4NH1C

Crystal structure of a heterotetrameric ck2 holoenzyme complex carrying the andante-mutation in ck2beta and consistent with proposed models of autoinhibition and trans-autophosphorylation
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHILFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title The Protein Kinase CK2(Andante) Holoenzyme Structure Supports Proposed Models of Autoregulation and Trans-Autophosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 201
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4nh1C01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4nh1C02
4NH1C 2M6NA 2R6MA 1JWHC 4MD9A 4MD7A 2JMOA 2M48A 3EEDA 1QF8A 2RT9A 1RQFA 4MD8A 4DGLA
chains in the Genus database with same CATH superfamily
4E33A 3HOXI 2DE7A 5D1OA 3J81b 3S16I 3CMEZ 3CCR1 3J80f 4E2WA 2WAQA 1N8R2 1TWGI 4MD8A 3GTGI 1Q862 2JA5I 3TE5B 3CCSZ 4A3II 1YJW1 1TWHI 4A3MI 1NJI1 3S15I 2RPRA 3S1QI 1VQ5Z 4DQYB 2QEXZ 2JA8I 3CCMZ 2Y0SA 1YJNZ 1Z03A 2KPIA 3BG1B 4HGYA 1TWAI 5A2Qf 2K5RA 4QTTA 4NBCA 1YITZ 2RHBA 3GCFA 2PMZA 3M4OI 4MH4A 1S72Z 4X6AI 1X3ZA 4BBSI 3G711 3CC2Z 5LL6f 3RZOI 2P28A 3VB9A 4E32A 3IFUA 3I4MI 3F3PC 1KD11 3NH8A 4A3LI 1RO0A 2R93I 5C4JI 2OTJZ 3CCQ1 2G2KA 1KQSZ 3GTJI 3G6EZ 3NH5A 4MXUA 1RLYA 5D1PA 3S17I 5T64A 1TFIA 2NAPA 1VQ6Z 3NH4A 1YHQZ 1Q812 4S1TA 2VPWA 1Y1VI 1VQ8Z 1PFTA 2VF1A 2QLVB 2PM9A 1VLAA 1YUAA 2JMOA 2K3RA 3CC4Z 1Y1WI 3HOVI 1ML8A 3PO3I 5D1OB 2PK7A 3FQQA 3CC7Z 4EWCA 2I3CA 1VQ91 3CD6Z 2VPZA 3CCS1 2JIOA 3J7A4 1M1K2 2IV2X 4NBGA 2NVTI 2OZKA 1X3WA 1VQ51 1ZB9A 2QEX1 1K8A2 2HF1A 5C3EI 3CXCZ 3HOUI 3I55Z 1N8R1 3GTLI 1P9NA 2QREB 1R9TI 1KC82 3GTMS 1YIT1 4A3KI 5FLXf 2VUMI 1WIIA 1WW9A 3OW2Y 3D2LA 1VQLZ 5CM2M 2QA4Z 2LEXA 1WZNA 1VQ7Z 3D9XA 4HH4A 1AA6A 4NOZA 1VQ4Z 1VQNZ 3I07A 3CCU1 4E30A 4NBDA 4BBRI 4E31A 3M3YI 2OTJ1 1L1OC 4NB8A 3J80b 3S14I 1NUIA 2JIQA 4E2YA 1YUKA 2JIMA 1K732 1YHQ1 1W2BY 1SFOI 4NH1C 1VQ81 3IX0A 2V8KA 1VQP1 1M902 2F4MA 3CCEZ 