3R2TA 3Q22A 3ERQA 2IX3A 3RD4A 1EOTA 3S1MB 5IT9b 3PO3I 4HCSA 1Y69U 4A3GB 1CT1D 3QWUA 5C3EI 1VQ6Z 2B2UC 3H6MA 4IUNA 2DE7A 4V190 1X3QA 2F0QA 2HCCA 2B63I 2DY7A 1QILA 4CKBA 3IFDA 4A3JB 3U9SA 5FLXf 1VQL1 2E76C 1B2TA 2JA6I 1TWHB 1SJHD 4FXKC 3CC7Z 2KCNA 2R6GA 2E2II 1STGA 5IGBA 5M5XB 4FXGC 2K03A 3EA6A 3HOWI 1KDBA 5CGKA 2PYKA 3S2HI 1WTPA 2BCOA 3K59A 4E2ZA 3T4AC 5A2Qb 3BG0B 1YJ9Z 3OW2Y 1TT2A 1ENAA 3I4MB 3GTMB 5FO9B 5EBDA 1TR5A 3VYRA 2CW0D 1KAAA 3AMUA 3T51B 1RHPA 1SYEA 1HXYD 3FKIB 5C4JB 4A3LI 4EQOA 3PIO3 3VYTA 1USPB 1K731 4G7HC 5CBAE 1XWEA 1HUNA 3QJYA 2QEX1 4Z9CB 2DE5A 4MD8A 1PXUA 3G6JB 5FK9C 4C1NI 1PDQA 1VQOZ 2NVQI 1SMYC 3HOZI 1WW9A 2A68D 3QO2A 1VQN1 4A3DI 2ICIA 1Z7TA 2H4OA 4WORA 1CQVA 4E33A 1SNOA 1KC82 1LTSD 3V96A 1HTLD 2V8IA 1B9MA 1UUPA 2Q51A 2FJ2A 3TE5B 2NB0A 4CJ1B 4FF1A 1FD7D 3VA5A 3KF8A 2O53A 3CMAZ 3H3VC 3HRZC 1RO0A 1SE4A 4MN3A 1JC7A 3S1RB 2XSCA 2K33A 4IUTA 2LS01 5CORA 2WACA 5KNBA 3PMFA 4A3FB 4XYQA 5FO7B 4QTTA 2FMCA 4C56C 5C4HA 3K7AI 1PZJD 5E4XA 2NUCA 4KV6A 2MP1A 1GXDC 5IP9I 3RZOB 4X6AI 1Q862 4NOZA 3MAQA 2KI7B 1A3TA 1F77A 3CCM1 3ESWA 1IYVA 3NWSA 4DF7A 3J80b 4BWGB 5ELCA 2NN6I 4NBDA 3EQLC 1LT5D 3DEOA 3R3OA 1JOQA 2K32A 5I2YA 4QCLA 1YHQZ 1BUVT 3HOVB 5T6BA 1I4PA 2AQ2B 2JEAI 1RNIA 2NVXI 4HSVA 2AUKA 5A35A 3NUCA 3CMEZ 3CCU1 5KRUA 5IODA 2VUMB 4U673 3I4MI 2PCFB 5LL6X 3VMHA 4KKUA 2QRCB 4ID6A 4A3BB 5E4WC 5BN5A 1SYDA 2IZ3A 5EPLA 1XTCD 1IHZA 5M3FB 3CME1 2EYJA 2RDGA 3GTKI 1Q3LA 5FLXE 1ZB8A 1EZ8A 1CFMA 5EKIA 4OO1G 4G4KA 5D1OA 4DAYA 2RKSA 2L0CA 5CM2M 3H91A 1V43A 2SEBD 3BS1A 2OOXB 1SBBB 2L55A 3A54A 1R9TI 5ELFA 3I70A 3V05A 1M901 1Y8OB 4G7ZC 3GKQA 2A73B 1QCBD 2F0WA 4O42A 3GTLI 2HDLA 1BR9A 1Y1VB 4F8MA 3CU7A 1YJ91 1PRTD 4RGNA 2LKVA 1EEFD 4QMGA 5JAVA 1ENFA 3RZDI 5CBEE 2ZAEB 2HCIA 2SNSA 1AP0A 2RVLA 2NVYI 2RPRA 3TP7A 1WCMI 3GTPI 3NH8A 3KK7A 3LNNA 3NH4A 3MXUA 2BE5D 1YNJC 1PTOC 1TWFB 2QA4Z 4KTAA 2JS4A 2Q8IB 2LIYA 3GD7A 4FNFA 3SE0A 3M4YA 4E6IA 4BXXI 1SEBD 2NVYB 1DOKA 1STBA 3MONA 3T56B 4CJ0B 2ID0A 3EEDA 1LABA 1ZH1A 3CC4Z 1JOKA 1R4QB 1DD2A 4N9TA 5KYLA 4HMJA 5CYUA 5DNFA 3BVZA 3BDCA 3QB3A 4IUPA 2VXWA 3FDTA 3J80E 5A2QL 1IL8A 1QVFY 3H94A 1M902 1PTOD 4B08A 5JEAJ 2O4XA 5I9OA 3S9WA 1X3WA 4NBGA 2B2WC 3DEPA 3TDQA 4IUUA 4OIKA 3GTOI 1W6KA 4A3KB 1PFNA 2BA1A 1EYAA 3MFYA 1Z6HA 3GQBA 3GTMI 1RQFA 2BA0A 4TQUS 4NB8A 4MRIA 1STNA 3MXPA 4EQNA 1QF8A 1DZ1A 2F0JA 3NE5B 3LUSA 4ZQ3A 1B1ZA 2BOSA 2K3RA 1TU2B 4IFDI 3P7JA 3CCMZ 1B9NA 4LMQD 2JMOA 2F4OA 2QDBA 2YU9I 2TMPA 1VQNZ 2FINB 3PUYA 4K2KA 3I8ZA 2R93B 5M9OA 3HZXA 2KUMA 1BXTA 1K8MA 3IFTA 1X3ZA 5JPNC 3CC21 1YJN1 2AWOA 1G291 4DXFA 2XWBB 3SK5A 4DK0A 1OXUA 4JBWA 2GTIA 2A6HC 2DNEA 2EJMA 1EQTA 3CCR1 4PMWA 1U4PA 3ND8A 3GTGB 1D2BA 2NZ1D 2RQXA 4RGMA 2PZWA 1QYPA 3PO3B 2EOTA 4UDUC 4TKOB 5LHY1 1VQO1 4K6DA 1HCZA 2F0OA 1T5EA 1KNAA 4U68A 1A2UA 2PZTA 1QVGZ 2Z1CA 4NB9A 3I551 2EVBA 2K1BA 3G7LA 3JAMf 1CZWA 1SNQA 1X0TA 1SE3A 1F9QA 1LTTD 5T64A 1I3QI 5IIFA 1AW7A 5AFWA 1FYCA 4K8JA 2O2LD 5C5MA 3WOFA 2OZKA 3TP6A 5KIXA 2E2JB 1YUKA 2XVSA 3EERA 1XX8A 2H1EA 3TN2A 2RSOA 1LACA 1DONA 3KLRA 1VQM1 1Z47A 4G7OC 1YI21 1YNJD 1CHPD 4QUCA 2EY6A 3U50C 1PRTF 2QILA 1GUWA 3CCJZ 1VQ71 3K7AB 2KJXA 1Q7Y1 2MJ8A 1QVGY 1ZYRD 3NSWA 5JEAH 2JP1A 3F3FC 3NWTA 2F0HA 1L1OC 3KLSX 4ZK9B 4ZYSA 1S4ZA 1ZB9A 1ESRA 3KIFA 3QIAA 1AN8A 1R4PB 2QKIC 3CPWZ 5DM63 1EY9A 1K8A1 5C6AA 2F0MA 3GTQI 3CCRZ 5IT9L 1S5CD 1AZQA 4QF4A 3CCVZ 1TIID 5EKLA 1BCPB 2B63B 3GTJI 3D31A 2EE1A 1B3AA 5C0XJ 1SYCA 2F0GA 2QR1B 2PMZB 1HQRD 2OF1A 1A3VA 1B50A 2YADA 2BJOA 1HPCA 1S721 3VYUA 3HGBA 2B2VA 1VQLZ 1BCPC 3CCV1 1ZEQX 4NDXA 3FVQA 1SJED 3Q24A 4BBSI 1F2YA 5A2QE 5CV8A 3NBHA 1Q7Y2 1WTVA 4XQJA 3RLFA 2D2CC 3U9OA 3F2UA 1Q821 1A3UA 3R8BA 2J0TD 5FLMI 4KN4C 2F0EA 3M3YB 3HOYI 4FVMA 3I4NI 3L3OC 2BE5C 1FNWA 1QNUA 5JEAG 1DJRD 3BVGA 1NR2A 3I91A 1JWHC 2ENBA 1KTKA 4ME5A 3GP7A 3DM1A 1QJOA 1VQ91 1D5MC 1L0YB 2QEXZ 1X32A 1TWCI 4EQPA 3CRLC 2JA7I 3MZKB 3VR3A 5JVG3 3CCEZ 4A3MI 1OXTA 4ZUIA 2A6HD 4HN7A 2F0DA 2NYZD 4F88A 1TWCB 2F0TA 1I4QA 5CV7A 3FKII 3LWUA 4Y7NB 1AZPA 3CMA1 5EBCA 2A68C 2JA7B 1JORA 5EQ0A 4L6TB 2FFKB 1RTNA 3M4OI 3BYTB 4FXDA 1KNEA 5IGGA 4A3JI 2F03A 4IUQA 1GHJA 4L8JA 1C4QA 4V0BA 2EYLA 1DM0B 3F3PC 2QKDA 4DAPA 2AKLA 1VMCA 4S3SA 3L7ZC 1O80A 1S7MA 3NP8A 1CM9A 2K04A 2ICEC 3HKZB 2QREB 1NUIA 1I50B 2EYHA 5C3XA 4NBCA 4KN7C 1Q90A 1YUAA 5EPJA 2K7VA 1G6ZA 3NXWA 5FOBB 2IT1A 2PMZA 2AQ1B 1ET9A 4I7ZC 1TWGB 1VF7A 3GO5A 4IUVA 1VQ81 1VQ4Z 1XXGA 3SK8A 4HGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCI A;  4IUR A;  1AP0 A;  2RVL A;  1Y1V S;  2NVY I;  4X3U A;  4DN4 M;  2B2Y C;  2B2W A;  1WCM I;  3GTP I;  2RA4 A;  1U4R A;  1HFG A;  4R9W A;  2P3Y A;  2KED A;  4R8I A;  2FHT A;  4X3T A;  1F9S A;  3HOX I;  3VMI A;  2KOL A;  5T1G A;  1WTQ A;  2JS4 A;  2MGS A;  1QE6 A;  1MSG A;  2F4M A;  3Q6S A;  4BXX I;  1DOK A;  2Q8T A;  5T1I A;  3UI2 A;  2RSN A;  4CJ0 B;  3S2D I;  4MH4 A;  4A3C I;  2JYO A;  2L4N A;  2N55 A;  4XT1 B;  1DOL A;  2DE6 A;  5DNF A;  2B2T A;  1HRJ A;  2RBL A;  2HDM A;  4MHE A;  1TWA I;  4IUP A;  2VXW A;  1F2L A;  3FDT A;  3S15 I;  3RZO I;  3I3C A;  1IKM A;  1EIH A;  3MTS A;  4X3K A;  2EPB A;  3HOU I;  1IL8 A;  1RJT A;  4XDX A;  1EL0 A;  2KPI A;  1SFO I;  3GTM S;  1X3W A;  4NBG A;  2HUG A;  2B2W C;  2E2J I;  4A3B I;  3DEP A;  3H0G I;  1CA5 A;  2JNY A;  4IUU A;  4OIK A;  3GTO I;  1WD1 A;  1QNK A;  1WTR A;  1PFN A;  2BDN A;  2X6L A;  3GV3 A;  2KVM A;  2X6G A;  2KEE A;  2N88 A;  3GTM I;  1ZXT A;  1J9O A;  4NB8 A;  1HUM A;  1Y1V I;  3VMG A;  1DZ1 A;  1PFT A;  1IKL A;  3LUS A;  1ILP A;  2DY8 A;  1F9R A;  5D65 A;  3P7J A;  3I90 A;  4NBA A;  4LMQ D;  3IL8 A;  4RAU C;  2F4O A;  1MI2 A;  2YU9 I;  2R93 I;  4CJ2 C;  3PO3 S;  1BO0 A;  1WVL A;  1BNZ A;  1NR4 A;  2FIN B;  1DOM A;  3S1N I;  2D9U A;  5COY A;  3I8Z A;  3LWE A;  3S17 I;  3S1Q I;  1MSH A;  2KUM A;  2R7Z I;  4XX2 A;  1HHV A;  1X3Z A;  2K5R A;  2R92 I;  1ML0 D;  5D14 A;  1LV9 A;  1G2T A;  3MWY W;  5IP7 I;  2L12 A;  1SAP A;  3S16 I;  1RO4 A;  3ONA B;  2JA5 I;  1NAP A;  1EQT A;  1ICW A;  4NBF A;  1U4P A;  1RTO A;  3N52 A;  1K83 I;  2NZ1 D;  1VLA A;  1A15 A;  1QYP A;  1M8A A;  1I6H I;  3S14 I;  4NW2 A;  2EOT A;  1VMP A;  2K01 A;  1TWF I;  1TWG I;  4U68 A;  1KNA A;  1E0B A;  2X69 A;  4ZKB B;  4NB9 A;  1X3P A;  3GTG I;  2K1B A;  3G7L A;  3M3Y I;  4XT3 B;  5JJZ A;  1F9Q A;  1JE4 A;  1RLY A;  1I3Q I;  1EOT A;  2L9H A;  3HOV I;  3FPU B;  5AFW A;  3PO3 I;  4HCS A;  1CA6 A;  2E2H I;  5C3E I;  2B2U C;  1O7Y A;  2DE7 A;  1X3Q A;  2HCC A;  3EER A;  2B63 I;  2DY7 A;  1TWH I;  1HFN A;  1XX8 A;  2H1E A;  3TN2 A;  3IFD A;  2RSO A;  4RA8 A;  1DON A;  1ML8 A;  1G2S A;  1B2T A;  2JA6 I;  2L1B A;  2E2I I;  4QUC A;  4A3F I;  2K03 A;  3HOW I;  3U50 C;  3S2H I;  1WTP A;  1WTO A;  1GUW A;  1HA6 A;  4A3I I;  4RWS C;  2MJ8 A;  3KBX A;  2JP1 A;  5C44 I;  4A3K I;  4UAI A;  1L1O C;  2PK7 A;  1TFI A;  4ZK9 B;  