4A3KI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI02
4Y52I 3I07A 1TFIA 4A3II 4MH4A 2JR6A 1USPA 3GTLI 4A3LI 4Y7NI 5C4JI 1Y1VI 2R92I 4NBFA 2NVYI 1ML8A 1ZB9A 4A3GI 3S2HI 4BBRI 1WW9A 4NBHA 3S1RI 5FLMI 3S15I 3GCFA 4A93I 2E2II 4NB9A 3HOYI 3S16I 3S1QI 2F4OA 2PK7A 4BBSI 1ZB8A 4BY7I 2DE6A 3GTJI 1YUAA 2R93I 1TWHI 3HOVI 3S17I 1K83I 1TWAI 2DE5A 2R7ZI 4A3DI 2P3YA 4A3MI 5IP9I 2K5RA 1N2FA 2J6AA 3VB9A 5C4XI 5IP7I 5C3EI 4NBDA 1TWCI 4NBAA 3GTMS 2BJOA 3M4OI 3D6WA 3EERA 2VUMI 3PO3S 1PFTA 4A3FI 2F4MA 3HOUI 2DE7A 4QTUA 3Q87A 1VLAA 3ESWA 2AKLA 4NB8A 3H0GI 2JA7I 1I3QI 3CQZI 2B63I 2JNYA 4A3BI 4XX2A 2E2HI 1USPB 4BXXI 4NOZA 1Y1WI 1R9TI 1DL6A 1Y1VS 3I4MI 4X6AI 3S1MI 1TWGI 3PO3I 2JA8I 1X3ZA 3FKII 2JA5I 3GTMI 4NBGA 3S2DI 3M3YI 3HOXI 3PO2I 5C44I 5CM2M 4A3JI 1L1OC 3GTGI 1I6HI 1I50I 2NVTI 4NBEA 1RLYA 3VMHA 1NUIA 1TWFI 2YU9I 2NVQI 2JA6I 1QYPA 3S14I 3RZDI 3GKQA 3K7AI 4NBBA 1X3WA 3HOZI 3GTPI 1WCMI 1LQLA 3S1NI 3VMIA 3RZOI 2HF1A 4A3EI 2E2JI 2JS4A 2RBLA 3GTKI 3HOWI 3H3VJ 1RO4A 3GTOI 3LUSA 4A3KI 3U50C 3VMGA 3GTQI 3I4NI 4A3CI 2KPIA 4NBCA 4QTTA 2NVXI 1SFOI 4BY1I
chains in the Genus database with same CATH superfamily
4E2XA 4Y52I 1VQP1 1USPA 1VQ81 3GTLI 4A3LI 2VPYA 3CXCY 4NBFA 1KD12 3G71Z 1KRLA 2HU9A 2W03A 5D1OA 1W2BZ 4E33A 1YHQZ 4AYBA 3G711 3CME1 5FLMI 3MZKB 2NAPA 3CD61 3HOYI 2E7ZA 3CCQ1 3F3PC 1ZB8A 2Y0SA 4DQYB 4E30A 1AA6A 1S7MA 1YUAA 3HOVI 5T6BA 2VPZA 1TWAI 1Q861 2R7ZI 4A3DI 1VQ41 1X0TA 1VQ51 5IP9I 3VB9A 1TWCI 1Q811 3CCRZ 3NDJA 2BJOA 2V8IA 2F4MA 3HOUI 2QEXZ 3D9XA 1VQ91 2JA7I 1QXFA 3I56Z 1USPB 4BXXI 5A2Qb 2QR1B 3I4MI 1NJI2 1VQN1 4DGLA 4X6AI 3CPWY 2VF1A 2I3CA 4RVDA 3GTMI 4S1TA 4NBGA 1Z02A 5C44I 4MD8A 2JIPA 4A3JI 1VQ9Z 3MZLB 3TE5B 2O53A 1I6HI 2NVTI 1RLYA 1VQMZ 2V8KA 1QVFZ 3VMHA 1KC81 3I561 4MRIA 2NVQI 5IT9f 1K731 4MXUA 2RHBA 3CCEZ 1QYPA 