3CC71 1VQM1 3HKZA 2QRDB 3JAMb 3BG0B 2RT9A 1YJ91 1LQLA 2JA6I 3IF8A 1Q16A 3NDJA 4BY1I 2OOXB 1VQK1 4CL1A 2R6MA 1X0TA 4MD9A 1ZB8A 1QXFA 3K7AI 4NBFA 2YU9I 1S7MA 3S2HI 4NB9A 4TNUA 2NVYI 3CQZI 5IP7I 2O4HA 2ZAEB 3F3FC 1TWFI 2RIQA 2DE6A 4RVDA 3G4SZ 4BXXI 1NJI2 2E2JI 1DL6A 3MZLB 4A3JI 3S1MI 4BY7I 2JS4A 3CCL1 1JJ2Z 5FLMI 1YI2Z 3GTOI 5IT9f 3I561 3VTNA 1VQL1 2QA41 3CCRZ 1VQ71 3VMIA 1K8A1 3VMHA 2E9HA 1Q821 2KI7B 3QWUA 3CPWY 4RS4A 1QF8A 2NVQI 3CME1 1QVGZ 1Q7Y1 3I4NI 3NFZA 4A3GI 2IZ4A 4RVFA 3MONA 2Q4ZA 4AYBA 1Z01A 2M48A 3H3VJ 1QVFZ 3CCM1 1YJN1 3GTKI 3HOZI 2E7ZA 1USPB 2E2HI 4A3BI 4E2ZA 3OW2Z 1FDIA 2EGTA 4XX2A 1Q861 1K9M2 3GKQA 4NBAA 2J6AA 1S721 3HOYI 1ZH1A 3CC21 2V8IA 2OOYB 2H85A 2O53A 2R7ZI 3MZKB 2JNYA 5T67A 1W2BZ 3G6E1 3G4S1 3Q87A 3EEDA 3CXCY 3PO2I 2V45A 3FKII 4NBEA 5IP9I 2GU2A 1RNIA 4A3CI 2VPYA 3S1RI 1VQ61 3TDHB 1RO4A 1WCMI 3RZDI 2JIPA 1Y8CA 1Z02A 2P3YA 2RBLA 2V3VA 2HU9A 3EERA 3J81f 3CC41 2B63I 1VQ9Z 2NVXI 1K83I 2LIYA 1USPA 3KIHA 3NDIA 2GTHA 1Y1VS 3ESWA 5A2Qb 3CCVZ 3HOWI 2VPXA 1KRLA 3P5JB 3CD61 4HGZA 1I50I 3CCJZ 3PO3S 1FDOA 4DGLA 1Q811 2M6NA 4QTUA 2JR6A 3GTMI 2LFUA 4E2XA 4MONA 3KIFA 2W03A 1WJ2A 3LUSA 1VQOZ 2R92I 4MRIA 3JAMf 3I551 3T4NB 3CMAZ 2WB1A 1YIJZ 5IT9b 2OTLZ 2W04A 5T6BA 3H0GI 2JUBA 1M1K1 3FQMA 1JWHC 3CPWZ 3CCUZ 2Q51A 2QR1B 5C44I 5AN9F 1VQ41 3S1NI 4Y52I 1VQN1 2YADA 1YJWZ 1I3QI 1KQSY 3GTQI 2IZ3A 2QKDA 4A3EI 2F4OA 1KC81 1K9M1 4RVGA 3S2DI 2JIRA 1KD12 1VQPZ 2GTIA 1JJ2Y 2DE5A 2V8JA 4RV9A 1RQFA 4A3FI 3D6WA 4RVHA 3GTPI 4DK1A 1VQMZ 4A93I 3IR7A 2JA7I 3CCE1 1SIWA 1N2FA 3CCV1 4MD7A 1YJ9Z 4A3DI 2AYDA 3G71Z 4NFRA 3U50C 2E2II 1QVGY 5FLXb 1VQKZ 3CCJ1 1QYPA 1K731 1I6HI 1Q822 3CCQZ 1NP6A 2BJOA 1M901 1Q7Y2 1QVFY 5C4XI 4Y7NI 2QRCB 3CCLZ 1TWCI 1VQO1 3VMGA 2VUGA 4NBHA 4NBBA 2AKLA 3I56Z 1RO2A 3CMA1 1YIJ1 2OTL1 1YI21
chains in the Genus database with same CATH topology