1S4Z A;  1ZB9 A;  1ESR A;  1B53 A;  2NVT I;  4NBH A;  1RHP A;  3GCF A;  4A3L I;  1U4L A;  1USP B;  3GTQ I;  5CBA E;  2L11 A;  1HUN A;  4NBB A;  1AZQ A;  2DE5 A;  1PDQ A;  2NVQ I;  1I50 I;  3GTJ I;  1USP A;  2EE1 A;  1B3A A;  1U4M A;  1PFM A;  3HOZ I;  1N2F A;  1WW9 A;  3QO2 A;  1WTW A;  3PO2 I;  4ZLT F;  3R93 A;  4A3D I;  2K28 A;  1B50 A;  2FMM A;  2BJO A;  2JA8 I;  2MPM A;  2B2V A;  3Q87 A;  4BBS I;  4A93 I;  1O7Z A;  2R3Z A;  2FJ2 A;  1DL6 A;  4NBE A;  2M2L A;  5EPK A;  4CJ1 B;  1JIC A;  1WTV A;  1NCV A;  2J7Z A;  2B2T C;  3F2U A;  1SSO A;  2J6A A;  3KUP A;  4MN3 A;  4IUT A;  5COR A;  2NWG A;  5FLM I;  2KEC A;  3HOY I;  5C4X I;  4QTT A;  3I4N I;  1SDF A;  2IL8 A;  1C8C A;  4A3G I;  1NR2 A;  3I91 A;  3K7A I;  4Y52 I;  5E4X A;  1J8I A;  1EIG A;  2MP1 A;  5IP9 I;  4X6A I;  3DM1 A;  2VUM I;  1PLF A;  1X32 A;  4NOZ A;  1TWC I;  4ZKC B;  3HP3 A;  2JA7 I;  1ROD A;  3ESW A;  3S1R I;  2B2V C;  4A3M I;  5CMD A;  3S1M I;  4OIJ A;  2NYZ D;  1WD0 A;  2SDF A;  2B2U A;  1LQL A;  4NBD A;  3FKI I;  2CVR A;  3DEO A;  4A3E I;  1AZP A;  2NVX I;  4QUF A;  4BY7 I;  1QG7 A;  4HED A;  4HSV A;  2JR6 A;  5EQ0 A;  2FFK B;  1RTN A;  2HF1 A;  3I4M I;  1F9P A;  3VB9 A;  1XYI A;  3M4O I;  1BF4 A;  1Y1W I;  1WTX A;  3VMH A;  4HAE A;  2B2Y A;  1B4O A;  1KNE A;  1G91 A;  5E4W C;  4A3J I;  4IUQ A;  1MGS A;  5EPL A;  1BBX C;  3GTK I;  1Q3L A;  2Q8R E;  1PFB A;  2AKL A;  1VMC A;  3H3V J;  2K05 A;  4BBR I;  1ZB8 A;  1O80 A;  1CM9 A;  4X3S A;  2K04 A;  4BY1 I;  5EKI A;  5C4J I;  1TVX A;  3SVM A;  1NUI A;  5CM2 M;  3H91 A;  3TZD A;  4NBC A;  4ZAI A;  3GV6 A;  1YUA A;  1R9T I;  5EPJ A;  1G6Z A;  3D6W A;  1ILQ A;  3GKQ A;  4O42 A;  4Y7N I;  3I07 A;  3GTL I;  2HDL A;  4QTU A;  5EJW A;  2XIW A;  4IUV A;  3CQZ I;  3RZD I;  5CBE E; 
#chains in the Genus database with same CATH topology
 1UAP A;  4R4Q A;  1IW7 C;  3VR6 A;  4IAL A;  1Y1V S;  1BCP F;  3IX0 A;  1ET6 A;  1HA5 A;  4HJ5 A;  2MUY A;  1C48 A;  1TS5 A;  1U5K A;  2B2Y C;  4MXU A;  2N78 A;  2L5T A;  2RA4 A;  1QXF A;  3J81 L;  1U4R A;  1K8G A;  5J22 A;  2XRS D;  4R9W A;  3BDL A;  4PMB A;  2LMC B;  2R92 H;  5F2D A;  3J7A F;  3EVQ A;  2KED A;  1RO2 A;  4N8F A;  3HOX I;  1ICF B;  2KOL A;  3DMU A;  1EYC A;  2KHI A;  3E6Z X;  2WKC A;  4NMZ A;  2OXP A;  2EIF A;  2V45 A;  3CMA A;  2QF7 A;  4YIJ A;  2IWH A;  2F3W A;  2P5Z X;  3AQQ A;  1W2B Y;  3QOL A;  3S2D I;  1YIJ Z;  3TP8 A;  1VQP Z;  4X64 L;  3I4L A;  2RBM A;  2PM9 A;  4MH4 A;  4LF6 L;  1S72 A;  3HOU H;  2N55 A;  1PH2 A;  1PV4 A;  5KYI A;  1PRT B;  3S2D B;  5BN4 A;  4BA2 I;  1CZG A;  2B2T A;  3CP0 A;  2LFU A;  2L15 A;  4EGV A;  1HRJ A;  4MHE A;  3KLS A;  2PZU A;  5IT9 E;  1TWA I;  4LWC A;  5M3F H;  1F2L A;  3UDI A;  5KNC A;  4FO2 A;  3J81 f;  1RIP A;  2E2H B;  4FP5 D;  3JAM E;  3CQZ B;  5I6Y A;  1D8L A;  2EPB A;  4G57 A;  1VQO A;  3CCQ 1;  3HOU I;  1PRT C;  3HOX G;  4B3T L;  5EKK A;  1FJG Q;  1TWA B;  3I2Z A;  1FJG L;  5C0X H;  1EL0 A;  3T4N B;  5DAU A;  1B3Q A;  1BQQ T;  2F0U A;  2HUG A;  2K5H A;  5TSS A;  4XTC S;  3NDI A;  2E2J I;  4A3B I;  1D5Z C;  2E2J H;  2JNY A;  4FF2 A;  3IRB A;  5JPM C;  5IP7 G;  1I4G A;  3PO2 B;  1WD1 A;  3H0G B;  3J7A V;  1U9R A;  1YHQ 1;  1KDA A;  1LT4 D;  4C3H B;  1TY0 A;  1QZG A;  3C46 A;  2BDN A;  4NKL A;  3GV3 A;  4LF8 L;  4KY6 A;  3MEH A;  4A3I B;  1Y8N B;  2H85 A;  4BY1 B;  3CCU Z;  2K50 A;  1TKW B;  3NDJ A;  4HSP A;  3CXC A;  2Q2U A;  3CD6 Z;  1SND A;  4BY1 G;  4AQY Q;  3VMG A;  1TY2 A;  3OMG A;  3FKI G;  1STH A;  2C5C A;  3KF6 A;  4LK1 C;  4F7X A;  3SR1 A;  2DY8 A;  1F9R A;  2F0P A;  3I90 A;  1N33 L;  1VQM Z;  1IYU A;  1YNX A;  3IL8 A;  1C7Y A;  1W2B A;  4CKC A;  4MD7 A;  1Q81 1;  3J80 i;  2R93 I;  4TVA B;  3PO3 S;  4DV5 Q;  1G8Z D;  1GHK A;  2HQE A;  3BZK A;  1UWV A;  1BO0 A;  3PUW A;  1WVL A;  1TS3 A;  3LX0 A;  4GOP A;  1BNZ A;  4JI4 Q;  1NR4 A;  1UEA B;  3J81 c;  3CXC Y;  2UUB Q;  3D6C A;  3LWE A;  3S17 I;  2KBN A;  4RCO A;  4DAY B;  1TQO A;  2A74 C;  3PQI A;  3HKZ A;  1S5B D;  3OW7 A;  1ML0 D;  1K9M 1;  4ZCK A;  1MIU A;  1PTO F;  1X55 A;  2Z4I A;  2OTL 1;  1LV9 A;  5M3M B;  3T1H Q;  1DYQ A;  3OWE B;  3C1F A;  4GN5 A;  1E2V A;  2L12 A;  4DUZ L;  5LL6 f;  2NVY H;  4NB3 A;  1SAP A;  4MTN A;  1RO4 A;  4DU9 A;  3KJO A;  1LT6 D;  4E2Y A;  2ZJQ A;  3GTO B;  2JA5 I;  1EEI D;  1EY7 A;  2OQ0 A;  4O2D A;  4C3J B;  1V1P B;  1WII A;  3D8G A;  2LY7 A;  1ICW A;  1NNX A;  4KHV A;  4JI4 L;  5GAH C;  3N52 A;  2PPB C;  3MC0 B;  3K5O A;  3A8I E;  3NQI A;  4ZUJ A;  3CXC Z;  1VLA A;  1GOZ A;  5C4X H;  4KLK A;  1EZ6 A;  1HTP A;  3VR5 A;  3DWA A;  1M8A A;  1I4X A;  1I6H I;  4OEM B;  4NW2 A;  1GUS A;  5FO8 B;  3C2P A;  4JI6 Q;  3F8T A;  2VPY A;  3S14 B;  3HG9 A;  5FLX L;  1I6V C;  4I7A A;  2K5Q A;  1E0B A;  2N49 A;  3UE0 A;  4TSS A;  4DV0 Q;  3PUV A;  4R4T A;  2KCT A;  2EY2 A;  1X3P A;  5JOB A;  4TRD A;  3H3V H;  5G3L F;  1KD1 C;  3A8J E;  5KND A;  4HJA A;  2E2I B;  3T13 A;  1RLY A;  4C1N K;  3CPW Y;  3FKI H;  2KCM A;  2VUG A;  1XPU A;  1HNW Q;  2C9O A;  2L9H A;  1JWM D;  1H9M A;  4A3K H;  1AE3 A;  1IBM Q;  4BBR B;  5LMN Q;  1CA6 A;  1PHJ A;  5JVH 3;  4P75 A;  2E2H I;  3EJI A;  3D4R A;  2F0L A;  3OWF A;  5GAE C;  3RUZ A;  3IF8 A;  1ZYR C;  5KGU A;  1TWH I;  4C3J G;  2C35 B;  3M85 A;  3C3L A;  1HFN A;  1EU4 A;  1S72 Z;  4J1M A;  4HCE A;  2JA6 B;  3BU2 A;  1D6E C;  1VQP A;  2KHJ A;  1ML8 A;  5M5W H;  5IWA Q;  2N3S A;  2L1B A;  4IFD G;  1MBY A;  4P71 A;  1JJ2 Z;  1IBK Q;  2K6A A;  4AYB B;  1T5X D;  4A3F I;  3NPP A;  1Q12 A;  4DAV A;  3FPP A;  4MON A;  1LTB D;  3EFX D;  1WTO A;  2PI2 E;  1TWH H;  2XWJ B;  1GVP A;  2W04 A;  2CWA A;  4A3I I;  4RWS C;  1H95 A;  1KAB A;  5E7N A;  2Y0S A;  1YZ6 A;  2EYP A;  4X65 L;  4GOP C;  1JT8 A;  2F0V A;  1RD9 D;  5AN9 F;  1D5X C;  5C44 I;  1PTO H;  4RV9 A;  1KXL A;  3I72 A;  3D2L A;  4UAI A;  5C4X G;  4ODG A;  1R9T B;  4JI0 L;  1Q16 A;  1JR0 D;  5IP9 H;  1ASY A;  1EIY B;  3CPF A;  4YWK A;  1II3 A;  4NBH A;  4GKJ Q;  4Y52 H;  5C5L A;  2OEO A;  4YY3 L;  4A93 H;  2E9H A;  3X3N A;  3GCF A;  3VA7 A;  1LTI D;  2IX0 A;  4DV7 L;  1U4L A;  1Q1B A;  3OHX C;  2JK8 A;  4DR5 Q;  1NY4 A;  5J39 A;  4A3D H;  3G4S Z;  4K2L A;  1TS2 A;  2L11 A;  4NBB A;  3WOE A;  1NJI 1;  4HJ8 A;  3L9A X;  4I65 A;  2WAQ A;  3J80 L;  1I50 I;  4KY5 A;  1HNZ L;  3CCE 1;  1Y1W G;  1U4M A;  4J15 A;  3VR2 A;  1N2F A;  1WTW A;  3PO3 H;  3R93 A;  2K28 A;  4DAM A;  3S1N B;  2G2K A;  1JJ2 Y;  1GUO A;  2PW7 A;  3PIP 3;  3TDH B;  4DV2 Q;  3JAM L;  1TS4 A;  4HMI A;  3GTL B;  3RN2 A;  5AJ3 Q;  1A2T A;  4YCV A;  2EY5 A;  4EWC A;  1LO5 D;  4DR1 L;  3AB9 A;  1KC8 1;  2R3Z A;  3JC6 6;  1YIT Z;  5ELE A;  5EPK A;  1FNU A;  3DWP A;  3PO3 G;  1N34 Q;  3CCS 1;  3SXH A;  4HH4 A;  1VF5 C;  2CHB D;  2B2T C;  4HR7 B;  1VQD A;  4CDD C;  3ND9 A;  3VTN A;  