4NH1C

Crystal structure of a heterotetrameric ck2 holoenzyme complex carrying the andante-mutation in ck2beta and consistent with proposed models of autoinhibition and trans-autophosphorylation
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHILFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title The Protein Kinase CK2(Andante) Holoenzyme Structure Supports Proposed Models of Autoregulation and Trans-Autophosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 201
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4nh1C01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4nh1C02
2R6MA 3EEDA 4MD8A 2M48A 1JWHC 4DGLA 4MD7A 2JMOA 4MD9A 2RT9A 4NH1C 1QF8A 1RQFA 2M6NA
chains in the Genus database with same CATH superfamily
4HGZA 3S2DI 2JA5I 1N2FA 1TFIA 3HKZA 5C44I 3CCL1 4E31A 2JNYA 2QEXZ 2JIQA 2HU9A 1RO4A 1K731 1VQMZ 2VPWA 1USPB 3GTMS 3H3VJ 1QVGZ 2JIPA 3I551 1VQN1 1M1K1 3CPWY 4NB8A 4NH1C 1W2BY 2PK7A 1ZB9A 2OZKA 2JS4A 4NBHA 3CCE1 3HOZI 2V8IA 1Y1WI 3F3FC 2GTHA 3J7A4 1TWFI 2JIRA 1PFTA 3CC41 1S721 1VQL1 4NBAA 1L1OC 4QTTA 1LQLA 1N8R2 2NVYI 4A3II 1VQ41 3NFZA 4NBDA 2JIMA 2M6NA 2PM9A 3EERA 4RVGA 2VPYA 2GTIA 3S15I 2I3CA 4A3CI 4E30A 4E2YA 2QRCB 1X3WA 1Q7Y2 3G71Z 4AYBA 3VMIA 1NJI2 1YIT1 4BY7I 1JJ2Z 2OTLZ 2RPRA 5IT9b 2GU2A 3GCFA 2QEX1 2NAPA 2E2HI 4A3EI 3CCQZ 1N8R1 1VQM1 3CCSZ 2QKDA 3CD6Z 1YJWZ 3GTPI 2E2II 3VMGA 1YUAA 4MH4A 3FQQA 2LEXA 2ZAEB 1TWHI 3HOXI 3S2HI 1X3ZA 4E2ZA 1QVFZ 3D2LA 2KPIA 4A3JI 3Q87A 1NJI1 1YIJZ 1TWCI 1Z02A 2KI7B 1K732 2RHBA 3T4NB 3KIHA 1Z01A 3CXCZ 1M1K2 3JAMf 1Q821 3PO3I 1NP6A 2NVTI 2W03A 4MRIA 3G711 4NBEA 3BG0B 3RZOI 2LIYA 3F3PC 1SIWA 1Q812 2OTL1 1WW9A 3GTKI 3GTOI 4MONA 2VUMI 1KQSY 1JWHC 3GTMI 1SFOI 3CCQ1 3MONA 3CCS1 3CD61 5A2Qf 1YJW1 1RQFA 1YHQZ 3J80b 3IF8A 1VQ5Z 3I56Z 2F4MA 3M4OI 3EEDA 3CPWZ 1W2BZ 2QA4Z 4NB9A 2IZ3A 2RBLA 1ZB8A 2EGTA 1KD11 2JIOA 2NVQI 1YIJ1 3MZLB 5C3EI 3D6WA 2JA8I 1Q811 2QR1B 2JMOA 5C4XI 3I07A 3CCR1 