3CCQZ 3RZDI 1QVFY 2M6NA 3TDHB 3G6EZ 1X3WA 4E2WA 1Q862 2LFUA 3HKZA 3G4S1 2JS4A 3HOWI 5D1PA 3T4NB 1VQ5Z 3CC21 3CCSZ 1RNIA 2GTHA 2QRCB 4NH1C 1ZH1A 3I4NI 4A3CI 2KPIA 2OTLZ 1Y1WI 1SFOI 3I07A 1TFIA 3FQQA 3CCMZ 4MH4A 4A3II 1Q821 5D1OB 1S72Z 1Y1VI 2QLVB 1M1K1 2R92I 1KD11 1ML8A 2WB1A 3CC2Z 1VQ71 3CCU1 3IFUA 4BBRI 4RV9A 1VQPZ 1YIJZ 1YI2Z 2O4HA 4NB9A 3S1QI 2F4OA 1RO2A 1YJW1 4BBSI 4DK1A 1YJ9Z 1Q822 2R93I 1TWHI 1KQSZ 3S17I 1K83I 2OZKA 3KIFA 3CCS1 2OOXB 2AYDA 2J6AA 5C4XI 2JIRA 3NFZA 4NBDA 2LIYA 1VQ6Z 1K9M2 2OOYB 2YADA 3M4OI 3D6WA 1N8R1 2DE7A 4QTUA 3H0GI 5LL6f 1Q812 3CQZI 3BG0B 3CPWZ 2JNYA 2E2HI 1VQ7Z 3QWUA 3IX0A 2W04A 1VQNZ 1VQL1 3S1MI 4E32A 1X3ZA 2JUBA 1YITZ 3PO2I 3J80f 3J80b 2QRDB 3G4SZ 1WJ2A 1I50I 1VQO1 1TWFI 1JJ2Y 1Y8CA 3OW2Z 1K9M1 4MD9A 2IZ4A 3CMAZ 3IR7A 2JIQA 1N8R2 3GTPI 1LQLA 3G6E1 3VMIA 1YIJ1 2HF1A 4A3EI 2E2JI 3H3VJ 1RO4A 4TNUA 2QA41 3U50C 3VMGA 2NVXI 5FLXb 2JR6A 3IF8A 1P9NA 4EWCA 2PMZA 2NVYI 2OTJZ 3NH4A 3FQMA 1ZB9A 4MONA 5IT9b 4HGZA 1WW9A 1M902 1Q7Y1 2OTJ1 1KC82 3GCFA 4A93I 2E2II 1Q16A 1S721 3CCV1 2JIOA 3NH5A 4RVHA 4HH4A 4RVFA 1RO0A 1QVGY 3I551 2M48A 1Z01A 1VQM1 2P3YA 3BG1B 2K5RA 5C3EI 5IP7I 4NBAA 1K8A2 3GTMS 3EERA 2VUMI 2JMOA 4A3FI 3CD6Z 1VLAA 3ESWA 2AKLA 3CCJ1 4HGYA 4MD7A 1YHQ1 2QREB 1I3QI 2K3RA 3F3FC 2B63I 4A3BI 4XX2A 3NH8A 4NOZA 1R9TI 1DL6A 2OTL1 1Y1VS 1VQLZ 1JWHC 2ZAEB 3FKII 2JA5I 3M3YI 3EEDA 5CM2M 2KI7B 1L1OC 3J81b 1YJN1 2GU2A 4RVGA 3GTGI 2Q4ZA 4E2ZA 2QEX1 1NUIA 2YU9I 3CCM1 1Z03A 5T64A 3CCL1 2E9HA 3K7AI 4NBBA 2WAQA 3S1NI 4CL1A 1SIWA 3J81f 2VPWA 3RZOI 1Q7Y2 1YJ91 3GTOI 4RS4A 3CXCZ 3GTQI 1YI21 3CMA1 3JAMb 3CC4Z 4BY1I 3CMEZ 1YJWZ 1YIT1 1JJ2Z 4Y7NI 5C4JI 5FLXf 1W2BY 3OW2Y 2EGTA 4E31A 4A3GI 3S2HI 1WZNA 4NFRA 3CCJZ 2H85A 4NBHA 3S1RI 1FDOA 3S15I 2RPRA 2QKDA 3VTNA 1VQ4Z 2VPXA 3S16I 2PK7A 4E2YA 5T67A 2LEXA 