1PYS B;  1XMO Q;  3KUP A;  3BYY B;  3CW2 C;  2OTL A;  2WKD A;  1FVI A;  4CDC C;  1NMG A;  1OXV A;  1SRU A;  3T53 B;  4DR5 L;  3OYY A;  1YIJ 1;  1EQQ A;  2YU9 H;  5C4X I;  3G6E Z;  3CCS Z;  1SDF A;  5C44 G;  2VB3 X;  3P5J B;  5CC4 A;  2EQS A;  2A69 C;  2IL8 A;  4CGY B;  3HOY B;  4A93 B;  4JG2 A;  4PG3 A;  2NVX B;  4DR2 L;  4K14 A;  3I4N G;  4ILW A;  2N8N A;  4LJZ C;  2VQE Q;  1E24 A;  1VQ4 A;  1PYW D;  4HID A;  2VUM I;  1PLF A;  2B29 A;  4MIU A;  5CV6 A;  2NN6 G;  3QOJ A;  4YWL A;  2D0P A;  3K5L A;  3HP3 A;  5C44 H;  2QA4 1;  1QB5 D;  3OW2 A;  1K0R A;  3S1R I;  3KDF B;  4PQX A;  5CMD A;  3S17 H;  3S1M I;  3ER0 A;  2EXD A;  4OIJ A;  3HOV H;  3AFP A;  4QJF A;  5FKA C;  5IGC A;  2QEJ C;  4BBS B;  1LQL A;  1S5E D;  4TNU A;  2W03 A;  3MHB A;  1N32 Q;  3TZU A;  2CVR A;  2M00 A;  3OMC A;  1VQ8 A;  2JE6 I;  1SYG A;  3S2H H;  2DNC A;  2K14 A;  4CDF C;  2KCC A;  1PMR A;  5GQO A;  4QUF A;  4BY7 I;  3SK6 A;  1QG7 A;  3K0X A;  5I4D A;  3S15 B;  2V8K A;  2JA6 H;  4KKS A;  5ELB A;  1DCZ A;  2JR6 A;  1QVC A;  2AWN A;  2WB1 E;  2XNA C;  5CR3 A;  2VPZ A;  2HF1 A;  1F9P A;  3RZO H;  3S15 H;  2WB1 A;  3VB9 A;  1XYI A;  3CCL 1;  5BR8 L;  1KD1 1;  4HAE A;  1E1O A;  1SIW A;  1CKN A;  3M7N A;  1PH7 A;  4CKE A;  4UP7 A;  1FGU A;  1K8O A;  1SNC A;  1K83 H;  5K36 G;  2F4I A;  1CUK A;  3W5O A;  3AEV A;  2ATW A;  3R2I A;  3SGI A;  2CQA A;  1QZH A;  3NK9 A;  2HU9 A;  3RZD B;  5H1S E;  2YTY A;  3K6O A;  3KF8 B;  4DQY B;  4BY1 I;  4X3S A;  3M4O B;  3OTO Q;  5C4J I;  1TVX A;  3SVM A;  2IZ4 A;  3FQM A;  1L2F A;  3O13 A;  3TZD A;  1B70 B;  1EQV A;  2RHS B;  2LSS A;  4HTH A;  3GV6 A;  1EFI D;  1FL0 A;  2RHB A;  2R7Z H;  1VQP 1;  3HOZ B;  3PUZ A;  1T9H A;  2UUC L;  2WIN B;  3NHH A;  1S5F D;  3S1Q B;  1TWF H;  3EIV A;  5E3F A;  1ILQ A;  3HEJ A;  5IOC A;  2VUM G;  4Y7N I;  3I07 A;  3CCR A;  1STA A;  5C4X B;  1GJX A;  4KJO A;  3CPW A;  2MHV A;  3VYS A;  1K9M C;  2XIW A;  1B8A A;  4BY7 B;  5I2X A;  2R92 G;  1M1K 2;  3P75 A;  1RKN A;  3RR5 A;  3GTQ B;  2R7Z B;  3CQZ I;  1V8Q A;  1KDC A;  1KRS A;  1VQ7 A;  3K58 A;  4IZ8 A;  1O7I A;  1M1K 1;  4IUR A;  1FDI A;  5BN3 A;  2OTJ Z;  3FMC A;  3ERS X;  4A3E G;  1J5E Q;  1H9S A;  4X3U A;  2NVQ B;  5IT9 c;  4DN4 M;  3RN5 A;  4OX9 Q;  3SK4 A;  2B2W A;  2IY5 B;  1SXT A;  4K5W A;  3CHB D;  4NXM L;  1Y1V H;  1VQ5 1;  3I56 1;  3BG3 A;  5L37 A;  3I55 A;  1PFS A;  3QWN A;  1SRO A;  1RL2 A;  4IN3 A;  3IAY A;  3A7L A;  2P3Y A;  1M4V A;  3ZJY C;  3K7U C;  2FHT A;  4X3T A;  1F9S A;  3D3R A;  3URY A;  4A75 A;  4DK1 A;  3BVM A;  3VMI A;  2RDH A;  1Q7Y C;  3S1N H;  1WTQ A;  1E3P A;  3NTK A;  1LTG D;  4A3I G;  1HZC A;  1MSG A;  1VCI A;  2AHO B;  3BDO A;  4DNR B;  2HIV A;  3UI2 A;  4JI5 L;  4DGZ A;  2O4H A;  1GUG A;  1L0W A;  1F2M A;  1Z03 A;  1Y8C A;  4YCU A;  2P28 A;  2JA5 B;  1H9S B;  1RF2 D;  5CV5 A;  2JYO A;  4DR3 Q;  1ENC A;  3FHW A;  4XT1 B;  3PUX A;  1DOL A;  4NP5 A;  3RMH A;  3SEB A;  3NTH A;  4DFA A;  5IWA L;  3S2H B;  4M1U B;  5A2Q f;  2MO0 A;  1KD1 2;  2EYM A;  3I4N B;  1F2Z A;  3CCL Z;  1SYB A;  3RZO I;  1VQ9 Z;  5ELD A;  3S17 B;  3CF5 A;  3K57 A;  4POF A;  4LFB Q;  3UE1 A;  1RJT A;  2F0N A;  4JI1 Q;  5C44 B;  4XDX A;  2KPI A;  1K28 A;  1SFO I;  5IYB G;  5CV4 A;  4IFD J;  3DWQ A;  1BVS A;  1KRT A;  3GTM S;  2ES2 A;  4XYO A;  2J4X A;  5IGF A;  1DXM A;  3X3M A;  2K5D A;  3BG1 B;  4IJH A;  1CA5 A;  3IKJ A;  4BA1 I;  3V2T A;  1KIX A;  2B8F A;  4S1T A;  5C0X I;  1KLU D;  1PZI D;  2Q4Z A;  4A3C G;  1Q1E A;  3STB D;  3S1M H;  5CV9 A;  1J5E L;  2X6G A;  1HH2 P;  2IHE A;  4JV5 Q;  5IYB H;  1BBU A;  4DV0 L;  2YU9 B;  4B3T Q;  1J9O A;  2M9V A;  4L5Q A;  1HUM A;  1Y1V I;  5D3D A;  4OGQ C;  4LF5 L;  2QLV B;  2K52 A;  1EIF A;  1PFT A;  3CCJ A;  2NTT A;  4J8Q A;  1QUQ B;  2GU2 A;  1ILP A;  5M5Y B;  1YNN D;  3TEH B;  1EYD A;  1JB3 A;  1PH3 A;  4NBA A;  2ZXO A;  4RAU C;  1RDP D;  3PGZ A;  3CC2 Z;  1YJN Z;  1MI2 A;  2AQ3 B;  4RFB A;  3DLL A;  1Q81 2;  1DGS A;  4CJ2 C;  2UUA L;  1G6P A;  1YJW 1;  4JOI C;  2O5J C;  1I4R A;  3GTL H;  5GAD C;  1DOM A;  3CCQ Z;  1AEX A;  4XQN A;  1NSN S;  1VQ5 Z;  1FNV A;  4RGO S;  3CCQ A;  1MSH A;  3S1R H;  4H7B A;  3OIQ A;  1KC8 C;  1AFP A;  3D9X A;  4PZ8 A;  2R7Z I;  4DK6 C;  1WJ2 A;  1HHV A;  2K5R A;  5D1O B;  1N9W A;  4P74 A;  1EFW A;  4RHS A;  1GUN A;  2VNU D;  1BOS A;  4RKL A;  2A6E D;  2KHS A;  3KDF A;  1G2T A;  1KRL A;  3MWY W;  5DEH A;  1Q82 2;  1E2W A;  1XMQ Q;  3CCM A;  3S16 I;  2JA8 B;  2JSO A;  4OWW B;  5IGD A;  2NAP A;  4CL1 A;  1EY0 A;  1NAP A;  2K5N A;  3IFU A;  3A55 A;  3KBG A;  4NBF A;  1Z02 A;  4GLV B;  2Q2I A;  3PV0 A;  2UXD L;  3SHL A;  2Z9H A;  4JI3 Q;  1I4H A;  4QQB X;  2VB2 X;  1MJC A;  3DHQ A;  2HQL A;  1I3Q B;  3NH5 A;  3CC4 1;  1EY4 A;  3HOZ H;  1QWY A;  2B3G A;  2ZXR A;  3S14 I;  1LLR D;  2AYD A;  1KQS Y;  3G6E 1;  1QUQ A;  4HIK A;  1Y1W H;  1BDO A;  2KA7 A;  3HOX B;  1I6H B;  1NJI 2;  1R9T H;  5D1P A;  2HIX A;  1KLG D;  2GA4 B;  3FQQ A;  4YCW A;  1PTO B;  2X69 A;  4ZKB B;  3DXJ C;  1SMY D;  3UDG A;  4Q5V A;  1JQY D;  2JIR A;  1E22 A;  2F0K A;  3E0J A;  5KEE A;  4A3D G;  2I46 A;  3ITP A;  3M3Y I;  1QVF Z;  4A76 A;  1LTR D;  4B3M L;  5FLM G;  3AFQ A;  5C4J H;  1JE4 A;  1HZB A;  2V8J A;  1H9J A;  4K5V A;  1LYL A;  1JWS D;  2BH8 A;  5JJK A;  1SLJ A;  2IPK D;  1M1K C;  3G4S 1;  3ULL A;  5DM7 3;  1SR3 A;  1S5D D;  2CW0 C;  3NEM A;  2SNM A;  3HOV I;  3P20 A;  4KD3 A;  3FPU B;  4A3M H;  1SYF A;  2IJ0 A;  5J1Z A;  3A56 A;  2WB1 G;  5C3E B;  1X56 A;  4GOP B;  1YI2 Z;  1Y8P B;  3W2D A;  4FDB A;  4OX9 L;  1O7Y A;  2EXZ A;  4RGT A;  3M7G A;  2YYZ A;  4WJ3 M;  1VQ5 A;  4P72 A;  1E1T A;  4B9W A;  2OOY B;  1VQK 1;  1UNS A;  1GO3 E;  3Q8D A;  4RA8 A;  3RLN A;  1G2S A;  4KMU C;  2VF1 A;  1W6J A;  1Z9F A;  2JA8 G;  4JI6 L;  2Y0S G;  2EY1 A;  5M5X H;  3TS2 A;  1XNR Q;  4C3H H;  3A0J A;  4C2M H;  1YIT 1;  2F52 A;  1JJG A;  3AYH B;  4DV1 Q;  4NXN L;  2EYF A;  4OXP A;  4C3I B;  1HA6 A;  2BDO A;  4CBV A;  1D1I A;  4C3I G;  1VQ4 1;  1YJW Z;  3HOW G;  3KBX A;  5NUC A;  4RVD A;  3OIP A;  4FF4 A;  1I5F A;  1YNN C;  3MA2 B;  4JYA Q;  1SNP A;  4A3K I;  3J81 b;  2PK7 A;  2GTH A;  3HOZ G;  1TFI A;  2XRQ D;  3ZYY X;  1WCM B;  2E74 C;  1N34 L;  3FRP B;  4GN4 B;  1VQ7 Z;  1B53 A;  4DGL A;  2NVT I;  2Y0S B;  2NZO A;  4MD9 A;  3E5S A;  5LMU Q;  1SE2 A;  2LFN A;  1HR0 W;  2KQ3 A;  4DV7 Q;  3HOU G;  4HJ7 A;  3TP5 A;  3TBI B;  1D1K A;  1S3O A;  5LL6 S;  5HY6 A;  3HOU B;  4AYB A;  1X54 A;  4HIM A;  1EQR A;  3F2B A;  2QCP X;  3OTO L;  5FLM H;  3GDE A;  5BR8 Q;  4HIO A;  1LT3 D;  2B39 A;  4R4I A;  1CI3 M;  1GD7 A;  1A6X A;  1USP A;  1VQ9 A;  3L0O A;  3JAM b;  1IW7 D;  1HNZ Q;  3CCL A;  1PFM A;  3C1E A;  3PIO A;  2EYO A;  3CRK C;  1JMC A;  3K8A A;  3PO2 I;  4ZLT F;  1C9O A;  2I0Q A;  4PMC A;  4RG1 A;  