1Y1VS 3CCVZ 2JR6A 2QREB 1YJ9Z 2AYDA 5AN9F 2QRDB 2OOXB 3CMEZ 1VQK1 1RO0A 4NBGA 1TWAI 4NFRA 4E33A 2P3YA 3ESWA 3P5JB 2DE7A 3NH8A 1DL6A 2IZ4A 4A93I 3PO2I 1Q822 3S1QI 1RLYA 1WJ2A 1WCMI 1VQPZ 1VQ9Z 2VF1A 2V8KA 1YHQ1 3J81b 5IT9f 1VQ51 4E32A 1Q862 3I561 2JUBA 5T6BA 2O4HA 3FQMA 3S1RI 1YJNZ 3J81f 3CC2Z 2QA41 1S7MA 2O53A 3S17I 2NVXI 3OW2Y 4A3MI 2B63I 2JA6I 2VUGA 4HGYA 1VQ7Z 2OTJZ 1USPA 4QTUA 1QF8A 3CCLZ 2Q4ZA 2HF1A 3VMHA 3H0GI 3IFUA 2DE5A 4NBBA 1ML8A 2BJOA 4E2WA 1K83I 3CCV1 4NBCA 3I55Z 1M901 3HOUI 1YJ91 5FLXb 3CME1 3CCUZ 4S1TA 1KD12 2WB1A 2F4OA 3BG1B 2G2KA 1VQLZ 1ZH1A 5D1OB 1AA6A 3CC7Z 1NUIA 1WZNA 1Q861 2WAQA 1RO2A 3GTGI 3HOYI 3CCJZ 2W04A 2YU9I 1I50I 1P9NA 1VQ8Z 4BBRI 4DQYB 1KQSZ 3QWUA 1K8A1 2JA7I 1VQ91 4RVHA 3RZDI 4A3BI 3CMAZ 2E9HA 3CCMZ 2VPXA 3I4NI 4CL1A 1YJN1 2AKLA 3CC21 4A3LI 3IX0A 2K3RA 3CQZI 5LL6f 4NOZA 3G4SZ 3J80f 3KIFA 5IP7I 4BXXI 4Y7NI 2QLVB 2Y0SA 1VQ71 2OTJ1 2M48A 3G6EZ 4RV9A 1R9TI 1Y1VI 2V45A 4BBSI 3S1NI 1Z03A 1KRLA 3HOVI 3S14I 3TDHB 1QVGY 3NH5A 4MD8A 1VQOZ 3FKII 1VQ6Z 5T67A 3CCU1 4DGLA 3GTJI 1KC82 3CC71 3NH4A 1K9M2 3CCJ1 2VPZA 5T64A 2E2JI 3M3YI 4A3GI 1VQ81 3GTLI 3LUSA 4MXUA 1M902 4A3KI 2YADA 1X0TA 5D1OA 4X6AI 3CMA1 3CCM1 2RT9A 2K5RA 2R6MA 1Y8CA 4A3DI 1QYPA 2E7ZA 3S1MI 1I3QI 1YI2Z 3G4S1 5D1PA 1JJ2Y 2H85A 3S16I 2R7ZI 1I6HI 3G6E1 3OW2Z 3VTNA 5FLMI 1K8A2 1KC81 4DK1A 4EWCA 3VB9A 4MD7A 2LFUA 2Q51A 4E2XA 3IR7A 2OOYB 1K9M1 3TE5B 5IP9I 2RIQA 1VQO1 2PMZA 1VQ61 1VQNZ 2R93I 1FDOA 3CCEZ 2V8JA 2P28A 3GKQA 1QVFY 4Y52I 1TWGI 4NBFA 3K7AI 3NDIA 1QXFA 1Q7Y1 3CC4Z 1S72Z 2R92I 5FLXf 4RS4A 4HH4A 3JAMb 1VQ4Z 4MD9A 4RVDA 3CXCY 3D9XA 3CCRZ 3U50C 1VQP1 4XX2A 4A3FI 2IV2X 1WIIA 4RVFA 1VQKZ 5C4JI 3HOWI 1FDIA 2J6AA 1YI21 1RNIA 3PO3S 2DE6A 4BY1I 4TNUA 3GTQI 2V3VA 1Q16A 1YITZ 1VLAA 1YUKA 3MZKB 3I4MI 3NDJA 5A2Qb 5CM2M
chains in the Genus database with same CATH topology