4BY7I 2DE6A 3GTJI 2G2KA 2IZ3A 2V45A 1VQK1 2DE5A 1VQOZ 5A2Qf 4A3MI 1N2FA 2RT9A 2V3VA 1RQFA 2RIQA 3KIHA 3PO3S 1PFTA 1NJI1 3P5JB 1KQSY 3Q87A 2VUGA 4NB8A 3CC71 1YJNZ 3CCUZ 2Q51A 2GTIA 3CC7Z 3JAMf 3NDIA 1TWGI 3PO3I 2P28A 2JA8I 1K8A1 3S2DI 1VQ8Z 3HOXI 1K732 3MONA 1FDIA 2QA4Z 2V8JA 4NBEA 1VQKZ 3CCR1 3CCE1 1VQ61 2JA6I 3CC41 3S14I 1WIIA 1QVGZ 3GKQA 3CCLZ 3HOZI 3CCVZ 1WCMI 1YUKA 1QF8A 2R6MA 2PM9A 1NP6A 2RBLA 3GTKI 3J7A4 2IV2X 5AN9F 3LUSA 4A3KI 2JIMA 1M1K2 3D2LA 3I55Z 1M901 4NBCA 4QTTA
chains in the Genus database with same CATH topology
4E2XA 4Y52I 1VQP1 1USPA 1VQ81 3GTLI 4A3LI 3CXCY 4NBFA 1KD12 3G71Z 1KRLA 2HU9A 2W03A 5D1OA 1W2BZ 4E33A 1YHQZ 4AYBA 3G711 3CME1 5FLMI 3MZKB 3CD61 3HOYI 3CCQ1 3F3PC 1ZB8A 2Y0SA 4DQYB 4E30A 1S7MA 1YUAA 3HOVI 5T6BA 1TWAI 1Q861 2R7ZI 4A3DI 1VQ41 1X0TA 1VQ51 5IP9I 3VB9A 1TWCI 1Q811 3CCRZ 3NDJA 2BJOA 2V8IA 2F4MA 3HOUI 2QEXZ 3D9XA 1VQ91 2JA7I 3I56Z 1USPB 4BXXI 5A2Qb 2QR1B 3I4MI 1NJI2 1VQN1 4DGLA 4X6AI 3CPWY 2VF1A 2I3CA 4RVDA 3GTMI 4S1TA 4NBGA 1Z02A 5C44I 4MD8A 4A3JI 3MZLB 3TE5B 1VQ9Z 2O53A 1I6HI 2NVTI 1RLYA 1VQMZ 2V8KA 1QVFZ 3VMHA 1KC81 3I561 4MRIA 2NVQI 5IT9f 1K731 4MXUA 2RHBA 3CCEZ 1QYPA 3CCQZ 3RZDI 1QVFY 2M6NA 3TDHB 3G6EZ 1X3WA 4E2WA 1Q862 2LFUA 3HKZA 3G4S1 2JS4A 3HOWI 5D1PA 3T4NB 1VQ5Z 3CC21 3CCSZ 1RNIA 2GTHA 2QRCB 4NH1C 1ZH1A 3I4NI 4A3CI 2KPIA 2OTLZ 1Y1WI 1SFOI 3I07A 1TFIA 3FQQA 3CCMZ 4MH4A 4A3II 1Q821 5D1OB 1S72Z 1Y1VI 2QLVB 1M1K1 2R92I 1KD11 1ML8A 2WB1A 3CC2Z 1VQ71 3CCU1 3IFUA 4BBRI 4RV9A 1VQPZ 1YIJZ 1YI2Z 2O4HA 4NB9A 3S1QI 2F4OA 1RO2A 1YJW1 4BBSI 4DK1A 1YJ9Z 1Q822 2R93I 1TWHI 1KQSZ 3S17I 1K83I 2OZKA 3KIFA 3CCS1 2OOXB 2J6AA 5C4XI 3NFZA 4NBDA 2LIYA 1VQ6Z 1K9M2 2OOYB 2YADA 3M4OI 3D6WA 1N8R1 2DE7A 4QTUA 3H0GI 5LL6f 1Q812 3CQZI 3BG0B 3CPWZ 2JNYA 2E2HI 1VQ7Z 3QWUA 3IX0A 2W04A 1VQNZ 1VQL1 