1KQS Z;  1Y1W B;  4LF8 Q;  2FMM A;  2JA8 I;  2MPM A;  5C0X G;  3Q23 A;  2LEX A;  4JK1 C;  1N8R 2;  2UUB L;  1E2Z A;  3Q87 A;  1I3Q H;  4A93 I;  5FLX b;  4E31 A;  1O7Z A;  3NFZ A;  3CC7 1;  1IBL L;  1XNQ Q;  4IPG A;  1YHB A;  5IP7 H;  4LUZ A;  1DL6 A;  4WRD A;  4NBE A;  2M2L A;  4NFR A;  3CKI B;  1N8R 1;  4BBR G;  1EY8 A;  1ZKO A;  5I9P A;  4JI7 Q;  1JIC A;  1CTM A;  1K9M 2;  4XXE A;  1E7Z A;  5C3W A;  4WFN 3;  2HT1 A;  2JA8 H;  1N32 L;  1NCV A;  2J7Z A;  1K73 2;  1JCK B;  1SN8 A;  3OPO A;  4C3H G;  1SSO A;  2J6A A;  2PQE A;  2QA4 A;  4X66 L;  4DV4 Q;  3BZD B;  4LFB L;  1U0L A;  4KK7 A;  2GVA A;  4XIG S;  4JVZ A;  1UE7 A;  2NWG A;  1A0I A;  1PZK D;  1Z01 A;  2DGY A;  2KEC A;  4KJN A;  3I55 Z;  1OO9 B;  3HOW H;  2QGQ A;  2D62 A;  3MXG A;  1C8C A;  4A3G I;  2WB1 B;  3MZ5 A;  2OTJ A;  4DR2 Q;  4JI7 L;  4R8N A;  4JC0 A;  3KIH A;  1B44 D;  3M4Q A;  4Y52 I;  3TS0 A;  1J8I A;  3J7Z C;  1EIG A;  1EWC A;  5HUR A;  2R6M A;  1ONL A;  2TSS A;  4LF6 Q;  2QRD B;  3OW2 Z;  2YTX A;  4K5X A;  4KHZ A;  5M5Y H;  1M90 C;  3G71 Z;  4KY7 A;  4ZKC B;  3JAM i;  1ROD A;  2VW9 A;  2EJF C;  2EGT A;  2K5V A;  2IW3 A;  4OL7 A;  2B2V C;  3FP9 A;  2SOB A;  1WD0 A;  3E9H A;  4YHH L;  2SDF A;  1HNW L;  2B2U A;  2DN8 A;  3MVV A;  4A3E B;  1GM5 A;  2ZTD A;  4PNY A;  4UY8 C;  2NTS A;  1K3R A;  4A3E I;  1Q8I A;  2UU9 Q;  5M5W B;  3G71 1;  4L63 B;  1OXS C;  3KJP A;  3G6E A;  1CKN B;  1SFO H;  4HED A;  1Y14 B;  4DXG A;  5K36 H;  2PW5 A;  5IYC G;  2O5I C;  1BCP D;  2QDL A;  3T16 A;  3CCJ 1;  4DK3 C;  2JUB A;  1HZA A;  1BF4 A;  3H09 A;  2ZXP A;  1Y1W I;  3MZL B;  1WTX A;  1OXX K;  4LAA A;  1SNM A;  2B2Y A;  2AUJ D;  1B4O A;  1CKM A;  1G91 A;  2I07 B;  2MQH A;  2RIQ A;  1SMX A;  5GRO A;  5HGT A;  4LF4 Q;  3GTK B;  1MGS A;  4E30 A;  1CHQ D;  1FGB D;  1YIT A;  4IQZ A;  3M9B A;  1BBX C;  4JV5 L;  2M48 A;  2ZT9 C;  1NUC A;  2R92 B;  2Q8R E;  3N6R A;  1PFB A;  2I3C A;  3H3V J;  2HD3 A;  2K05 A;  4BBR I;  4EQ5 A;  3CME A;  4OO1 I;  3BJU A;  4K6L A;  3T1Y L;  1H9R A;  3D4W A;  4RVG A;  1O7L A;  1K8A 2;  4YHH Q;  3HS0 C;  4Q0F A;  4H44 C;  3AU7 A;  3TSS A;  2WV6 D;  2IX1 A;  4M8A A;  3K5N A;  2NVT B;  4ZAI A;  1VQ8 Z;  1MD2 D;  1I94 L;  3P1H A;  2XN9 C;  4A3M B;  2MFI A;  4P2C B;  4CHT B;  3CD6 1;  1TWG H;  3D6W A;  3J81 E;  5J3B A;  3G4S A;  2JIM A;  4UHV A;  4RVH A;  1JOO A;  1JWU D;  4H13 C;  3NBI A;  4KKT A;  3ULP A;  1PYB A;  4QTU A;  1H9K A;  5EJW A;  2R61 A;  1STY A;  3OSO A;  5K5P A;  4FF3 A;  2RT9 A;  2F0F A;  4ABN A;  2WAQ B;  1STE A;  4A3C H;  4PV1 C;  4RCN A;  3S16 B;  3SDZ A;  4IFD H;  1FR3 A;  2WAQ E;  4EVO A;  4DNT B;  1IBM L;  2B8G A;  3S16 H;  4AYB E;  4A3B G;  2G9D A;  4OON A;  5G3L D;  3A8K E;  2G9H D;  2F3V A;  2V4D A;  1HFG A;  3OOC A;  2EDG A;  3K81 C;  5EGT A;  1VQA A;  3MXN A;  5T67 A;  4JI3 L;  3Q0A A;  4R8I A;  2OTL Z;  4RMF A;  5IYD G;  1EY5 A;  2CH4 A;  5T1G A;  3F1Z A;  2PNR C;  2MGS A;  1X9N A;  5IP9 G;  1WCM H;  1QE6 A;  4WJW A;  4RHR A;  1KL9 A;  4RS4 A;  2F4M A;  3Q6S A;  3CC7 A;  4QB4 A;  2Q8T A;  5T1I A;  4E2X A;  2PQA B;  3KFU A;  4A93 G;  3GTJ B;  2RSN A;  2NZH A;  2Q2T A;  2JIP A;  1KAW A;  4IOC A;  3DUZ A;  1EU3 A;  4A3C I;  5IGE A;  2L4N A;  2PI2 A;  1ESF A;  4GLX A;  4FYD A;  4HGZ A;  3WDN A;  3GTP B;  4DR6 Q;  2DE6 A;  4KI0 A;  2Q2H A;  1VQK Z;  2FXQ A;  1WCM G;  2A69 D;  3I4O A;  4DA2 A;  2RBL A;  2HDM A;  4Y7N H;  5ISR A;  4C2M B;  4GNX A;  1K83 B;  3NTI A;  4QIW B;  2OT2 A;  3PCO B;  4RH6 A;  1VQ6 1;  3S15 I;  3I3C A;  3J7A 4;  4KD4 A;  4QIW E;  3U4Z A;  4DUZ Q;  5I6W A;  1IKM A;  1EIH A;  3MTS A;  4R4O A;  4X3K A;  1PA6 A;  4LF4 L;  1K73 C;  4AYB G;  2UUA Q;  2OTJ 1;  2PQA A;  4F87 A;  4LF7 L;  3I73 A;  1CQF A;  3K5M A;  3VR4 A;  5D3I B;  1WOC A;  1SE8 A;  3PIP A;  4JOI A;  1SFO B;  2JA5 G;  1TXY A;  4B3S L;  2Z0S A;  3H0G I;  1CSQ A;  4X62 L;  4OO1 H;  4IJL A;  4K8I A;  4B3R Q;  1QNK A;  2JXM B;  3DM3 A;  4B9X A;  4B3R L;  1WTR A;  1EOV A;  1O78 A;  2X6L A;  2KVM A;  2LXJ A;  2JA9 A;  1L0X B;  2KEE A;  1V9P A;  1KHI A;  2N88 A;  5M3M G;  1CK1 A;  4NH1 C;  2D5D A;  4GLA C;  1ZXT A;  4JI8 L;  3ERO A;  1WJJ A;  4BS9 A;  4RKB A;  2E2D C;  3E3X A;  3HKS A;  2EZV A;  1YJ9 A;  1WYD A;  1IKL A;  5JJL A;  1N36 Q;  2OWO A;  2XGT A;  2ZTE A;  1VQI A;  5D65 A;  4A3M G;  1EWH A;  1LTL A;  1VDZ A;  1Q86 1;  5GAG C;  1JJ2 A;  3I56 Z;  2PO4 A;  4LF7 Q;  2NBF A;  1V1O A;  1V1P A;  2NN6 H;  3HOW B;  1LTA D;  1HQM C;  2F0I A;  3S1N I;  2D9U A;  5COY A;  3S1Q I;  2JEB I;  4O1N A;  4RVF A;  4XQQ A;  1WZN A;  4XX2 A;  1VQ6 A;  2R92 I;  3FEW X;  5D14 A;  4OWT B;  2UXC L;  1W2B Z;  3A74 A;  2E75 C;  3NQT A;  1QOH A;  2AKW B;  2F1M A;  3HOY G;  5IP7 I;  2EJG C;  1EY6 A;  1VQM A;  1GUT A;  2M6N A;  3H0G G;  2VQE L;  2K5W A;  3QG1 A;  1Q86 C;  3ONA B;  2A1A A;  3K0Y A;  4E32 A;  2JA6 G;  1LUZ A;  3J80 f;  1UE6 A;  1RTO A;  3F2C A;  4DPG A;  4B3M Q;  1K83 I;  4E2W A;  3W3A A;  3CD6 A;  4H0L C;  5IT9 f;  1A15 A;  4N9P A;  4DV3 Q;  5E1F A;  4ULL A;  4OHJ A;  5C4Z A;  1K8A C;  2Z4H A;  1VMP A;  5C3E G;  2WII B;  2RDF A;  2K01 A;  2VZA A;  2NVQ H;  1TWF I;  1TWG I;  2WP8 J;  4GNX C;  2A5H A;  4BBS G;  3D4D A;  2A6E C;  3D0F A;  4ZRZ A;  4J6H A;  1RCV D;  2VQF Q;  4DUY Q;  1P9N A;  3E9I A;  3A7A B;  1L1O B;  4LUO A;  3GTG I;  4GZY C;  2Z8L A;  3J7Y W;  1VQB A;  4XT3 B;  1YEZ A;  4BY7 H;  4GS3 A;  1NP6 A;  3TME A;  5JJZ A;  2F0S A;  3HKZ E;  4A3D B;  4EX5 A;  3MFG A;  3R2T A;  4L5S A;  4B3S Q;  2GVB A;  3BZC A;  4IPH A;  2VL6 A;  1NTG A;  3ERQ A;  3Q22 A;  2UXC Q;  4H02 A;  2IX3 A;  3RD4 A;  1EOT A;  3S1M B;  4L5T A;  5IT9 b;  2R7Z G;  4A3G G;  1C0A A;  3PO3 I;  4HCS A;  1Y69 U;  4A3G B;  1CT1 D;  3QWU A;  1UE1 A;  1UE5 A;  5C3E I;  1VQK A;  1VQ6 Z;  2B2U C;  2WFW A;  3H6M A;  4IUN A;  2DE7 A;  5EAY A;  4V19 0;  1X3Q A;  2VUM H;  2F0Q A;  2GN5 A;  2HCC A;  2B63 I;  2DY7 A;  3M4O H;  1QIL A;  4CKB A;  3IFD A;  1HNX L;  4A3J B;  5AJ3 L;  4C3I H;  3U9S A;  5FLX f;  4LF9 Q;  1YIJ A;  1VQL 1;  2E76 C;  4POG A;  1B2T A;  2JA6 I;  4A3L H;  3I56 A;  1TWH B;  1SJH D;  4FXK C;  3CC7 Z;  2KCN A;  1XNR L;  2R6G A;  2E2I I;  1STG A;  5IGB A;  5M5X B;  4FXG C;  3I4N H;  2K03 A;  3EA6 A;  3HOW I;  1KDB A;  5CGK A;  2PYK A;  3S2H I;  5LMU L;  1WTP A;  2BCO A;  3A5U A;  3K59 A;  4E2Z A;  3T4A C;  5A2Q b;  3BG0 B;  2RCN A;  3U58 A;  1YJ9 Z;  4AQY L;  1X6O A;  2A8V A;  3OW2 Y;  1TT2 A;  3CCU A;  2JIO A;  4JYA L;  3JAM c;  1ENA A;  2XTI A;  1OTC A;  2K4K A;  2Z6B A;  3I4M B;  3GTM B;  5FO9 B;  4OWX B;  5EBD A;  1TR5 A;  3VYR A;  2CW0 D;  1KAA A;  1X3E A;  2HHH L;  4DKA C;  3AMU A;  4BBS H;  5LMN W;  3T51 B;  1RHP A;  1EYG A;  1SYE A;  3M3Y H;  4GKK L;  3HKZ G;  1HXY D;  3FKI B;  5C4J B;  2Z6K C;  5IYC H;  3GTG H;  4A3L I;  4EQO A;  3PIO 3;  3VYT A;  