4HGZA 3S2DI 2JA5I 1N2FA 1TFIA 3HKZA 5C44I 3CCL1 4E31A 2JNYA 2QEXZ 2HU9A 1RO4A 1K731 1VQMZ 1USPB 3GTMS 3H3VJ 1QVGZ 3I551 1VQN1 1M1K1 3CPWY 4NB8A 4NH1C 1W2BY 2PK7A 1ZB9A 2OZKA 2JS4A 4NBHA 3CCE1 3HOZI 2V8IA 1Y1WI 3F3FC 2GTHA 3J7A4 1TWFI 1PFTA 3CC41 1S721 1VQL1 4NBAA 1L1OC 4QTTA 1LQLA 1N8R2 2NVYI 4A3II 1VQ41 3NFZA 4NBDA 2M6NA 2PM9A 3EERA 4RVGA 2GTIA 3S15I 2I3CA 4A3CI 4E30A 4E2YA 2QRCB 1X3WA 1Q7Y2 3G71Z 4AYBA 3VMIA 1NJI2 1YIT1 4BY7I 1JJ2Z 2OTLZ 2RPRA 5IT9b 2GU2A 3GCFA 2QEX1 2E2HI 4A3EI 3CCQZ 1N8R1 1VQM1 3CCSZ 2QKDA 3CD6Z 1YJWZ 3GTPI 2E2II 3VMGA 1YUAA 4MH4A 3FQQA 2ZAEB 1TWHI 3HOXI 3S2HI 1X3ZA 4E2ZA 1QVFZ 2KPIA 4A3JI 3Q87A 1NJI1 1YIJZ 1TWCI 1Z02A 2KI7B 1K732 2RHBA 3T4NB 3KIHA 1Z01A 3CXCZ 1M1K2 3JAMf 1Q821 3PO3I 1NP6A 2NVTI 2W03A 4MRIA 3G711 4NBEA 3BG0B 3RZOI 2LIYA 3F3PC 1Q812 2OTL1 1WW9A 3GTKI 3GTOI 4MONA 2VUMI 1KQSY 1JWHC 3GTMI 1SFOI 3CCQ1 3MONA 3CCS1 3CD61 5A2Qf 1YJW1 1RQFA 1YHQZ 3J80b 3IF8A 1VQ5Z 3I56Z 2F4MA 3M4OI 3EEDA 3CPWZ 1W2BZ 2QA4Z 4NB9A 2IZ3A 2RBLA 1ZB8A 2EGTA 1KD11 2NVQI 1YIJ1 3MZLB 5C3EI 3D6WA 2JA8I 1Q811 2QR1B 2JMOA 5C4XI 3I07A 3CCR1 1Y1VS 3CCVZ 2JR6A 2QREB 1YJ9Z 5AN9F 2QRDB 2OOXB 3CMEZ 1VQK1 1RO0A 4NBGA 1TWAI 4NFRA 4E33A 2P3YA 3ESWA 3P5JB 2DE7A 3NH8A 1DL6A 2IZ4A 4A93I 3PO2I 1Q822 3S1QI 1RLYA 1VQPZ 1WCMI 1VQ9Z 2VF1A 2V8KA 1YHQ1 3J81b 5IT9f 1VQ51 4E32A 1Q862 3I561 2JUBA 5T6BA 2O4HA 3FQMA 3S1RI 1YJNZ 3J81f 3CC2Z 2QA41 1S7MA 2O53A 3S17I 2NVXI 3OW2Y 4A3MI 2B63I 2JA6I 2VUGA 4HGYA 1VQ7Z 2OTJZ 1USPA 4QTUA 1QF8A 3CCLZ 2Q4ZA 2HF1A 3VMHA 3H0GI 3IFUA 2DE5A 4NBBA 1ML8A 2BJOA 4E2WA 1K83I 3CCV1 4NBCA 3I55Z 1M901 3HOUI 1YJ91 5FLXb 3CME1 3CCUZ 4S1TA 1KD12 2WB1A 2F4OA 3BG1B 2G2KA 1VQLZ 1ZH1A 5D1OB 3CC7Z 1NUIA 1Q861 2WAQA 1RO2A 3GTGI 3HOYI 3CCJZ 2W04A 2YU9I 1I50I 1P9NA 1VQ8Z 4BBRI 4DQYB 1KQSZ 3QWUA 1K8A1 2JA7I 1VQ91 4RVHA 3RZDI 4A3BI 3CMAZ 2E9HA 3CCMZ 3I4NI 4CL1A 1YJN1 2AKLA 3CC21 4A3LI 3IX0A 2K3RA 3CQZI 5LL6f 4NOZA 3G4SZ 3J80f 3KIFA 5IP7I 4BXXI 4Y7NI 2QLVB 2Y0SA 1VQ71 2OTJ1 2M48A 3G6EZ 4RV9A 1R9TI 1Y1VI 4BBSI 3S1NI 1Z03A 1KRLA 3HOVI 3S14I 