4E33A 3HOXI 2DE7A 5D1OA 3J81b 3S16I 3CMEZ 3CCR1 3J80f 4E2WA 2WAQA 1N8R2 1TWGI 4MD8A 3GTGI 1Q862 2JA5I 3TE5B 3CCSZ 4A3II 1YJW1 1TWHI 4A3MI 1NJI1 3S15I 2RPRA 3S1QI 1VQ5Z 4DQYB 2QEXZ 2JA8I 3CCMZ 2Y0SA 1YJNZ 1Z03A 2KPIA 3BG1B 4HGYA 1TWAI 5A2Qf 2K5RA 4QTTA 4NBCA 1YITZ 2RHBA 3GCFA 2PMZA 3M4OI 4MH4A 1S72Z 4X6AI 1X3ZA 4BBSI 3G711 3CC2Z 5LL6f 3RZOI 2P28A 3VB9A 4E32A 3IFUA 3I4MI 3F3PC 1KD11 3NH8A 4A3LI 1RO0A 2R93I 5C4JI 2OTJZ 3CCQ1 2G2KA 1KQSZ 3GTJI 3G6EZ 3NH5A 4MXUA 1RLYA 5D1PA 3S17I 1TFIA 5T64A 1VQ6Z 3NH4A 1YHQZ 1Q812 4S1TA 1Y1VI 1VQ8Z 1PFTA 2VF1A 2QLVB 2PM9A 1VLAA 1YUAA 2JMOA 2K3RA 3CC4Z 1Y1WI 3HOVI 1ML8A 3PO3I 5D1OB 2PK7A 3FQQA 3CC7Z 4EWCA 1VQ91 2I3CA 3CD6Z 3CCS1 3J7A4 1M1K2 4NBGA 2NVTI 2OZKA 1X3WA 1VQ51 1ZB9A 2QEX1 1K8A2 2HF1A 5C3EI 3CXCZ 3HOUI 3I55Z 1N8R1 3GTLI 1P9NA 2QREB 1R9TI 1KC82 3GTMS 1YIT1 4A3KI 5FLXf 2VUMI 1WIIA 1WW9A 3OW2Y 1VQLZ 5CM2M 2QA4Z 1VQ7Z 3D9XA 4HH4A 1VQ4Z 4NOZA 1VQNZ 3I07A 3CCU1 4E30A 4NBDA 4BBRI 4E31A 3M3YI 2OTJ1 1L1OC 4NB8A 3J80b 3S14I 1NUIA 4E2YA 1YUKA 1K732 1YHQ1 1W2BY 1SFOI 4NH1C 1VQ81 3IX0A 2V8KA 1VQP1 1M902 2F4MA 3CCEZ 3CC71 1VQM1 3HKZA 2QRDB 3JAMb 3BG0B 2RT9A 1YJ91 1LQLA 2JA6I 3IF8A 3NDJA 4BY1I 2OOXB 1VQK1 4CL1A 2R6MA 1X0TA 4MD9A 1ZB8A 3K7AI 4NBFA 2YU9I 1S7MA 3S2HI 4NB9A 4TNUA 2NVYI 3CQZI 5IP7I 2O4HA 2ZAEB 3F3FC 1TWFI 2RIQA 2DE6A 4RVDA 3G4SZ 4BXXI 1NJI2 2E2JI 1DL6A 3MZLB 4A3JI 3S1MI 4BY7I 2JS4A 3CCL1 1JJ2Z 5FLMI 1YI2Z 3GTOI 5IT9f 3I561 3VTNA 1VQL1 2QA41 3CCRZ 1VQ71 3VMIA 1K8A1 3VMHA 2E9HA 1Q821 2KI7B 3QWUA 3CPWY 4RS4A 1QF8A 2NVQI 3CME1 1QVGZ 1Q7Y1 3I4NI 3NFZA 4A3GI 2IZ4A 4RVFA 3MONA 2Q4ZA 4AYBA 1Z01A 2M48A 3H3VJ 1QVFZ 3CCM1 1YJN1 3GTKI 3HOZI 1USPB 2E2HI 4A3BI 4E2ZA 3OW2Z 2EGTA 4XX2A 1Q861 1K9M2 3GKQA 4NBAA 2J6AA 1S721 3HOYI 1ZH1A 3CC21 2V8IA 2OOYB 2H85A 2O53A 2R7ZI 3MZKB 2JNYA 5T67A 1W2BZ 3G6E1 3G4S1 3Q87A 3EEDA 3CXCY 3PO2I 3FKII 4NBEA 5IP9I 2GU2A 1RNIA 4A3CI 1VQ61 3S1RI 3TDHB 1RO4A 1WCMI 3RZDI 1Z02A 2P3YA 2RBLA 2HU9A 3EERA 3J81f 3CC41 2B63I 1VQ9Z 2NVXI 1K83I 2LIYA 1USPA 3KIHA 3NDIA 2GTHA 1Y1VS 3ESWA 5A2Qb 