1USP B;  1K73 1;  4G7H C;  5CBA E;  4PZ7 A;  1XWE A;  1HUN A;  2F4V Q;  3QJY A;  2QEX 1;  4Z9C B;  2DE5 A;  4MD8 A;  2VY3 A;  1PXU A;  3G6J B;  5FK9 C;  4C1N I;  1PDQ A;  1VQO Z;  2NVQ I;  1SMY C;  2JJQ A;  5FJ8 H;  1UEB A;  2VPX A;  3RLO A;  1I6H H;  3HOZ I;  1WW9 A;  2A68 D;  3QO2 A;  1VQN 1;  2JQO A;  3GTQ H;  4A3D I;  2VPW A;  2ICI A;  4DV6 Q;  4ALP A;  1Z7T A;  4IOA A;  2H4O A;  4WOR A;  2YTV A;  1CQV A;  4E33 A;  3E0E A;  2DJF C;  1SNO A;  1VQE A;  1KC8 2;  1LTS D;  4LFC Q;  1HR0 L;  3V96 A;  1HTL D;  4DV3 L;  2V8I A;  1B9M A;  1N36 L;  1UUP A;  2Q51 A;  2FJ2 A;  3TE5 B;  2NB0 A;  4CJ1 B;  3H3V I;  2K75 A;  4FF1 A;  1FD7 D;  1VQC A;  3VA5 A;  1WFQ A;  3KF8 A;  2O53 A;  4A3L G;  3CMA Z;  4JI2 Q;  3H3V C;  3HRZ C;  5HGQ A;  4APV A;  1RO0 A;  1XMO L;  2ZTC A;  1SE4 A;  4DV6 L;  4MN3 A;  1JC7 A;  1L1O A;  1PH1 A;  2E7Z A;  3NEN A;  3S1R B;  3PF4 A;  2XSC A;  2K33 A;  4IUT A;  2LS0 1;  5COR A;  2WAC A;  5KNB A;  2OQK A;  3PMF A;  4A3F B;  4XYQ A;  5FO7 B;  4QTT A;  2FMC A;  2ZM6 L;  2PMZ E;  4O0A A;  4C56 C;  1K0S A;  5C4H A;  3K7A I;  1PZJ D;  1N8R C;  4LFA L;  5E4X A;  1PVO A;  2NUC A;  1V1Q A;  4KV6 A;  2MP1 A;  2E5L L;  2IV2 X;  1GXD C;  1WTH A;  5IP9 I;  3RZO B;  4X6A I;  1Q86 2;  3CCE A;  2CWP A;  4NOZ A;  4A3F G;  3KOJ A;  3MAQ A;  4LF5 Q;  4KHP Q;  2KI7 B;  1A3T A;  1F77 A;  3M4P A;  3CCM 1;  1JJC B;  3ESW A;  3T1Y Q;  1IYV A;  3NWS A;  4DF7 A;  3J80 b;  2I5H A;  4A3I H;  2V3V A;  4BWG B;  5ELC A;  2NN6 I;  4NBD A;  3EQL C;  1LT5 D;  3DEO A;  3R3O A;  3STB C;  1JOQ A;  5IY0 A;  2K32 A;  5I2Y A;  1X65 A;  4A3B H;  4QCL A;  1YHQ Z;  4DV1 L;  4N8X 1;  1BUV T;  3HOV B;  5T6B A;  1I4P A;  1VQH A;  2AQ2 B;  3A5Z B;  1RNI A;  2NVX I;  2JEA I;  1MJE A;  5IE8 A;  4HSV A;  4WJ4 A;  2AUK A;  5A35 A;  3NUC A;  3CME Z;  3CCU 1;  1J6Q A;  5KRU A;  5IOD A;  2VUM B;  4U67 3;  3I4M I;  2PCF B;  4MZ9 A;  5LL6 X;  4MTK A;  1TWA H;  3VMH A;  4JBK A;  4KKU A;  2QRC B;  4ID6 A;  4A3B B;  3ICE A;  5E4W C;  4JI2 L;  5BN5 A;  2E2H H;  2BH2 A;  2KEN A;  1YHA A;  4GKJ L;  1SYD A;  2UU9 L;  2IZ3 A;  5EPL A;  5FLX c;  1XTC D;  1IHZ A;  5M3F B;  3CME 1;  2EYJ A;  2RDG A;  3GTK I;  1PH9 A;  1Q3L A;  2E8G A;  5ELO A;  5FLX E;  2WAQ G;  3S2D H;  1PH6 A;  1Q46 A;  3EN2 A;  1ZB8 A;  1EZ8 A;  3CAM A;  1CFM A;  2JA5 H;  2F4V L;  5EKI A;  4OO1 G;  5D1O A;  4G4K A;  4BXX H;  4P73 A;  4DAY A;  2RKS A;  2L0C A;  5CM2 M;  3H91 A;  3KYH C;  1V43 A;  2SEB D;  3BS1 A;  4HJ9 A;  2OOX B;  1YBY A;  1SBB B;  3TRZ A;  4A3K G;  2L55 A;  2UXB L;  2D0O A;  3A54 A;  1R9T I;  5ELF A;  3I70 A;  3V05 A;  1M90 1;  1Y8O B;  3CCV A;  4G7Z C;  3GKQ A;  2ALY B;  2A73 B;  1QCB D;  2F0W A;  2RF4 A;  4O42 A;  3GTL I;  2H5X A;  3G71 A;  2HDL A;  3LGJ A;  4DR3 L;  1BR9 A;  1Y1V B;  2QEX A;  4F8M A;  3CU7 A;  1YJ9 1;  1PRT D;  3KF6 B;  4RGN A;  2LKV A;  1EEF D;  4QMG A;  5JAV A;  1ENF A;  3RZD I;  4CDE C;  5CBE E;  4K0K L;  2RHQ B;  1MHW C;  5IYD H;  2ZAE B;  2HCI A;  2SNS A;  1AP0 A;  2RVL A;  2NVY I;  2RPR A;  3J81 i;  3W1G A;  3TP7 A;  1WCM I;  3GTP I;  3NH8 A;  4DV2 L;  3J7A 5;  3J80 c;  2G5D A;  3KK7 A;  3LNN A;  1YJW A;  4QL5 A;  3IR7 A;  4LF9 L;  3NH4 A;  3MXU A;  2BE5 D;  1YNJ C;  1PTO C;  1TWF B;  3S1Q H;  2QA4 Z;  3HOV G;  4KTA A;  2JS4 A;  2Q8I B;  2LIY A;  3QR8 A;  3GD7 A;  4FNF A;  3GTO H;  2I5L X;  3SE0 A;  3M4Y A;  4E6I A;  4BXX I;  1SEB D;  2NVY B;  3MXN B;  1DOK A;  1STB A;  3MON A;  4R4C A;  3T56 B;  1IXR A;  4CJ0 B;  2Y0S E;  2ID0 A;  3EED A;  1VS0 A;  1LAB A;  3RZD H;  1ZH1 A;  3CC4 Z;  1MKH A;  1JOK A;  1R4Q B;  2CQO A;  1DD2 A;  1A8V A;  4N9T A;  1VQL A;  3K80 C;  5KYL A;  1X3G A;  4HMJ A;  5CYU A;  5DNF A;  3BVZ A;  1VQG A;  3BDC A;  1KQS A;  1YI2 A;  4BXX G;  3QB3 A;  4IUP A;  2VXW A;  3FDT A;  4YWM A;  1B7Y B;  4DNI A;  3GTM H;  3I4M H;  3J80 E;  4DR7 L;  5A2Q L;  1IL8 A;  1QVF Y;  3H94 A;  1M90 2;  1PTO D;  4B08 A;  5JEA J;  2O4X A;  5I9O A;  3S9W A;  2Z6K A;  1X3W A;  4NBG A;  1XJV A;  2B2W C;  3DEP A;  2VS1 A;  3TDQ A;  4X62 Q;  4IUU A;  4BBR H;  4OIK A;  3GTO I;  3U4V A;  1W6K A;  4LUV A;  3TQY A;  4A3K B;  1GKH A;  1PFN A;  2BA1 A;  3HFZ B;  1EYA A;  3MFY A;  3PSI A;  1Z6H A;  3GQB A;  3GTM I;  1RQF A;  2BA0 A;  4DUY L;  4TQU S;  4BY7 G;  4NB8 A;  1TWC H;  4MRI A;  1STN A;  3GTP H;  3MXP A;  4X6A H;  1CSP A;  4EQN A;  1QF8 A;  1IZ6 A;  1DZ1 A;  2F0J A;  3NE5 B;  3LUS A;  4ZQ3 A;  1B1Z A;  2BOS A;  2K3R A;  2CH4 W;  1PH4 A;  1TU2 B;  4IFD I;  3P7J A;  4A3G H;  3CCM Z;  1B9N A;  3MEF A;  3CQZ H;  4LMQ D;  2NVX H;  5DLQ E;  1AA6 A;  2ZJP A;  1NMF A;  2JMO A;  2F4O A;  2QDB A;  2UXB Q;  1A63 A;  1IYJ B;  3S24 A;  2R7D A;  2YU9 I;  3HOY H;  4AIM A;  4LNQ A;  4JI1 L;  2TMP A;  1VQN Z;  4GKK Q;  1Y1V G;  2FIN B;  3PUY A;  4K2K A;  2ZJR A;  2F3I A;  3I8Z A;  2R93 B;  5M9O A;  3HZX A;  2KUM A;  1BXT A;  1K8M A;  1HR0 Q;  3IFT A;  1X3Z A;  5JPN C;  2RCF A;  3VDY A;  3CC2 1;  1YJN 1;  2AWO A;  1YJN A;  3CC2 A;  1G29 1;  4A4I A;  4DXF A;  2XWB B;  3SK5 A;  4DK0 A;  4DR7 Q;  1EWI A;  1OXU A;  1AE2 A;  4JBW A;  2GTI A;  2A6H C;  3I4M G;  2DNE A;  2JN4 A;  2EJM A;  1EQT A;  3CCR 1;  4PMW A;  1U4P A;  3ND8 A;  3GTG B;  1D2B A;  1QVF A;  2JA7 G;  2NZ1 D;  1BBW A;  2RQX A;  3I7F A;  4RGM A;  4QGU A;  2PZW A;  1QYP A;  1QVG A;  1D7Q A;  2MO1 A;  3PO3 B;  2EOT A;  4QY7 A;  4UDU C;  4TKO B;  3T1H L;  2LXK A;  5LHY 1;  1VQO 1;  4K6D A;  1HCZ A;  2F0O A;  1T5E A;  1KNA A;  3EBE A;  4U68 A;  5M3F G;  1XPO A;  1IL2 A;  1A2U A;  1XMQ L;  1K3B C;  2PZT A;  4JI8 Q;  1QVG Z;  2Z1C A;  4YY3 Q;  1HZ9 A;  1G51 A;  4NB9 A;  3I55 1;  2EVB A;  3RNU A;  1NBW A;  2K1B A;  4IPD A;  3G7L A;  1EUJ A;  3JAM f;  4A3J G;  1CZW A;  1SNQ A;  4DR4 Q;  1HNX Q;  1X0T A;  1SE3 A;  1P16 A;  1F9Q A;  4DR6 L;  4BY1 H;  3B6Y A;  1LTT D;  5T64 A;  1I3Q I;  5IIF A;  1N33 Q;  1AW7 A;  3GTK H;  2V1C C;  1VQJ A;  1PH8 A;  5AFW A;  3PO2 H;  1FYC A;  4K8J A;  2O2L D;  5C5M A;  3WOF A;  2VQF L;  4MNO A;  4A3J H;  2OZK A;  3TP6 A;  5KIX A;  2E2J B;  1XTD A;  1YUK A;  1I50 H;  2XVS A;  3ULJ A;  4X65 Q;  3EER A;  1A62 A;  4KHP L;  1XX8 A;  2H1E A;  3TN2 A;  2RSO A;  1LAC A;  1DON A;  3KLR A;  3NEL A;  1VQN A;  3K7A H;  1VQM 1;  1Z47 A;  3L2P A;  4G7O C;  4UP8 A;  1YI2 1;  1YNJ D;  1CHP D;  3PO2 G;  4QUC A;  1IBK L;  2EY6 A;  3U50 C;  2JIQ A;  2CKZ B;  3W1B A;  4A3E H;  2AMC B;  1FDO A;  1PRT F;  2QIL A;  4X66 Q;  1GUW A;  3CCJ Z;  1VQ7 1;  3K7A B;  2KJX A;  1Q7Y 1;  2MJ8 A;  2ASB A;  3NBH B;  1QVG Y;  1ZYR D;  3NSW A;  4JBJ A;  4LFC L;  2JP1 A;  5JEA H;  3WWV A;  2JA7 H;  3F3F C;  4JW0 A;  3NWT A;  2F0H A;  2MNA A;  1L1O C;  4JPB W;  3KLS X;  4ZK9 B;  4ZYS A;  1S4Z A;  1ZB9 A;  1ESR A;  5FJ8 G;  5LMN L;  2B63 G;  4UPA A;  1Q82 C;  3KIF A;  4A3F H;  3QIA A;  2E2I H;  1AN8 A;  1R4P B;  