3S1MI 4E32A 1X3ZA 2JUBA 1YITZ 3PO2I 3J80f 3J80b 2QRDB 3G4SZ 1I50I 1VQO1 1TWFI 1JJ2Y 3OW2Z 1K9M1 4MD9A 2IZ4A 3CMAZ 1N8R2 3GTPI 1LQLA 3G6E1 3VMIA 1YIJ1 2HF1A 4A3EI 2E2JI 3H3VJ 1RO4A 4TNUA 2QA41 3U50C 3VMGA 2NVXI 5FLXb 2JR6A 3IF8A 1P9NA 4EWCA 2PMZA 2NVYI 2OTJZ 3NH4A 3FQMA 1ZB9A 4MONA 5IT9b 4HGZA 1WW9A 1M902 1Q7Y1 2OTJ1 1KC82 3GCFA 4A93I 2E2II 1S721 3CCV1 3NH5A 4RVHA 4HH4A 4RVFA 1RO0A 1QVGY 3I551 2M48A 1Z01A 1VQM1 2P3YA 3BG1B 2K5RA 5C3EI 5IP7I 4NBAA 1K8A2 3GTMS 3EERA 2VUMI 2JMOA 4A3FI 3CD6Z 1VLAA 3ESWA 2AKLA 3CCJ1 4HGYA 4MD7A 1YHQ1 2QREB 1I3QI 2K3RA 3F3FC 2B63I 4A3BI 4XX2A 3NH8A 4NOZA 1R9TI 1DL6A 2OTL1 1Y1VS 1VQLZ 1JWHC 2ZAEB 3FKII 2JA5I 3M3YI 3EEDA 5CM2M 2KI7B 1L1OC 3J81b 1YJN1 2GU2A 4RVGA 3GTGI 2Q4ZA 4E2ZA 2QEX1 1NUIA 2YU9I 3CCM1 1Z03A 5T64A 3CCL1 2E9HA 3K7AI 4NBBA 2WAQA 3S1NI 4CL1A 3J81f 3RZOI 1Q7Y2 1YJ91 3GTOI 4RS4A 3CXCZ 3GTQI 1YI21 3CMA1 3JAMb 3CC4Z 4BY1I 3CMEZ 1YJWZ 1YIT1 1JJ2Z 4Y7NI 5C4JI 5FLXf 1W2BY 3OW2Y 2EGTA 4E31A 4A3GI 3S2HI 4NFRA 3CCJZ 2H85A 4NBHA 3S1RI 3S15I 2RPRA 2QKDA 3VTNA 1VQ4Z 3S16I 2PK7A 4E2YA 5T67A 4BY7I 2DE6A 3GTJI 2G2KA 2IZ3A 1VQK1 2DE5A 1VQOZ 5A2Qf 4A3MI 1N2FA 2RT9A 1RQFA 2RIQA 3KIHA 3PO3S 1PFTA 1NJI1 3P5JB 1KQSY 3Q87A 2VUGA 4NB8A 3CC71 1YJNZ 3CCUZ 2Q51A 2GTIA 3CC7Z 3JAMf 3NDIA 1TWGI 3PO3I 2P28A 2JA8I 1K8A1 3S2DI 1VQ8Z 3HOXI 1K732 3MONA 2QA4Z 2V8JA 4NBEA 1VQKZ 3CCR1 3CCE1 1VQ61 2JA6I 3CC41 3S14I 1WIIA 1QVGZ 3GKQA 3CCLZ 3HOZI 3CCVZ 1WCMI 1YUKA 1QF8A 2R6MA 2PM9A 1NP6A 2RBLA 3GTKI 3J7A4 5AN9F 3LUSA 4A3KI 1M1K2 3I55Z 1M901 4NBCA 4QTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y52 I;  3I07 A;  1TFI A;  4A3I I;  4MH4 A;  2JR6 A;  1USP A;  3GTL I;  4A3L I;  4Y7N I;  5C4J I;  1Y1V I;  2R92 I;  4NBF A;  2NVY I;  1ML8 A;  1ZB9 A;  4A3G I;  3S2H I;  4BBR I;  1WW9 A;  4NBH A;  3S1R