3CCVZ 3HOWI 1KRLA 3P5JB 3CD61 4HGZA 1I50I 3CCJZ 3PO3S 4DGLA 1Q811 2M6NA 4QTUA 2JR6A 3GTMI 2LFUA 4E2XA 4MONA 3KIFA 2W03A 3LUSA 1VQOZ 2R92I 4MRIA 3JAMf 3I551 3T4NB 3CMAZ 2WB1A 1YIJZ 5IT9b 2OTLZ 2W04A 5T6BA 3H0GI 2JUBA 1M1K1 3FQMA 1JWHC 3CPWZ 3CCUZ 2Q51A 2QR1B 5C44I 5AN9F 1VQ41 3S1NI 4Y52I 1VQN1 2YADA 1YJWZ 1I3QI 1KQSY 3GTQI 2IZ3A 2QKDA 4A3EI 2F4OA 1KC81 1K9M1 4RVGA 3S2DI 1KD12 1VQPZ 2GTIA 1JJ2Y 2DE5A 2V8JA 4RV9A 1RQFA 4A3FI 3D6WA 4RVHA 3GTPI 4DK1A 1VQMZ 4A93I 2JA7I 3CCE1 1N2FA 3CCV1 4MD7A 1YJ9Z 4A3DI 3G71Z 4NFRA 3U50C 2E2II 1QVGY 5FLXb 1VQKZ 3CCJ1 1QYPA 1K731 1I6HI 1Q822 3CCQZ 1NP6A 2BJOA 1M901 1Q7Y2 1QVFY 5C4XI 4Y7NI 2QRCB 3CCLZ 1TWCI 1VQO1 3VMGA 2VUGA 4NBHA 4NBBA 2AKLA 3I56Z 1RO2A 3CMA1 1YIJ1 2OTL1 1YI21
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH1 C;  2M6N A;  2R6M A;  1JWH C;  4MD9 A;  4MD7 A;  2JMO A;  2M48 A;  3EED A;  1QF8 A;  2RT9 A;  1RQF A;  4MD8 A;  4DGL A; 
#chains in the Genus database with same CATH topology
 4E33 A;  3HOX I;  2DE7 A;  5D1O A;  3J81 b;  3S16 I;  3CME Z;  3CCR 1;  3J80 f;  4E2W A;  2WAQ A;  1N8R 2;  1TWG I;  4MD8 A;  3GTG I;  1Q86 2;  2JA5 I;  3TE5 B;  3CCS Z;  4A3I I;  1YJW 1;  1TWH I;  4A3M I;  1NJI 1;  3S15 I;  2RPR A;  3S1Q I;  1VQ5 Z;  4DQY B;  2QEX Z;  2JA8 I;  3CCM Z;  2Y0S A;  1YJN Z;  1Z03 A;  2KPI A;  3BG1 B;  4HGY A;  1TWA I;  5A2Q f;  2K5R A;  4QTT A;  4NBC A;  1YIT Z;  2RHB A;  3GCF A;  2PMZ A;  3M4O I;  4MH4 A;  1S72 Z;  4X6A I;  1X3Z A;  4BBS I;  3G71 1;  3CC2 Z;  5LL6 f;  3RZO I;  2P28 A;  3VB9 A;  4E32 A;  3IFU A;  3I4M I;  3F3P C;  1KD1 1;  3NH8 A;  4A3L I;  1RO0 A;  2R93 I;  5C4J I;  2OTJ Z;  3CCQ 1;  2G2K A;  1KQS Z;  3GTJ I;  3G6E Z;  3NH5 A;  4MXU A;  1RLY A;  5D1P A;  3S17 I;  5T64 A;  1TFI A;  2NAP A;  1VQ6 Z;  3NH4 A;  1YHQ Z;  1Q81 2;  4S1T A;  2VPW A;  1Y1V I;  1VQ8 Z;  1PFT A;  2VF1 A;  2QLV B;  2PM9 A;  1VLA A;  1YUA A;  2JMO A;  2K3R A;  3CC4 Z;  1Y1W I;  3HOV I;  