3TDHB 1QVGY 3NH5A 4MD8A 1VQOZ 3FKII 1VQ6Z 5T67A 3CCU1 4DGLA 3GTJI 1KC82 3CC71 3NH4A 1K9M2 3CCJ1 5T64A 2E2JI 3M3YI 4A3GI 1VQ81 3GTLI 3LUSA 4MXUA 1M902 4A3KI 2YADA 1X0TA 5D1OA 4X6AI 3CMA1 3CCM1 2RT9A 2K5RA 2R6MA 4A3DI 1QYPA 3S1MI 1I3QI 1YI2Z 3G4S1 5D1PA 1JJ2Y 2H85A 3S16I 2R7ZI 1I6HI 3G6E1 3OW2Z 3VTNA 5FLMI 1K8A2 1KC81 4DK1A 4EWCA 3VB9A 4MD7A 2LFUA 2Q51A 4E2XA 2OOYB 1K9M1 3TE5B 5IP9I 2RIQA 1VQO1 2PMZA 1VQ61 1VQNZ 2R93I 3CCEZ 2V8JA 2P28A 3GKQA 1QVFY 4Y52I 1TWGI 4NBFA 3K7AI 3NDIA 1Q7Y1 3CC4Z 1S72Z 2R92I 5FLXf 4RS4A 4HH4A 3JAMb 1VQ4Z 4MD9A 4RVDA 3CXCY 3D9XA 3CCRZ 3U50C 1VQP1 4XX2A 4A3FI 1WIIA 4RVFA 1VQKZ 5C4JI 3HOWI 2J6AA 1YI21 1RNIA 3PO3S 2DE6A 4BY1I 4TNUA 3GTQI 1YITZ 1VLAA 1YUKA 3MZKB 3I4MI 3NDJA 5A2Qb 5CM2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6M A;  3EED A;  4MD8 A;  2M48 A;  1JWH C;  4DGL A;  4MD7 A;  2JMO A;  4MD9 A;  2RT9 A;  4NH1 C;  1QF8 A;  1RQF A;  2M6N A; 
#chains in the Genus database with same CATH topology
 4HGZ A;  3S2D I;  2JA5 I;  1N2F A;  1TFI A;  3HKZ A;  5C44 I;  3CCL 1;  4E31 A;  2JNY A;  2QEX Z;  2JIQ A;  2HU9 A;  1RO4 A;  1K73 1;  1VQM Z;  2VPW A;  1USP B;  3GTM S;  3H3V J;  1QVG Z;  2JIP A;  3I55 1;  1VQN 1;  1M1K 1;  3CPW Y;  4NB8 A;  4NH1 C;  1W2B Y;  2PK7 A;  1ZB9 A;  2OZK A;  2JS4 A;  4NBH A;  3CCE 1;  3HOZ I;  2V8I A;  1Y1W I;  3F3F C;  2GTH A;  3J7A 4;  1TWF I;  2JIR A;  1PFT A;  3CC4 1;  1S72 1;  1VQL 1;  4NBA A;  1L1O C;  4QTT A;  1LQL A;  1N8R 2;  2NVY I;  4A3I I;  1VQ4 1;  3NFZ A;  4NBD A;  2JIM A;  2M6N A;  2PM9 A;  3EER A;  4RVG A;  2VPY A;  2GTI A;  3S15 I;  2I3C A;  4A3C I;  4E30 A;  4E2Y A;  2QRC B;  1X3W A;  1Q7Y 2;  3G71 Z;  4AYB A;  3VMI A;  1NJI 2;  1YIT 1;  4BY7 I;  1JJ2 Z;  2OTL Z;  2RPR A;  5IT9 b;  2GU2 A;  3GCF A;  2QEX 1;  2NAP A;  2E2H I;  4A3E I;  3CCQ Z;  1N8R 1;  1VQM 1;  3CCS Z;  2QKD A;  3CD6 Z;  1YJW Z;  3GTP I;  2E2I I;  3VMG A;  1YUA A;  4MH4 A;  3FQQ A;  2LEX A;  