I;  5FLM I;  3S15 I;  3GCF A;  4A93 I;  2E2I I;  4NB9 A;  3HOY I;  3S16 I;  3S1Q I;  2F4O A;  2PK7 A;  4BBS I;  1ZB8 A;  4BY7 I;  2DE6 A;  3GTJ I;  1YUA A;  2R93 I;  1TWH I;  3HOV I;  3S17 I;  1K83 I;  1TWA I;  2DE5 A;  2R7Z I;  4A3D I;  2P3Y A;  4A3M I;  5IP9 I;  2K5R A;  1N2F A;  2J6A A;  3VB9 A;  5C4X I;  5IP7 I;  5C3E I;  4NBD A;  1TWC I;  4NBA A;  3GTM S;  2BJO A;  3M4O I;  3D6W A;  3EER A;  2VUM I;  3PO3 S;  1PFT A;  4A3F I;  2F4M A;  3HOU I;  2DE7 A;  4QTU A;  3Q87 A;  1VLA A;  3ESW A;  2AKL A;  4NB8 A;  3H0G I;  2JA7 I;  1I3Q I;  3CQZ I;  2B63 I;  2JNY A;  4A3B I;  4XX2 A;  2E2H I;  1USP B;  4BXX I;  4NOZ A;  1Y1W I;  1R9T I;  1DL6 A;  1Y1V S;  3I4M I;  4X6A I;  3S1M I;  1TWG I;  3PO3 I;  2JA8 I;  1X3Z A;  3FKI I;  2JA5 I;  3GTM I;  4NBG A;  3S2D I;  3M3Y I;  3HOX I;  3PO2 I;  5C44 I;  5CM2 M;  4A3J I;  1L1O C;  3GTG I;  1I6H I;  1I50 I;  2NVT I;  4NBE A;  1RLY A;  3VMH A;  1NUI A;  1TWF I;  2YU9 I;  2NVQ I;  2JA6 I;  1QYP A;  3S14 I;  3RZD I;  3GKQ A;  3K7A I;  4NBB A;  1X3W A;  3HOZ I;  3GTP I;  1WCM I;  1LQL A;  3S1N I;  3VMI A;  3RZO I;  2HF1 A;  4A3E I;  2E2J I;  2JS4 A;  2RBL A;  3GTK I;  3HOW I;  3H3V J;  1RO4 A;  3GTO I;  3LUS A;  4A3K I;  3U50 C;  3VMG A;  3GTQ I;  3I4N I;  4A3C I;  2KPI A;  4NBC A;  4QTT A;  2NVX I;  1SFO I;  4BY1 I; 
#chains in the Genus database with same CATH topology
 4E2X A;  4Y52 I;  1VQP 1;  1USP A;  1VQ8 1;  3GTL I;  4A3L I;  2VPY A;  3CXC Y;  4NBF A;  1KD1 2;  3G71 Z;  1KRL A;  2HU9 A;  2W03 A;  5D1O A;  1W2B Z;  4E33 A;  1YHQ Z;  4AYB A;  3G71 1;  3CME 1;  5FLM I;  3MZK B;  2NAP A;  3CD6 1;  3HOY I;  2E7Z A;  3CCQ 1;  3F3P C;  1ZB8 A;  2Y0S A;  4DQY B;  4E30 A;  1AA6 A;  1S7M A;  1YUA A;  3HOV I;  5T6B A;  2VPZ A;  1TWA I;  1Q86 1;  2R7Z I;  4A3D I;  1VQ4 1;  