1ML8 A;  3PO3 I;  5D1O B;  2PK7 A;  3FQQ A;  3CC7 Z;  4EWC A;  2I3C A;  1VQ9 1;  3CD6 Z;  2VPZ A;  3CCS 1;  2JIO A;  3J7A 4;  1M1K 2;  2IV2 X;  4NBG A;  2NVT I;  2OZK A;  1X3W A;  1VQ5 1;  1ZB9 A;  2QEX 1;  1K8A 2;  2HF1 A;  5C3E I;  3CXC Z;  3HOU I;  3I55 Z;  1N8R 1;  3GTL I;  1P9N A;  2QRE B;  1R9T I;  1KC8 2;  3GTM S;  1YIT 1;  4A3K I;  5FLX f;  2VUM I;  1WII A;  1WW9 A;  3OW2 Y;  3D2L A;  1VQL Z;  5CM2 M;  2QA4 Z;  2LEX A;  1WZN A;  1VQ7 Z;  3D9X A;  4HH4 A;  1AA6 A;  4NOZ A;  1VQ4 Z;  1VQN Z;  3I07 A;  3CCU 1;  4E30 A;  4NBD A;  4BBR I;  4E31 A;  3M3Y I;  2OTJ 1;  1L1O C;  4NB8 A;  3J80 b;  3S14 I;  1NUI A;  2JIQ A;  4E2Y A;  1YUK A;  2JIM A;  1K73 2;  1YHQ 1;  1W2B Y;  1SFO I;  4NH1 C;  1VQ8 1;  3IX0 A;  2V8K A;  1VQP 1;  1M90 2;  2F4M A;  3CCE Z;  3CC7 1;  1VQM 1;  3HKZ A;  2QRD B;  3JAM b;  3BG0 B;  2RT9 A;  1YJ9 1;  1LQL A;  2JA6 I;  3IF8 A;  1Q16 A;  3NDJ A;  4BY1 I;  2OOX B;  1VQK 1;  4CL1 A;  2R6M A;  1X0T A;  4MD9 A;  1ZB8 A;  1QXF A;  3K7A I;  4NBF A;  2YU9 I;  1S7M A;  3S2H I;  4NB9 A;  4TNU A;  2NVY I;  3CQZ I;  5IP7 I;  2O4H A;  2ZAE B;  3F3F C;  1TWF I;  2RIQ A;  2DE6 A;  4RVD A;  3G4S Z;  4BXX I;  1NJI 2;  2E2J I;  1DL6 A;  3MZL B;  4A3J I;  3S1M I;  4BY7 I;  2JS4 A;  3CCL 1;  1JJ2 Z;  5FLM I;  1YI2 Z;  3GTO I;  5IT9 f;  3I56 1;  3VTN A;  1VQL 1;  2QA4 1;  3CCR Z;  1VQ7 1;  3VMI A;  1K8A 1;  3VMH A;  2E9H A;  1Q82 1;  2KI7 B;  3QWU A;  3CPW Y;  4RS4 A;  1QF8 A;  2NVQ I;  3CME 1;  1QVG Z;  1Q7Y 1;  3I4N I;  3NFZ A;  4A3G I;  2IZ4 A;  4RVF A;  3MON A;  2Q4Z A;  4AYB A;  1Z01 A;  2M48 A;  3H3V J;  1QVF Z;  3CCM 1;  1YJN 1;  3GTK I;  3HOZ I;  2E7Z A;  1USP B;  2E2H I;  4A3B I;  4E2Z A;  3OW2 Z;  1FDI A;  2EGT A;  4XX2 A;  1Q86 1;  1K9M 2;  3GKQ A;  4NBA A;  2J6A A;  1S72 1;  3HOY I;  1ZH1 A;  3CC2 1;  2V8I A;  2OOY B;  2H85 A;  2O53 A;  2R7Z I;  3MZK B;  2JNY A;  5T67 A;  1W2B Z;  3G6E 1;  3G4S 1;  3Q87 A;  3EED A;  