2ZAE B;  1TWH I;  3HOX I;  3S2H I;  1X3Z A;  4E2Z A;  1QVF Z;  3D2L A;  2KPI A;  4A3J I;  3Q87 A;  1NJI 1;  1YIJ Z;  1TWC I;  1Z02 A;  2KI7 B;  1K73 2;  2RHB A;  3T4N B;  3KIH A;  1Z01 A;  3CXC Z;  1M1K 2;  3JAM f;  1Q82 1;  3PO3 I;  1NP6 A;  2NVT I;  2W03 A;  4MRI A;  3G71 1;  4NBE A;  3BG0 B;  3RZO I;  2LIY A;  3F3P C;  1SIW A;  1Q81 2;  2OTL 1;  1WW9 A;  3GTK I;  3GTO I;  4MON A;  2VUM I;  1KQS Y;  1JWH C;  3GTM I;  1SFO I;  3CCQ 1;  3MON A;  3CCS 1;  3CD6 1;  5A2Q f;  1YJW 1;  1RQF A;  1YHQ Z;  3J80 b;  3IF8 A;  1VQ5 Z;  3I56 Z;  2F4M A;  3M4O I;  3EED A;  3CPW Z;  1W2B Z;  2QA4 Z;  4NB9 A;  2IZ3 A;  2RBL A;  1ZB8 A;  2EGT A;  1KD1 1;  2JIO A;  2NVQ I;  1YIJ 1;  3MZL B;  5C3E I;  3D6W A;  2JA8 I;  1Q81 1;  2QR1 B;  2JMO A;  5C4X I;  3I07 A;  3CCR 1;  1Y1V S;  3CCV Z;  2JR6 A;  2QRE B;  1YJ9 Z;  2AYD A;  5AN9 F;  2QRD B;  2OOX B;  3CME Z;  1VQK 1;  1RO0 A;  4NBG A;  1TWA I;  4NFR A;  4E33 A;  2P3Y A;  3ESW A;  3P5J B;  2DE7 A;  3NH8 A;  1DL6 A;  2IZ4 A;  4A93 I;  3PO2 I;  1Q82 2;  3S1Q I;  1RLY A;  1WJ2 A;  1WCM I;  1VQP Z;  1VQ9 Z;  2VF1 A;  2V8K A;  1YHQ 1;  3J81 b;  5IT9 f;  1VQ5 1;  4E32 A;  1Q86 2;  3I56 1;  2JUB A;  5T6B A;  2O4H A;  3FQM A;  3S1R I;  1YJN Z;  3J81 f;  3CC2 Z;  2QA4 1;  1S7M A;  2O53 A;  3S17 I;  2NVX I;  3OW2 Y;  4A3M I;  2B63 I;  2JA6 I;  2VUG A;  4HGY A;  1VQ7 Z;  2OTJ Z;  1USP A;  4QTU A;  1QF8 A;  3CCL Z;  2Q4Z A;  2HF1 A;  3VMH A;  3H0G I;  3IFU A;  2DE5 A;  4NBB A;  1ML8 A;  2BJO A;  4E2W A;  1K83 I;  3CCV 1;  4NBC A;  3I55 Z;  1M90 1;  3HOU I;  1YJ9 1;  5FLX b;  3CME 1;  3CCU Z;  4S1T A;  1KD1 2;  2WB1 A;  2F4O A;  3BG1 B;  2G2K A;  1VQL Z;  1ZH1 A;  5D1O B;  1AA6 A;  3CC7 Z;  1NUI A;  1WZN A;  1Q86 1;  2WAQ A;  1RO2 A;  3GTG I;  3HOY I;  3CCJ Z;  2W04 A;  2YU9 I;  1I50 I;  1P9N A;  1VQ8 Z;  4BBR I;  4DQY B;  1KQS Z;  3QWU A;  1K8A 1;  2JA7 I;  1VQ9 1;  4RVH A;  3RZD I;  4A3B I;  3CMA Z;  2E9H A;  