1X0T A;  1VQ5 1;  5IP9 I;  3VB9 A;  1TWC I;  1Q81 1;  3CCR Z;  3NDJ A;  2BJO A;  2V8I A;  2F4M A;  3HOU I;  2QEX Z;  3D9X A;  1VQ9 1;  2JA7 I;  1QXF A;  3I56 Z;  1USP B;  4BXX I;  5A2Q b;  2QR1 B;  3I4M I;  1NJI 2;  1VQN 1;  4DGL A;  4X6A I;  3CPW Y;  2VF1 A;  2I3C A;  4RVD A;  3GTM I;  4S1T A;  4NBG A;  1Z02 A;  5C44 I;  4MD8 A;  2JIP A;  4A3J I;  1VQ9 Z;  3MZL B;  3TE5 B;  2O53 A;  1I6H I;  2NVT I;  1RLY A;  1VQM Z;  2V8K A;  1QVF Z;  3VMH A;  1KC8 1;  3I56 1;  4MRI A;  2NVQ I;  5IT9 f;  1K73 1;  4MXU A;  2RHB A;  3CCE Z;  1QYP A;  3CCQ Z;  3RZD I;  1QVF Y;  2M6N A;  3TDH B;  3G6E Z;  1X3W A;  4E2W A;  1Q86 2;  2LFU A;  3HKZ A;  3G4S 1;  2JS4 A;  3HOW I;  5D1P A;  3T4N B;  1VQ5 Z;  3CC2 1;  3CCS Z;  1RNI A;  2GTH A;  2QRC B;  4NH1 C;  1ZH1 A;  3I4N I;  4A3C I;  2KPI A;  2OTL Z;  1Y1W I;  1SFO I;  3I07 A;  1TFI A;  3FQQ A;  3CCM Z;  4MH4 A;  4A3I I;  1Q82 1;  5D1O B;  1S72 Z;  1Y1V I;  2QLV B;  1M1K 1;  2R92 I;  1KD1 1;  1ML8 A;  2WB1 A;  3CC2 Z;  1VQ7 1;  3CCU 1;  3IFU A;  4BBR I;  4RV9 A;  1VQP Z;  1YIJ Z;  1YI2 Z;  2O4H A;  4NB9 A;  3S1Q I;  2F4O A;  1RO2 A;  1YJW 1;  4BBS I;  4DK1 A;  1YJ9 Z;  1Q82 2;  2R93 I;  1TWH I;  1KQS Z;  3S17 I;  1K83 I;  2OZK A;  3KIF A;  3CCS 1;  2OOX B;  2AYD A;  2J6A A;  5C4X I;  2JIR A;  3NFZ A;  4NBD A;  2LIY A;  1VQ6 Z;  1K9M 2;  2OOY B;  2YAD A;  3M4O I;  3D6W A;  1N8R 1;  2DE7 A;  4QTU A;  3H0G I;  5LL6 f;  1Q81 2;  3CQZ I;  3BG0 B;  3CPW Z;  2JNY A;  2E2H I;  1VQ7 Z;  3QWU A;  3IX0 A;  2W04 A;  1VQN Z;  1VQL 1;  3S1M I;  4E32 A;  1X3Z A;  2JUB A;  1YIT Z;  3PO2 I;  3J80 f;  3J80 b;  2QRD B;  3G4S Z;  1WJ2 A;  1I50 I;  1VQO 1;  1TWF I;  1JJ2 Y;  1Y8C A;  3OW2 Z;  1K9M 1;  4MD9 A;  2IZ4 A;  3CMA Z;  3IR7 A;  2JIQ A;  1N8R 2;  3GTP I;  1LQL A;  3G6E 1;  3VMI A;  