3CXC Y;  3PO2 I;  2V45 A;  3FKI I;  4NBE A;  5IP9 I;  2GU2 A;  1RNI A;  4A3C I;  2VPY A;  3S1R I;  1VQ6 1;  3TDH B;  1RO4 A;  1WCM I;  3RZD I;  2JIP A;  1Y8C A;  1Z02 A;  2P3Y A;  2RBL A;  2V3V A;  2HU9 A;  3EER A;  3J81 f;  3CC4 1;  2B63 I;  1VQ9 Z;  2NVX I;  1K83 I;  2LIY A;  1USP A;  3KIH A;  3NDI A;  2GTH A;  1Y1V S;  3ESW A;  5A2Q b;  3CCV Z;  3HOW I;  2VPX A;  1KRL A;  3P5J B;  3CD6 1;  4HGZ A;  1I50 I;  3CCJ Z;  3PO3 S;  1FDO A;  4DGL A;  1Q81 1;  2M6N A;  4QTU A;  2JR6 A;  3GTM I;  2LFU A;  4E2X A;  4MON A;  3KIF A;  2W03 A;  1WJ2 A;  3LUS A;  1VQO Z;  2R92 I;  4MRI A;  3JAM f;  3I55 1;  3T4N B;  3CMA Z;  2WB1 A;  1YIJ Z;  5IT9 b;  2OTL Z;  2W04 A;  5T6B A;  3H0G I;  2JUB A;  1M1K 1;  3FQM A;  1JWH C;  3CPW Z;  3CCU Z;  2Q51 A;  2QR1 B;  5C44 I;  5AN9 F;  1VQ4 1;  3S1N I;  4Y52 I;  1VQN 1;  2YAD A;  1YJW Z;  1I3Q I;  1KQS Y;  3GTQ I;  2IZ3 A;  2QKD A;  4A3E I;  2F4O A;  1KC8 1;  1K9M 1;  4RVG A;  3S2D I;  2JIR A;  1KD1 2;  1VQP Z;  2GTI A;  1JJ2 Y;  2DE5 A;  2V8J A;  4RV9 A;  1RQF A;  4A3F I;  3D6W A;  4RVH A;  3GTP I;  4DK1 A;  1VQM Z;  4A93 I;  3IR7 A;  2JA7 I;  3CCE 1;  1SIW A;  1N2F A;  3CCV 1;  4MD7 A;  1YJ9 Z;  4A3D I;  2AYD A;  3G71 Z;  4NFR A;  3U50 C;  2E2I I;  1QVG Y;  5FLX b;  1VQK Z;  3CCJ 1;  1QYP A;  1K73 1;  1I6H I;  1Q82 2;  3CCQ Z;  1NP6 A;  2BJO A;  1M90 1;  1Q7Y 2;  1QVF Y;  5C4X I;  4Y7N I;  2QRC B;  3CCL Z;  1TWC I;  1VQO 1;  3VMG A;  2VUG A;  4NBH A;  4NBB A;  2AKL A;  3I56 Z;  1RO2 A;  3CMA 1;  1YIJ 1;  2OTL 1;  1YI2 1; 
#chains in the Genus database with same CATH homology
 4E33 A;  3HOX I;  2DE7 A;  5D1O A;  3J81 b;  3S16 I;  3CME Z;  3CCR 1;  3J80 f;  4E2W A;  2WAQ A;  1N8R 2;  1TWG I;  4MD8 A;  3GTG I;  1Q86 2;  2JA5 I;  3TE5 B;  3CCS Z;  4A3I I;  1YJW 1;  1TWH I;  4A3M I;  1NJI 1;  3S15 I;  2RPR A;  3S1Q I;  1VQ5 Z;  4DQY B;  2QEX Z;  2JA8 I;  3CCM Z;  2Y0S A;  1YJN Z;  1Z03 A;  2KPI A;  3BG1 B;  4HGY