2QKI C;  2CCZ A;  1VQF A;  3CPW Z;  1NE3 A;  5DM6 3;  1EY9 A;  1K8A 1;  5C6A A;  4GNX B;  2F0M A;  3GTQ I;  3CCR Z;  5IT9 L;  3H15 A;  4JBM A;  1S5C D;  1AZQ A;  4QF4 A;  3CCV Z;  2YV5 A;  1TII D;  5EKL A;  1BCP B;  3TRE A;  3GTJ I;  3D31 A;  3GTJ H;  4IO9 A;  2B63 B;  1W3S A;  2EE1 A;  1B3A A;  4JCV E;  3S14 H;  5C0X J;  1SYC A;  4R1J A;  4ME3 A;  2F0G A;  4JI5 Q;  2QR1 B;  2PMZ B;  4UP9 A;  1HQR D;  2OF1 A;  1PH5 A;  1A3V A;  1HJP A;  1B50 A;  2YAD A;  2BJO A;  1HPC A;  1S72 1;  3VYU A;  3HGB A;  2B2V A;  1VQL Z;  1BCP C;  3CCV 1;  1ZEQ X;  4NDX A;  3FVQ A;  1SJE D;  3Q24 A;  4BBS I;  4DR4 L;  3CC4 A;  1F2Y A;  1WI5 A;  5A2Q E;  1X3F A;  4GN3 B;  4C3J H;  4DR1 Q;  1S40 A;  5CV8 A;  1AH9 A;  5ELN A;  3NBH A;  1Q7Y 2;  1WTV A;  1CKO A;  4XQJ A;  3RLF A;  2D2C C;  5M3M H;  3U9O A;  3F2U A;  3UDX A;  4L5R C;  4DV5 L;  1Q82 1;  1A3U A;  3R8B A;  3F2D A;  3UDF A;  4NXM Q;  4X64 Q;  2J0T D;  5FLM I;  3KLW A;  2F0E A;  4KN4 C;  3M3Y B;  2R93 H;  3HOY I;  4FVM A;  3I4N I;  2QW7 A;  3L3O C;  2BE5 C;  1P8L A;  2I5M X;  1FNW A;  2PNH A;  2ZM6 Q;  1QNU A;  5JEA G;  1DJR D;  2IHF A;  1YHQ A;  3BVG A;  1NR2 A;  3I91 A;  1JWH C;  2ENB A;  1KTK A;  2R7F A;  4ME5 A;  1JB7 A;  2NVT H;  3GP7 A;  2E5L Q;  3J81 j;  5JJI A;  2B63 H;  3DM1 A;  1QJO A;  1VQ9 1;  1D5M C;  1L0Y B;  2QEX Z;  1Q8K A;  1X32 A;  2R93 G;  1TWC I;  1Q81 C;  4EQP A;  3CRL C;  4AH6 A;  2JA7 I;  3MZK B;  3VR3 A;  1XPR A;  5JVG 3;  3CCE Z;  4A3M I;  1OXT A;  4ZUI A;  2A6H D;  4HN7 A;  2F0D A;  2NYZ D;  4F88 A;  1TWC B;  2F0T A;  1I4Q A;  4JI0 Q;  5CV7 A;  3FKI I;  3LWU A;  2OCE A;  4Y7N B;  3H0G H;  1BKB A;  4LFA Q;  1AZP A;  3CMA 1;  5EBC A;  4NXN Q;  3CCS A;  2A68 C;  2CFM A;  2JA7 B;  4IPC A;  1JOR A;  5EQ0 A;  4L6T B;  2DUD A;  1IBL Q;  2FFK B;  1RTN A;  3M4O I;  3BYT B;  2DJG C;  4FXD A;  4K0K Q;  1KNE A;  5IGG A;  5C3E H;  4A3J I;  1LM0 A;  3PF5 A;  2F03 A;  4IUQ A;  1GHJ A;  4L8J A;  2HHH Q;  1C4Q A;  4OEL B;  4V0B A;  2EYL A;  4DV4 L;  1DM0 B;  3F3P C;  2QKD A;  4DAP A;  1NJI C;  2AKL A;  1VMC A;  2UXD Q;  4S3S A;  3L7Z C;  1O80 A;  1S7M A;  3NP8 A;  1CM9 A;  2K04 A;  2ICE C;  3HKZ B;  2QRE B;  1ASZ A;  1NUI A;  1I50 B;  1XNQ L;  2EYH A;  5C3X A;  4LW1 A;  2A19 A;  4NBC A;  4KN7 C;  3HOX H;  1I94 Q;  1Q90 A;  1YUA A;  5EPJ A;  2K7V A;  2UUC Q;  4NPS A;  1G6Z A;  3NXW A;  5FOB B;  2IT1 A;  2PMZ A;  2AQ1 B;  1ET9 A;  4I7Z C;  1YVC A;  1TWG B;  4PZ6 A;  1VF7 A;  3GO5 A;  4IUV A;  1VQ8 1;  1VQ4 Z;  1XXG A;  1JE5 A;  3SK8 A;  3G48 A;  4HGY A; 
#chains in the Genus database with same CATH homology
 1UAP A;  1IW7 C;  3VR6 A;  4IAL A;  1Y1V S;  1BCP F;  3IX0 A;  1ET6 A;  1HA5 A;  2MUY A;  1C48 A;  1TS5 A;  2B2Y C;  4MXU A;  2L5T A;  2RA4 A;  3J81 L;  1U4R A;  5J22 A;  2XRS D;  4R9W A;  3BDL A;  4PMB A;  2LMC B;  5F2D A;  3J7A F;  3EVQ A;  2KED A;  1RO2 A;  3HOX I;  2KOL A;  3DMU A;  1EYC A;  3E6Z X;  2WKC A;  4NMZ A;  2OXP A;  2QF7 A;  4YIJ A;  2IWH A;  2F3W A;  1W2B Y;  3QOL A;  3S2D I;  1YIJ Z;  3TP8 A;  1VQP Z;  3I4L A;  2RBM A;  2PM9 A;  4MH4 A;  2N55 A;  5KYI A;  1PRT B;  3S2D B;  5BN4 A;  4BA2 I;  1CZG A;  2B2T A;  2LFU A;  4EGV A;  1HRJ A;  4MHE A;  3KLS A;  2PZU A;  5IT9 E;  1TWA I;  1F2L A;  5KNC A;  4FO2 A;  3J81 f;  2E2H B;  4FP5 D;  3JAM E;  3CQZ B;  5I6Y A;  2EPB A;  4G57 A;  3CCQ 1;  3HOU I;  1PRT C;  5EKK A;  1TWA B;  1EL0 A;  5C0X H;  3T4N B;  5DAU A;  1BQQ T;  2F0U A;  2HUG A;  5TSS A;  4XTC S;  3NDI A;  2E2J I;  4A3B I;  1D5Z C;  2JNY A;  4FF2 A;  5JPM C;  1I4G A;  3PO2 B;  1WD1 A;  3H0G B;  3J7A V;  1U9R A;  1YHQ 1;  1KDA A;  1LT4 D;  4C3H B;  1TY0 A;  3C46 A;  2BDN A;  4NKL A;  3GV3 A;  4KY6 A;  3MEH A;  4A3I B;  1Y8N B;  2H85 A;  4BY1 B;  3CCU Z;  1TKW B;  3NDJ A;  4HSP A;  3CD6 Z;  1SND A;  3VMG A;  1TY2 A;  3OMG A;  1STH A;  2C5C A;  4LK1 C;  4F7X A;  3SR1 A;  2DY8 A;  1F9R A;  2F0P A;  3I90 A;  1VQM Z;  1IYU A;  3IL8 A;  4CKC A;  4MD7 A;  1Q81 1;  2R93 I;  3PO3 S;  1G8Z D;  1GHK A;  2HQE A;  1BO0 A;  3PUW A;  1WVL A;  1TS3 A;  3LX0 A;  1BNZ A;  1NR4 A;  1UEA B;  3CXC Y;  3D6C A;  3LWE A;  3S17 I;  4RCO A;  1TQO A;  2A74 C;  3HKZ A;  1S5B D;  3OW7 A;  1ML0 D;  1K9M 1;  1PTO F;  2Z4I A;  5M3M B;  2OTL 1;  1LV9 A;  1DYQ A;  3OWE B;  3C1F A;  1E2V A;  2L12 A;  5LL6 f;  1SAP A;  1RO4 A;  4DU9 A;  1LT6 D;  4E2Y A;  3GTO B;  2JA5 I;  1EEI D;  1EY7 A;  4C3J B;  1V1P B;  1WII A;  3D8G A;  2LY7 A;  1ICW A;  4KHV A;  3N52 A;  2PPB C;  3MC0 B;  3K5O A;  3A8I E;  3NQI A;  4ZUJ A;  3CXC Z;  1VLA A;  1GOZ A;  1EZ6 A;  1HTP A;  3VR5 A;  3DWA A;  1M8A A;  1I4X A;  1I6H I;  4NW2 A;  1GUS A;  5FO8 B;  3C2P A;  3S14 B;  3HG9 A;  5FLX L;  1I6V C;  2K5Q A;  1E0B A;  4TSS A;  3PUV A;  2EY2 A;  1X3P A;  5JOB A;  4TRD A;  5G3L F;  3A8J E;  5KND A;  2E2I B;  3T13 A;  1RLY A;  4C1N K;  3CPW Y;  2VUG A;  2C9O A;  2L9H A;  1JWM D;  1H9M A;  4BBR B;  1CA6 A;  5JVH 3;  2E2H I;  3EJI A;  3D4R A;  2F0L A;  3OWF A;  3RUZ A;  3IF8 A;  1ZYR C;  5KGU A;  1TWH I;  4C3J G;  3M85 A;  3C3L A;  1HFN A;  1EU4 A;  1S72 Z;  4J1M A;  4HCE A;  2JA6 B;  1D6E C;  1ML8 A;  2L1B A;  4IFD G;  1MBY A;  1JJ2 Z;  2K6A A;  4AYB B;  1T5X D;  4A3F I;  3NPP A;  1Q12 A;  4DAV A;  3FPP A;  4MON A;  1LTB D;  3EFX D;  1WTO A;  2XWJ B;  2W04 A;  4A3I I;  4RWS C;  1KAB A;  2Y0S A;  2EYP A;  2F0V A;  1RD9 D;  5AN9 F;  1D5X C;  5C44 I;  1PTO H;  4RV9 A;  3I72 A;  4UAI A;  4ODG A;  1R9T B;  1JR0 D;  1II3 A;  4NBH A;  5C5L A;  2OEO A;  2E9H A;  3X3N A;  3GCF A;  3VA7 A;  1LTI D;  2IX0 A;  1U4L A;  1Q1B A;  3OHX C;  5J39 A;  3G4S Z;  4K2L A;  1TS2 A;  2L11 A;  4NBB A;  3WOE A;  1NJI 1;  3L9A X;  4I65 A;  2WAQ A;  3J80 L;  1I50 I;  4KY5 A;  3CCE 1;  1U4M A;  3VR2 A;  1N2F A;  1WTW A;  3R93 A;  2K28 A;  3S1N B;  2G2K A;  1JJ2 Y;  1GUO A;  2PW7 A;  3PIP 3;  3TDH B;  3JAM L;  1TS4 A;  4HMI A;  3GTL B;  1A2T A;  2EY5 A;  4EWC A;  1LO5 D;  3AB9 A;  1KC8 1;  2R3Z A;  1YIT Z;  5ELE A;  5EPK A;  1FNU A;  3DWP A;  3CCS 1;  3SXH A;  4HH4 A;  1VF5 C;  2CHB D;  2B2T C;  4HR7 B;  3ND9 A;  3VTN A;  3KUP A;  3BYY B;  2WKD A;  1OXV A;  3T53 B;  1YIJ 1;  5C4X I;  3G6E Z;  3CCS Z;  1SDF A;  3P5J B;  2VB3 X;  5CC4 A;  2A69 C;  2IL8 A;  4CGY B;  3HOY B;  4A93 B;  2NVX B;  4K14 A;  4ILW A;  4LJZ C;  1PYW D;  2VUM I;  1PLF A;  4MIU A;  5CV6 A;  2NN6 G;  3QOJ A;  3K5L A;  3HP3 A;  2QA4 1;  1QB5 D;  3S1R I;  4PQX A;  5CMD A;  3S1M I;  4OIJ A;  5FKA C;  5IGC A;  2QEJ C;  4BBS B;  1LQL A;  1S5E D;  4TNU A;  2W03 A;  3MHB A;  3TZU A;  2CVR A;  2M00 A;  3OMC A;  2JE6 I;  1SYG A;  2DNC A;  2KCC A;  1PMR A;  4QUF A;  4BY7 I;  3SK6 A;  1QG7 A;  5I4D A;  3S15 B;  2V8K A;  4KKS A;  5ELB A;  1DCZ A;  2JR6 A;  2AWN A;  2XNA C;  5CR3 A;  2HF1 A;  1F9P A;  2WB1 A;  3VB9 A;  1XYI A;  3CCL 1;  1KD1 1;  4HAE A;  3M7N A;  4CKE A;  