3CCM Z;  2VPX A;  3I4N I;  4CL1 A;  1YJN 1;  2AKL A;  3CC2 1;  4A3L I;  3IX0 A;  2K3R A;  3CQZ I;  5LL6 f;  4NOZ A;  3G4S Z;  3J80 f;  3KIF A;  5IP7 I;  4BXX I;  4Y7N I;  2QLV B;  2Y0S A;  1VQ7 1;  2OTJ 1;  2M48 A;  3G6E Z;  4RV9 A;  1R9T I;  1Y1V I;  2V45 A;  4BBS I;  3S1N I;  1Z03 A;  1KRL A;  3HOV I;  3S14 I;  3TDH B;  1QVG Y;  3NH5 A;  4MD8 A;  1VQO Z;  3FKI I;  1VQ6 Z;  5T67 A;  3CCU 1;  4DGL A;  3GTJ I;  1KC8 2;  3CC7 1;  3NH4 A;  1K9M 2;  3CCJ 1;  2VPZ A;  5T64 A;  2E2J I;  3M3Y I;  4A3G I;  1VQ8 1;  3GTL I;  3LUS A;  4MXU A;  1M90 2;  4A3K I;  2YAD A;  1X0T A;  5D1O A;  4X6A I;  3CMA 1;  3CCM 1;  2RT9 A;  2K5R A;  2R6M A;  1Y8C A;  4A3D I;  1QYP A;  2E7Z A;  3S1M I;  1I3Q I;  1YI2 Z;  3G4S 1;  5D1P A;  1JJ2 Y;  2H85 A;  3S16 I;  2R7Z I;  1I6H I;  3G6E 1;  3OW2 Z;  3VTN A;  5FLM I;  1K8A 2;  1KC8 1;  4DK1 A;  4EWC A;  3VB9 A;  4MD7 A;  2LFU A;  2Q51 A;  4E2X A;  3IR7 A;  2OOY B;  1K9M 1;  3TE5 B;  5IP9 I;  2RIQ A;  1VQO 1;  2PMZ A;  1VQ6 1;  1VQN Z;  2R93 I;  1FDO A;  3CCE Z;  2V8J A;  2P28 A;  3GKQ A;  1QVF Y;  4Y52 I;  1TWG I;  4NBF A;  3K7A I;  3NDI A;  1QXF A;  1Q7Y 1;  3CC4 Z;  1S72 Z;  2R92 I;  5FLX f;  4RS4 A;  4HH4 A;  3JAM b;  1VQ4 Z;  4MD9 A;  4RVD A;  3CXC Y;  3D9X A;  3CCR Z;  3U50 C;  1VQP 1;  4XX2 A;  4A3F I;  2IV2 X;  1WII A;  4RVF A;  1VQK Z;  5C4J I;  3HOW I;  1FDI A;  2J6A A;  1YI2 1;  1RNI A;  3PO3 S;  2DE6 A;  4BY1 I;  4TNU A;  3GTQ I;  2V3V A;  1Q16 A;  1YIT Z;  1VLA A;  1YUK A;  3MZK B;  3I4M I;  3NDJ A;  5A2Q b;  5CM2 M; 
#chains in the Genus database with same CATH homology
 4HGZ A;  3S2D I;  2JA5 I;  1N2F A;  1TFI A;  3HKZ A;  5C44 I;  3CCL 1;  4E31 A;  2JNY A;  2QEX Z;  2HU9 A;  1RO4 A;  1K73 1;  1VQM Z;  1USP B;  3GTM S;  3H3V J;  1QVG Z;  3I55 1;  1VQN 1;  1M1K 1;  3CPW Y;  4NB8 A;  4NH1 C;  1W2B Y;  2PK7 A;  1ZB9 A;  2OZK A;  2JS4 A;  4NBH A;  3CCE 1;  3HOZ I;  2V8I A;  1Y1W I;  3F3F C;  2GTH A;  