A;  1TWA I;  5A2Q f;  2K5R A;  4QTT A;  4NBC A;  1YIT Z;  2RHB A;  3GCF A;  2PMZ A;  3M4O I;  4MH4 A;  1S72 Z;  4X6A I;  1X3Z A;  4BBS I;  3G71 1;  3CC2 Z;  5LL6 f;  3RZO I;  2P28 A;  3VB9 A;  4E32 A;  3IFU A;  3I4M I;  3F3P C;  1KD1 1;  3NH8 A;  4A3L I;  1RO0 A;  2R93 I;  5C4J I;  2OTJ Z;  3CCQ 1;  2G2K A;  1KQS Z;  3GTJ I;  3G6E Z;  3NH5 A;  4MXU A;  1RLY A;  5D1P A;  3S17 I;  1TFI A;  5T64 A;  1VQ6 Z;  3NH4 A;  1YHQ Z;  1Q81 2;  4S1T A;  1Y1V I;  1VQ8 Z;  1PFT A;  2VF1 A;  2QLV B;  2PM9 A;  1VLA A;  1YUA A;  2JMO A;  2K3R A;  3CC4 Z;  1Y1W I;  3HOV I;  1ML8 A;  3PO3 I;  5D1O B;  2PK7 A;  3FQQ A;  3CC7 Z;  4EWC A;  1VQ9 1;  2I3C A;  3CD6 Z;  3CCS 1;  3J7A 4;  1M1K 2;  4NBG A;  2NVT I;  2OZK A;  1X3W A;  1VQ5 1;  1ZB9 A;  2QEX 1;  1K8A 2;  2HF1 A;  5C3E I;  3CXC Z;  3HOU I;  3I55 Z;  1N8R 1;  3GTL I;  1P9N A;  2QRE B;  1R9T I;  1KC8 2;  3GTM S;  1YIT 1;  4A3K I;  5FLX f;  2VUM I;  1WII A;  1WW9 A;  3OW2 Y;  1VQL Z;  5CM2 M;  2QA4 Z;  1VQ7 Z;  3D9X A;  4HH4 A;  1VQ4 Z;  4NOZ A;  1VQN Z;  3I07 A;  3CCU 1;  4E30 A;  4NBD A;  4BBR I;  4E31 A;  3M3Y I;  2OTJ 1;  1L1O C;  4NB8 A;  3J80 b;  3S14 I;  1NUI A;  4E2Y A;  1YUK A;  1K73 2;  1YHQ 1;  1W2B Y;  1SFO I;  4NH1 C;  1VQ8 1;  3IX0 A;  2V8K A;  1VQP 1;  1M90 2;  2F4M A;  3CCE Z;  3CC7 1;  1VQM 1;  3HKZ A;  2QRD B;  3JAM b;  3BG0 B;  2RT9 A;  1YJ9 1;  1LQL A;  2JA6 I;  3IF8 A;  3NDJ A;  4BY1 I;  2OOX B;  1VQK 1;  4CL1 A;  2R6M A;  1X0T A;  4MD9 A;  1ZB8 A;  3K7A I;  4NBF A;  2YU9 I;  1S7M A;  3S2H I;  4NB9 A;  4TNU A;  2NVY I;  3CQZ I;  5IP7 I;  2O4H A;  2ZAE B;  3F3F C;  1TWF I;  2RIQ A;  2DE6 A;  4RVD A;  3G4S Z;  4BXX I;  1NJI 2;  2E2J I;  1DL6 A;  3MZL B;  4A3J I;  3S1M I;  4BY7 I;  2JS4 A;  3CCL 1;  1JJ2 Z;  5FLM I;  1YI2 Z;  3GTO I;  5IT9 f;  3I56 1;  3VTN A;  1VQL 1;  2QA4 1;  3CCR Z;  1VQ7 1;  3VMI A;  1K8A 1;  3VMH A;  2E9H A;  1Q82 1;  2KI7 B;  3QWU A;  3CPW Y;  4RS4 A;  1QF8 