1K8O A;  1SNC A;  5K36 G;  2F4I A;  3R2I A;  2CQA A;  3NK9 A;  2HU9 A;  3RZD B;  3K6O A;  4X3S A;  4DQY B;  4BY1 I;  3M4O B;  5C4J I;  1TVX A;  3SVM A;  2IZ4 A;  3FQM A;  3O13 A;  3TZD A;  1EQV A;  4HTH A;  3GV6 A;  1EFI D;  2RHB A;  1VQP 1;  3HOZ B;  3PUZ A;  2WIN B;  3NHH A;  1S5F D;  3S1Q B;  5E3F A;  1ILQ A;  3HEJ A;  5IOC A;  4Y7N I;  3I07 A;  5C4X B;  1STA A;  1GJX A;  4KJO A;  2MHV A;  3VYS A;  2XIW A;  4BY7 B;  5I2X A;  1M1K 2;  3P75 A;  1RKN A;  2R7Z B;  3GTQ B;  3CQZ I;  1V8Q A;  1KDC A;  3K58 A;  4IZ8 A;  1M1K 1;  4IUR A;  5BN3 A;  2OTJ Z;  3FMC A;  1H9S A;  4X3U A;  2NVQ B;  4DN4 M;  3SK4 A;  2B2W A;  1SXT A;  4K5W A;  3CHB D;  1VQ5 1;  3I56 1;  3BG3 A;  3QWN A;  4IN3 A;  3IAY A;  3A7L A;  2P3Y A;  1M4V A;  2FHT A;  4X3T A;  1F9S A;  3D3R A;  3URY A;  4DK1 A;  3BVM A;  3VMI A;  2RDH A;  1WTQ A;  3NTK A;  1LTG D;  1MSG A;  1VCI A;  3BDO A;  4DNR B;  3UI2 A;  4DGZ A;  2O4H A;  1GUG A;  1F2M A;  1Z03 A;  2P28 A;  2JA5 B;  1H9S B;  1RF2 D;  5CV5 A;  2JYO A;  1ENC A;  4XT1 B;  3PUX A;  1DOL A;  4NP5 A;  3RMH A;  3SEB A;  3NTH A;  4DFA A;  3S2H B;  4M1U B;  5A2Q f;  1KD1 2;  2EYM A;  3I4N B;  1F2Z A;  3CCL Z;  1SYB A;  3RZO I;  1VQ9 Z;  5ELD A;  3S17 B;  3K57 A;  1RJT A;  2F0N A;  5C44 B;  4XDX A;  2KPI A;  1SFO I;  5CV4 A;  4IFD J;  3DWQ A;  3GTM S;  4XYO A;  2J4X A;  5IGF A;  1DXM A;  3X3M A;  2K5D A;  3BG1 B;  1CA5 A;  3IKJ A;  4BA1 I;  3V2T A;  2B8F A;  4S1T A;  5C0X I;  1KLU D;  1PZI D;  2Q4Z A;  1Q1E A;  5CV9 A;  2X6G A;  2YU9 B;  1J9O A;  2M9V A;  1HUM A;  1Y1V I;  5D3D A;  4OGQ C;  2QLV B;  1PFT A;  2NTT A;  4J8Q A;  1ILP A;  2GU2 A;  5M5Y B;  1YNN D;  1EYD A;  1JB3 A;  4NBA A;  2ZXO A;  4RAU C;  1RDP D;  3CC2 Z;  1YJN Z;  1MI2 A;  2AQ3 B;  4RFB A;  1Q81 2;  4CJ2 C;  1YJW 1;  2O5J C;  1I4R A;  1DOM A;  3CCQ Z;  1AEX A;  4XQN A;  1NSN S;  1VQ5 Z;  1FNV A;  4RGO S;  1MSH A;  4H7B A;  3OIQ A;  1AFP A;  3D9X A;  2R7Z I;  1HHV A;  2K5R A;  5D1O B;  4RHS A;  1GUN A;  2VNU D;  1BOS A;  4RKL A;  2A6E D;  2KHS A;  1G2T A;  1KRL A;  3MWY W;  5DEH A;  1Q82 2;  1E2W A;  3S16 I;  2JA8 B;  2JSO A;  5IGD A;  4CL1 A;  1EY0 A;  1NAP A;  3IFU A;  3A55 A;  3KBG A;  4NBF A;  1Z02 A;  3PV0 A;  3SHL A;  1I4H A;  2VB2 X;  3DHQ A;  1I3Q B;  3NH5 A;  3CC4 1;  1EY4 A;  1QWY A;  2ZXR A;  3S14 I;  1LLR D;  1KQS Y;  3G6E 1;  1BDO A;  2KA7 A;  3HOX B;  1I6H B;  1NJI 2;  5D1P A;  1KLG D;  2GA4 B;  3FQQ A;  1PTO B;  2X69 A;  4ZKB B;  3DXJ C;  1SMY D;  4Q5V A;  1JQY D;  2F0K A;  3E0J A;  5KEE A;  2I46 A;  3ITP A;  3M3Y I;  1QVF Z;  1LTR D;  1JE4 A;  2V8J A;  1H9J A;  4K5V A;  1JWS D;  2IPK D;  3G4S 1;  5DM7 3;  2CW0 C;  1S5D D;  2SNM A;  3HOV I;  3P20 A;  4KD3 A;  3FPU B;  1SYF A;  2IJ0 A;  5J1Z A;  3A56 A;  5C3E B;  1YI2 Z;  1Y8P B;  3W2D A;  1O7Y A;  2EXZ A;  4RGT A;  3M7G A;  2YYZ A;  4B9W A;  2OOY B;  1VQK 1;  1UNS A;  4RA8 A;  1G2S A;  4KMU C;  2VF1 A;  1W6J A;  2EY1 A;  1YIT 1;  2EYF A;  4C3I B;  1HA6 A;  2BDO A;  4CBV A;  1D1I A;  4C3I G;  1VQ4 1;  1YJW Z;  3KBX A;  5NUC A;  4RVD A;  3OIP A;  4FF4 A;  1YNN C;  3MA2 B;  1SNP A;  4A3K I;  3J81 b;  2PK7 A;  2GTH A;  1TFI A;  2XRQ D;  3ZYY X;  1WCM B;  2E74 C;  3FRP B;  1VQ7 Z;  1B53 A;  4DGL A;  2NVT I;  2Y0S B;  4MD9 A;  3E5S A;  1SE2 A;  2LFN A;  2KQ3 A;  3TP5 A;  3TBI B;  1D1K A;  5LL6 S;  3HOU B;  4AYB A;  2QCP X;  1LT3 D;  2B39 A;  1CI3 M;  1A6X A;  1USP A;  3JAM b;  1IW7 D;  1PFM A;  3C1E A;  2EYO A;  3CRK C;  3PO2 I;  4ZLT F;  4PMC A;  1KQS Z;  1Y1W B;  2FMM A;  2JA8 I;  2MPM A;  5C0X G;  3Q23 A;  4JK1 C;  1N8R 2;  1E2Z A;  3Q87 A;  4A93 I;  5FLX b;  4E31 A;  1O7Z A;  3NFZ A;  3CC7 1;  1DL6 A;  4WRD A;  4NBE A;  2M2L A;  4NFR A;  3CKI B;  1N8R 1;  1EY8 A;  1ZKO A;  5I9P A;  1JIC A;  1CTM A;  1K9M 2;  4XXE A;  4WFN 3;  5C3W A;  1NCV A;  2J7Z A;  1K73 2;  1JCK B;  3OPO A;  4C3H G;  1SSO A;  2J6A A;  2PQE A;  3BZD B;  4KK7 A;  4XIG S;  2NWG A;  2KEC A;  1PZK D;  1Z01 A;  4KJN A;  3I55 Z;  1OO9 B;  2D62 A;  3MXG A;  1C8C A;  4A3G I;  2WB1 B;  3MZ5 A;  4R8N A;  3KIH A;  1B44 D;  4Y52 I;  1J8I A;  1EIG A;  1EWC A;  5HUR A;  2R6M A;  1ONL A;  2TSS A;  2QRD B;  3OW2 Z;  4K5X A;  4KHZ A;  3G71 Z;  4KY7 A;  4ZKC B;  1ROD A;  2EJF C;  2EGT A;  2IW3 A;  4OL7 A;  2B2V C;  2SOB A;  1WD0 A;  2SDF A;  2B2U A;  2DN8 A;  3MVV A;  4A3E B;  4PNY A;  2NTS A;  4A3E I;  1Q8I A;  5M5W B;  3G71 1;  4L63 B;  1OXS C;  4HED A;  4DXG A;  5K36 H;  2PW5 A;  2O5I C;  1BCP D;  3T16 A;  3CCJ 1;  2JUB A;  1BF4 A;  3H09 A;  2ZXP A;  1Y1W I;  3MZL B;  1WTX A;  1OXX K;  4LAA A;  1SNM A;  2B2Y A;  2AUJ D;  1B4O A;  1G91 A;  2I07 B;  2RIQ A;  5HGT A;  3GTK B;  1MGS A;  4E30 A;  1CHQ D;  1FGB D;  1BBX C;  4IQZ A;  2M48 A;  2ZT9 C;  1NUC A;  2R92 B;  2Q8R E;  3N6R A;  1PFB A;  2I3C A;  3H3V J;  2K05 A;  4BBR I;  4OO1 I;  4K6L A;  1H9R A;  3D4W A;  4RVG A;  1O7L A;  1K8A 2;  3HS0 C;  4Q0F A;  4H44 C;  3AU7 A;  3TSS A;  2WV6 D;  2IX1 A;  4M8A A;  3K5N A;  2NVT B;  4ZAI A;  1VQ8 Z;  1MD2 D;  3P1H A;  2XN9 C;  4A3M B;  4P2C B;  4CHT B;  3CD6 1;  3D6W A;  3J81 E;  4RVH A;  1JOO A;  1JWU D;  4H13 C;  3NBI A;  4KKT A;  4QTU A;  1H9K A;  5EJW A;  2R61 A;  1STY A;  3OSO A;  5K5P A;  4FF3 A;  2RT9 A;  2F0F A;  4ABN A;  2WAQ B;  1STE A;  4PV1 C;  4RCN A;  3S16 B;  3SDZ A;  4IFD H;  1FR3 A;  4EVO A;  4DNT B;  2B8G A;  2G9D A;  5G3L D;  3A8K E;  2G9H D;  2F3V A;  2V4D A;  1HFG A;  3OOC A;  2EDG A;  5EGT A;  3MXN A;  5T67 A;  3Q0A A;  4R8I A;  2OTL Z;  1EY5 A;  5T1G A;  2PNR C;  2MGS A;  1QE6 A;  4WJW A;  4RHR A;  4RS4 A;  2F4M A;  3Q6S A;  4QB4 A;  2Q8T A;  5T1I A;  4E2X A;  3GTJ B;  2RSN A;  3DUZ A;  1EU3 A;  4A3C I;  5IGE A;  2L4N A;  1ESF A;  4FYD A;  4HGZ A;  3WDN A;  3GTP B;  2DE6 A;  4KI0 A;  1VQK Z;  2A69 D;  4DA2 A;  2RBL A;  2HDM A;  5ISR A;  4C2M B;  1K83 B;  3NTI A;  4QIW B;  2OT2 A;  4RH6 A;  1VQ6 1;  3S15 I;  3I3C A;  3J7A 4;  4KD4 A;  5I6W A;  1IKM A;  1EIH A;  3MTS A;  4X3K A;  2OTJ 1;  4F87 A;  3I73 A;  1CQF A;  3K5M A;  3VR4 A;  5D3I B;  1SFO B;  3H0G I;  4OO1 H;  4K8I A;  1QNK A;  2JXM B;  4B9X A;  1WTR A;  1O78 A;  2X6L A;  2KVM A;  1L0X B;  2KEE A;  2N88 A;  1CK1 A;  4NH1 C;  2D5D A;  1ZXT A;  3ERO A;  4BS9 A;  4RKB A;  2E2D C;  2EZV A;  1IKL A;  5D65 A;  1EWH A;  1VDZ A;  1Q86 1;  3I56 Z;  2PO4 A;  2NBF A;  1V1O A;  1V1P A;  2NN6 H;  3HOW B;  1LTA D;  1HQM C;  2F0I A;  3S1N I;  2D9U A;  5COY A;  3S1Q I;  2JEB I;  4O1N A;  4RVF A;  4XQQ A;  4XX2 A;  2R92 I;  3FEW X;  5D14 A;  1W2B Z;  2E75 C;  3NQT A;  1QOH A;  2F1M A;  5IP7 I;  2EJG C;  1EY6 A;  1GUT A;  2M6N A;  2K5W A;  3QG1 A;  3ONA B;  3K0Y A;  4E32 A;  3J80 f;  1RTO A;  1K83 I;  4E2W A;  3W3A A;  4H0L C;  5IT9 f;  1A15 A;  4N9P A;  5E1F A;  4ULL A;  4OHJ A;  5C4Z A;  2Z4H A;  1VMP A;  2WII B;  2RDF A;  2K01 A;  1TWF I;  1TWG I;  2WP8 