3J7A 4;  1TWF I;  1PFT A;  3CC4 1;  1S72 1;  1VQL 1;  4NBA A;  1L1O C;  4QTT A;  1LQL A;  1N8R 2;  2NVY I;  4A3I I;  1VQ4 1;  3NFZ A;  4NBD A;  2M6N A;  2PM9 A;  3EER A;  4RVG A;  2GTI A;  3S15 I;  2I3C A;  4A3C I;  4E30 A;  4E2Y A;  2QRC B;  1X3W A;  1Q7Y 2;  3G71 Z;  4AYB A;  3VMI A;  1NJI 2;  1YIT 1;  4BY7 I;  1JJ2 Z;  2OTL Z;  2RPR A;  5IT9 b;  2GU2 A;  3GCF A;  2QEX 1;  2E2H I;  4A3E I;  3CCQ Z;  1N8R 1;  1VQM 1;  3CCS Z;  2QKD A;  3CD6 Z;  1YJW Z;  3GTP I;  2E2I I;  3VMG A;  1YUA A;  4MH4 A;  3FQQ A;  2ZAE B;  1TWH I;  3HOX I;  3S2H I;  1X3Z A;  4E2Z A;  1QVF Z;  2KPI A;  4A3J I;  3Q87 A;  1NJI 1;  1YIJ Z;  1TWC I;  1Z02 A;  2KI7 B;  1K73 2;  2RHB A;  3T4N B;  3KIH A;  1Z01 A;  3CXC Z;  1M1K 2;  3JAM f;  1Q82 1;  3PO3 I;  1NP6 A;  2NVT I;  2W03 A;  4MRI A;  3G71 1;  4NBE A;  3BG0 B;  3RZO I;  2LIY A;  3F3P C;  1Q81 2;  2OTL 1;  1WW9 A;  3GTK I;  3GTO I;  4MON A;  2VUM I;  1KQS Y;  1JWH C;  3GTM I;  1SFO I;  3CCQ 1;  3MON A;  3CCS 1;  3CD6 1;  5A2Q f;  1YJW 1;  1RQF A;  1YHQ Z;  3J80 b;  3IF8 A;  1VQ5 Z;  3I56 Z;  2F4M A;  3M4O I;  3EED A;  3CPW Z;  1W2B Z;  2QA4 Z;  4NB9 A;  2IZ3 A;  2RBL A;  1ZB8 A;  2EGT A;  1KD1 1;  2NVQ I;  1YIJ 1;  3MZL B;  5C3E I;  3D6W A;  2JA8 I;  1Q81 1;  2QR1 B;  2JMO A;  5C4X I;  3I07 A;  3CCR 1;  1Y1V S;  3CCV Z;  2JR6 A;  2QRE B;  1YJ9 Z;  5AN9 F;  2QRD B;  2OOX B;  3CME Z;  1VQK 1;  1RO0 A;  4NBG A;  1TWA I;  4NFR A;  4E33 A;  2P3Y A;  3ESW A;  3P5J B;  2DE7 A;  3NH8 A;  1DL6 A;  2IZ4 A;  4A93 I;  3PO2 I;  1Q82 2;  3S1Q I;  1RLY A;  1VQP Z;  1WCM I;  1VQ9 Z;  2VF1 A;  2V8K A;  1YHQ 1;  3J81 b;  5IT9 f;  1VQ5 1;  4E32 A;  1Q86 2;  3I56 1;  2JUB A;  5T6B A;  2O4H A;  3FQM A;  3S1R I;  1YJN Z;  3J81 f;  3CC2 Z;  2QA4 1;  1S7M A;  2O53 A;  3S17 I;  2NVX I;  3OW2 Y;  4A3M I;  2B63 I;  2JA6 I;  2VUG A;  4HGY A;  1VQ7 Z;  2OTJ Z;  1USP A;  4QTU A;  1QF8 A;  3CCL Z;  2Q4Z A;  2HF1 A;  3VMH A;  3H0G I;  3IFU