A;  2NVQ I;  3CME 1;  1QVG Z;  1Q7Y 1;  3I4N I;  3NFZ A;  4A3G I;  2IZ4 A;  4RVF A;  3MON A;  2Q4Z A;  4AYB A;  1Z01 A;  2M48 A;  3H3V J;  1QVF Z;  3CCM 1;  1YJN 1;  3GTK I;  3HOZ I;  1USP B;  2E2H I;  4A3B I;  4E2Z A;  3OW2 Z;  2EGT A;  4XX2 A;  1Q86 1;  1K9M 2;  3GKQ A;  4NBA A;  2J6A A;  1S72 1;  3HOY I;  1ZH1 A;  3CC2 1;  2V8I A;  2OOY B;  2H85 A;  2O53 A;  2R7Z I;  3MZK B;  2JNY A;  5T67 A;  1W2B Z;  3G6E 1;  3G4S 1;  3Q87 A;  3EED A;  3CXC Y;  3PO2 I;  3FKI I;  4NBE A;  5IP9 I;  2GU2 A;  1RNI A;  4A3C I;  1VQ6 1;  3S1R I;  3TDH B;  1RO4 A;  1WCM I;  3RZD I;  1Z02 A;  2P3Y A;  2RBL A;  2HU9 A;  3EER A;  3J81 f;  3CC4 1;  2B63 I;  1VQ9 Z;  2NVX I;  1K83 I;  2LIY A;  1USP A;  3KIH A;  3NDI A;  2GTH A;  1Y1V S;  3ESW A;  5A2Q b;  3CCV Z;  3HOW I;  1KRL A;  3P5J B;  3CD6 1;  4HGZ A;  1I50 I;  3CCJ Z;  3PO3 S;  4DGL A;  1Q81 1;  2M6N A;  4QTU A;  2JR6 A;  3GTM I;  2LFU A;  4E2X A;  4MON A;  3KIF A;  2W03 A;  3LUS A;  1VQO Z;  2R92 I;  4MRI A;  3JAM f;  3I55 1;  3T4N B;  3CMA Z;  2WB1 A;  1YIJ Z;  5IT9 b;  2OTL Z;  2W04 A;  5T6B A;  3H0G I;  2JUB A;  1M1K 1;  3FQM A;  1JWH C;  3CPW Z;  3CCU Z;  2Q51 A;  2QR1 B;  5C44 I;  5AN9 F;  1VQ4 1;  3S1N I;  4Y52 I;  1VQN 1;  2YAD A;  1YJW Z;  1I3Q I;  1KQS Y;  3GTQ I;  2IZ3 A;  2QKD A;  4A3E I;  2F4O A;  1KC8 1;  1K9M 1;  4RVG A;  3S2D I;  1KD1 2;  1VQP Z;  2GTI A;  1JJ2 Y;  2DE5 A;  2V8J A;  4RV9 A;  1RQF A;  4A3F I;  3D6W A;  4RVH A;  3GTP I;  4DK1 A;  1VQM Z;  4A93 I;  2JA7 I;  3CCE 1;  1N2F A;  3CCV 1;  4MD7 A;  1YJ9 Z;  4A3D I;  3G71 Z;  4NFR A;  3U50 C;  2E2I I;  1QVG Y;  5FLX b;  1VQK Z;  3CCJ 1;  1QYP A;  1K73 1;  1I6H I;  1Q82 2;  3CCQ Z;  1NP6 A;  2BJO A;  1M90 1;  1Q7Y 2;  1QVF Y;  5C4X I;  4Y7N I;  2QRC B;  3CCL Z;  1TWC I;  1VQO 1;  3VMG A;  2VUG A;  4NBH A;  4NBB A;  2AKL A;  3I56 Z;  1RO2 A;  3CMA 1;  1YIJ 1;  2OTL 1;  1YI2 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...