J;  2A5H A;  3D4D A;  2A6E C;  4ZRZ A;  4J6H A;  1RCV D;  1P9N A;  3A7A B;  3GTG I;  4GZY C;  2Z8L A;  3J7Y W;  4XT3 B;  3TME A;  1NP6 A;  5JJZ A;  2F0S A;  4A3D B;  3MFG A;  3R2T A;  3Q22 A;  3ERQ A;  2IX3 A;  3RD4 A;  1EOT A;  3S1M B;  5IT9 b;  3PO3 I;  4HCS A;  1Y69 U;  4A3G B;  1CT1 D;  3QWU A;  5C3E I;  1VQ6 Z;  2B2U C;  3H6M A;  4IUN A;  2DE7 A;  4V19 0;  1X3Q A;  2F0Q A;  2HCC A;  2B63 I;  2DY7 A;  1QIL A;  4CKB A;  3IFD A;  4A3J B;  3U9S A;  5FLX f;  1VQL 1;  2E76 C;  1B2T A;  2JA6 I;  1TWH B;  1SJH D;  4FXK C;  3CC7 Z;  2KCN A;  2R6G A;  2E2I I;  1STG A;  5IGB A;  5M5X B;  4FXG C;  2K03 A;  3EA6 A;  3HOW I;  1KDB A;  5CGK A;  2PYK A;  3S2H I;  1WTP A;  2BCO A;  3K59 A;  4E2Z A;  3T4A C;  5A2Q b;  3BG0 B;  1YJ9 Z;  3OW2 Y;  1TT2 A;  1ENA A;  3I4M B;  3GTM B;  5FO9 B;  5EBD A;  1TR5 A;  3VYR A;  2CW0 D;  1KAA A;  3AMU A;  3T51 B;  1RHP A;  1SYE A;  1HXY D;  3FKI B;  5C4J B;  4A3L I;  4EQO A;  3PIO 3;  3VYT A;  1USP B;  1K73 1;  4G7H C;  5CBA E;  1XWE A;  1HUN A;  3QJY A;  2QEX 1;  4Z9C B;  2DE5 A;  4MD8 A;  1PXU A;  3G6J B;  5FK9 C;  4C1N I;  1PDQ A;  1VQO Z;  2NVQ I;  1SMY C;  3HOZ I;  1WW9 A;  2A68 D;  3QO2 A;  1VQN 1;  4A3D I;  2ICI A;  1Z7T A;  2H4O A;  4WOR A;  1CQV A;  4E33 A;  1SNO A;  1KC8 2;  1LTS D;  3V96 A;  1HTL D;  2V8I A;  1B9M A;  1UUP A;  2Q51 A;  2FJ2 A;  3TE5 B;  2NB0 A;  4CJ1 B;  4FF1 A;  1FD7 D;  3VA5 A;  3KF8 A;  2O53 A;  3CMA Z;  3H3V C;  3HRZ C;  1RO0 A;  1SE4 A;  4MN3 A;  1JC7 A;  3S1R B;  2XSC A;  2K33 A;  4IUT A;  2LS0 1;  5COR A;  2WAC A;  5KNB A;  3PMF A;  4A3F B;  4XYQ A;  5FO7 B;  4QTT A;  2FMC A;  4C56 C;  5C4H A;  3K7A I;  1PZJ D;  5E4X A;  2NUC A;  4KV6 A;  2MP1 A;  1GXD C;  5IP9 I;  3RZO B;  4X6A I;  1Q86 2;  4NOZ A;  3MAQ A;  2KI7 B;  1A3T A;  1F77 A;  3CCM 1;  3ESW A;  1IYV A;  3NWS A;  4DF7 A;  3J80 b;  4BWG B;  5ELC A;  2NN6 I;  4NBD A;  3EQL C;  1LT5 D;  3DEO A;  3R3O A;  1JOQ A;  2K32 A;  5I2Y A;  4QCL A;  1YHQ Z;  1BUV T;  3HOV B;  5T6B A;  1I4P A;  2AQ2 B;  2JEA I;  1RNI A;  2NVX I;  4HSV A;  2AUK A;  5A35 A;  3NUC A;  3CME Z;  3CCU 1;  5KRU A;  5IOD A;  2VUM B;  4U67 3;  3I4M I;  2PCF B;  5LL6 X;  3VMH A;  4KKU A;  2QRC B;  4ID6 A;  4A3B B;  5E4W C;  5BN5 A;  1SYD A;  2IZ3 A;  5EPL A;  1XTC D;  1IHZ A;  5M3F B;  3CME 1;  2EYJ A;  2RDG A;  3GTK I;  1Q3L A;  5FLX E;  1ZB8 A;  1EZ8 A;  1CFM A;  5EKI A;  4OO1 G;  4G4K A;  5D1O A;  4DAY A;  2RKS A;  2L0C A;  5CM2 M;  3H91 A;  1V43 A;  2SEB D;  3BS1 A;  2OOX B;  1SBB B;  2L55 A;  3A54 A;  1R9T I;  5ELF A;  3I70 A;  3V05 A;  1M90 1;  1Y8O B;  4G7Z C;  3GKQ A;  2A73 B;  1QCB D;  2F0W A;  4O42 A;  3GTL I;  2HDL A;  1BR9 A;  1Y1V B;  4F8M A;  3CU7 A;  1YJ9 1;  1PRT D;  4RGN A;  2LKV A;  1EEF D;  4QMG A;  5JAV A;  1ENF A;  3RZD I;  5CBE E;  2ZAE B;  2HCI A;  2SNS A;  1AP0 A;  2RVL A;  2NVY I;  2RPR A;  3TP7 A;  1WCM I;  3GTP I;  3NH8 A;  3KK7 A;  3LNN A;  3NH4 A;  3MXU A;  2BE5 D;  1YNJ C;  1PTO C;  1TWF B;  2QA4 Z;  4KTA A;  2JS4 A;  2Q8I B;  2LIY A;  3GD7 A;  4FNF A;  3SE0 A;  3M4Y A;  4E6I A;  4BXX I;  1SEB D;  2NVY B;  1DOK A;  1STB A;  3MON A;  3T56 B;  4CJ0 B;  2ID0 A;  3EED A;  1LAB A;  1ZH1 A;  3CC4 Z;  1JOK A;  1R4Q B;  1DD2 A;  4N9T A;  5KYL A;  4HMJ A;  5CYU A;  5DNF A;  3BVZ A;  3BDC A;  3QB3 A;  4IUP A;  2VXW A;  3FDT A;  3J80 E;  5A2Q L;  1IL8 A;  1QVF Y;  3H94 A;  1M90 2;  1PTO D;  4B08 A;  5JEA J;  2O4X A;  5I9O A;  3S9W A;  1X3W A;  4NBG A;  2B2W C;  3DEP A;  3TDQ A;  4IUU A;  4OIK A;  3GTO I;  1W6K A;  4A3K B;  1PFN A;  2BA1 A;  1EYA A;  3MFY A;  1Z6H A;  3GQB A;  3GTM I;  1RQF A;  2BA0 A;  4TQU S;  4NB8 A;  4MRI A;  1STN A;  3MXP A;  4EQN A;  1QF8 A;  1DZ1 A;  2F0J A;  3NE5 B;  3LUS A;  4ZQ3 A;  1B1Z A;  2BOS A;  2K3R A;  1TU2 B;  4IFD I;  3P7J A;  3CCM Z;  1B9N A;  4LMQ D;  2JMO A;  2F4O A;  2QDB A;  2YU9 I;  2TMP A;  1VQN Z;  2FIN B;  3PUY A;  4K2K A;  3I8Z A;  2R93 B;  5M9O A;  3HZX A;  2KUM A;  1BXT A;  1K8M A;  3IFT A;  1X3Z A;  5JPN C;  3CC2 1;  1YJN 1;  2AWO A;  1G29 1;  4DXF A;  2XWB B;  3SK5 A;  4DK0 A;  1OXU A;  4JBW A;  2GTI A;  2A6H C;  2DNE A;  2EJM A;  1EQT A;  3CCR 1;  4PMW A;  1U4P A;  3ND8 A;  3GTG B;  1D2B A;  2NZ1 D;  2RQX A;  4RGM A;  2PZW A;  1QYP A;  3PO3 B;  2EOT A;  4UDU C;  4TKO B;  5LHY 1;  1VQO 1;  4K6D A;  1HCZ A;  2F0O A;  1T5E A;  1KNA A;  4U68 A;  1A2U A;  2PZT A;  1QVG Z;  2Z1C A;  4NB9 A;  3I55 1;  2EVB A;  2K1B A;  3G7L A;  3JAM f;  1CZW A;  1SNQ A;  1X0T A;  1SE3 A;  1F9Q A;  1LTT D;  5T64 A;  1I3Q I;  5IIF A;  1AW7 A;  5AFW A;  1FYC A;  4K8J A;  2O2L D;  5C5M A;  3WOF A;  2OZK A;  3TP6 A;  5KIX A;  2E2J B;  1YUK A;  2XVS A;  3EER A;  1XX8 A;  2H1E A;  3TN2 A;  2RSO A;  1LAC A;  1DON A;  3KLR A;  1VQM 1;  1Z47 A;  4G7O C;  1YI2 1;  1YNJ D;  1CHP D;  4QUC A;  2EY6 A;  3U50 C;  1PRT F;  2QIL A;  1GUW A;  3CCJ Z;  1VQ7 1;  3K7A B;  2KJX A;  1Q7Y 1;  2MJ8 A;  1QVG Y;  1ZYR D;  3NSW A;  5JEA H;  2JP1 A;  3F3F C;  3NWT A;  2F0H A;  1L1O C;  3KLS X;  4ZK9 B;  4ZYS A;  1S4Z A;  1ZB9 A;  1ESR A;  3KIF A;  3QIA A;  1AN8 A;  1R4P B;  2QKI C;  3CPW Z;  5DM6 3;  1EY9 A;  1K8A 1;  5C6A A;  2F0M A;  3GTQ I;  3CCR Z;  5IT9 L;  1S5C D;  1AZQ A;  4QF4 A;  3CCV Z;  1TII D;  5EKL A;  1BCP B;  2B63 B;  3GTJ I;  3D31 A;  2EE1 A;  1B3A A;  5C0X J;  1SYC A;  2F0G A;  2QR1 B;  2PMZ B;  1HQR D;  2OF1 A;  1A3V A;  1B50 A;  2YAD A;  2BJO A;  1HPC A;  1S72 1;  3VYU A;  3HGB A;  2B2V A;  1VQL Z;  1BCP C;  3CCV 1;  1ZEQ X;  4NDX A;  3FVQ A;  1SJE D;  3Q24 A;  4BBS I;  1F2Y A;  5A2Q E;  5CV8 A;  3NBH A;  1Q7Y 2;  1WTV A;  4XQJ A;  3RLF A;  2D2C C;  3U9O A;  3F2U A;  1Q82 1;  1A3U A;  3R8B A;  2J0T D;  5FLM I;  4KN4 C;  2F0E A;  3M3Y B;  3HOY I;  4FVM A;  3I4N I;  3L3O C;  2BE5 C;  1FNW A;  1QNU A;  5JEA G;  1DJR D;  3BVG A;  1NR2 A;  3I91 A;  1JWH C;  2ENB A;  1KTK A;  4ME5 A;  3GP7 A;  3DM1 A;  1QJO A;  1VQ9 1;  1D5M C;  1L0Y B;  2QEX Z;  1X32 A;  1TWC I;  4EQP A;  3CRL C;  2JA7 I;  3MZK B;  3VR3 A;  5JVG 3;  3CCE Z;  4A3M I;  1OXT A;  4ZUI A;  2A6H D;  4HN7 A;  2F0D A;  2NYZ D;  4F88 A;  1TWC B;  2F0T A;  1I4Q A;  5CV7 A;  3FKI I;  3LWU A;  4Y7N B;  1AZP A;  3CMA 1;  5EBC A;  2A68 C;  2JA7 B;  1JOR A;  5EQ0 A;  4L6T B;  2FFK B;  1RTN A;  3M4O I;  3BYT B;  4FXD A;  1KNE A;  5IGG A;  4A3J I;  2F03 A;  4IUQ A;  1GHJ A;  4L8J A;  1C4Q A;  4V0B A;  2EYL A;  1DM0 B;  3F3P C;  2QKD A;  4DAP A;  2AKL A;  1VMC A;  4S3S A;  3L7Z C;  1O80 A;  1S7M A;  3NP8 A;  1CM9 A;  2K04 A;  2ICE C;  3HKZ B;  2QRE B;  1NUI A;  1I50 B;  2EYH A;  5C3X A;  4NBC A;  4KN7 C;  1Q90 A;  1YUA A;  5EPJ A;  2K7V A;  1G6Z A;  3NXW A;  5FOB B;  2IT1 A;  2PMZ A;  2AQ1 B;  1ET9 A;  4I7Z C;  1TWG B;  1VF7 A;  3GO5 A;  4IUV A;  1VQ8 1;  1VQ4 Z;  1XXG A;  3SK8 A;  4HGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...