A;  2DE5 A;  4NBB A;  1ML8 A;  2BJO A;  4E2W A;  1K83 I;  3CCV 1;  4NBC A;  3I55 Z;  1M90 1;  3HOU I;  1YJ9 1;  5FLX b;  3CME 1;  3CCU Z;  4S1T A;  1KD1 2;  2WB1 A;  2F4O A;  3BG1 B;  2G2K A;  1VQL Z;  1ZH1 A;  5D1O B;  3CC7 Z;  1NUI A;  1Q86 1;  2WAQ A;  1RO2 A;  3GTG I;  3HOY I;  3CCJ Z;  2W04 A;  2YU9 I;  1I50 I;  1P9N A;  1VQ8 Z;  4BBR I;  4DQY B;  1KQS Z;  3QWU A;  1K8A 1;  2JA7 I;  1VQ9 1;  4RVH A;  3RZD I;  4A3B I;  3CMA Z;  2E9H A;  3CCM Z;  3I4N I;  4CL1 A;  1YJN 1;  2AKL A;  3CC2 1;  4A3L I;  3IX0 A;  2K3R A;  3CQZ I;  5LL6 f;  4NOZ A;  3G4S Z;  3J80 f;  3KIF A;  5IP7 I;  4BXX I;  4Y7N I;  2QLV B;  2Y0S A;  1VQ7 1;  2OTJ 1;  2M48 A;  3G6E Z;  4RV9 A;  1R9T I;  1Y1V I;  4BBS I;  3S1N I;  1Z03 A;  1KRL A;  3HOV I;  3S14 I;  3TDH B;  1QVG Y;  3NH5 A;  4MD8 A;  1VQO Z;  3FKI I;  1VQ6 Z;  5T67 A;  3CCU 1;  4DGL A;  3GTJ I;  1KC8 2;  3CC7 1;  3NH4 A;  1K9M 2;  3CCJ 1;  5T64 A;  2E2J I;  3M3Y I;  4A3G I;  1VQ8 1;  3GTL I;  3LUS A;  4MXU A;  1M90 2;  4A3K I;  2YAD A;  1X0T A;  5D1O A;  4X6A I;  3CMA 1;  3CCM 1;  2RT9 A;  2K5R A;  2R6M A;  4A3D I;  1QYP A;  3S1M I;  1I3Q I;  1YI2 Z;  3G4S 1;  5D1P A;  1JJ2 Y;  2H85 A;  3S16 I;  2R7Z I;  1I6H I;  3G6E 1;  3OW2 Z;  3VTN A;  5FLM I;  1K8A 2;  1KC8 1;  4DK1 A;  4EWC A;  3VB9 A;  4MD7 A;  2LFU A;  2Q51 A;  4E2X A;  2OOY B;  1K9M 1;  3TE5 B;  5IP9 I;  2RIQ A;  1VQO 1;  2PMZ A;  1VQ6 1;  1VQN Z;  2R93 I;  3CCE Z;  2V8J A;  2P28 A;  3GKQ A;  1QVF Y;  4Y52 I;  1TWG I;  4NBF A;  3K7A I;  3NDI A;  1Q7Y 1;  3CC4 Z;  1S72 Z;  2R92 I;  5FLX f;  4RS4 A;  4HH4 A;  3JAM b;  1VQ4 Z;  4MD9 A;  4RVD A;  3CXC Y;  3D9X A;  3CCR Z;  3U50 C;  1VQP 1;  4XX2 A;  4A3F I;  1WII A;  4RVF A;  1VQK Z;  5C4J I;  3HOW I;  2J6A A;  1YI2 1;  1RNI A;  3PO3 S;  2DE6 A;  4BY1 I;  4TNU A;  3GTQ I;  1YIT Z;  1VLA A;  1YUK A;  3MZK B;  3I4M I;  3NDJ A;  5A2Q b;  5CM2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...