1YIJ 1;  2HF1 A;  4A3E I;  2E2J I;  3H3V J;  1RO4 A;  4TNU A;  2QA4 1;  3U50 C;  3VMG A;  2NVX I;  5FLX b;  2JR6 A;  3IF8 A;  1P9N A;  4EWC A;  2PMZ A;  2NVY I;  2OTJ Z;  3NH4 A;  3FQM A;  1ZB9 A;  4MON A;  5IT9 b;  4HGZ A;  1WW9 A;  1M90 2;  1Q7Y 1;  2OTJ 1;  1KC8 2;  3GCF A;  4A93 I;  2E2I I;  1Q16 A;  1S72 1;  3CCV 1;  2JIO A;  3NH5 A;  4RVH A;  4HH4 A;  4RVF A;  1RO0 A;  1QVG Y;  3I55 1;  2M48 A;  1Z01 A;  1VQM 1;  2P3Y A;  3BG1 B;  2K5R A;  5C3E I;  5IP7 I;  4NBA A;  1K8A 2;  3GTM S;  3EER A;  2VUM I;  2JMO A;  4A3F I;  3CD6 Z;  1VLA A;  3ESW A;  2AKL A;  3CCJ 1;  4HGY A;  4MD7 A;  1YHQ 1;  2QRE B;  1I3Q I;  2K3R A;  3F3F C;  2B63 I;  4A3B I;  4XX2 A;  3NH8 A;  4NOZ A;  1R9T I;  1DL6 A;  2OTL 1;  1Y1V S;  1VQL Z;  1JWH C;  2ZAE B;  3FKI I;  2JA5 I;  3M3Y I;  3EED A;  5CM2 M;  2KI7 B;  1L1O C;  3J81 b;  1YJN 1;  2GU2 A;  4RVG A;  3GTG I;  2Q4Z A;  4E2Z A;  2QEX 1;  1NUI A;  2YU9 I;  3CCM 1;  1Z03 A;  5T64 A;  3CCL 1;  2E9H A;  3K7A I;  4NBB A;  2WAQ A;  3S1N I;  4CL1 A;  1SIW A;  3J81 f;  2VPW A;  3RZO I;  1Q7Y 2;  1YJ9 1;  3GTO I;  4RS4 A;  3CXC Z;  3GTQ I;  1YI2 1;  3CMA 1;  3JAM b;  3CC4 Z;  4BY1 I;  3CME Z;  1YJW Z;  1YIT 1;  1JJ2 Z;  4Y7N I;  5C4J I;  5FLX f;  1W2B Y;  3OW2 Y;  2EGT A;  4E31 A;  4A3G I;  3S2H I;  1WZN A;  4NFR A;  3CCJ Z;  2H85 A;  4NBH A;  3S1R I;  1FDO A;  3S15 I;  2RPR A;  2QKD A;  3VTN A;  1VQ4 Z;  2VPX A;  3S16 I;  2PK7 A;  4E2Y A;  5T67 A;  2LEX A;  4BY7 I;  2DE6 A;  3GTJ I;  2G2K A;  2IZ3 A;  2V45 A;  1VQK 1;  2DE5 A;  1VQO Z;  5A2Q f;  4A3M I;  1N2F A;  2RT9 A;  2V3V A;  1RQF A;  2RIQ A;  3KIH A;  3PO3 S;  1PFT A;  1NJI 1;  3P5J B;  1KQS Y;  3Q87 A;  2VUG A;  4NB8 A;  3CC7 1;  1YJN Z;  3CCU Z;  2Q51 A;  2GTI A;  3CC7 Z;  3JAM f;  3NDI A;  1TWG I;  3PO3 I;  2P28 A;  2JA8 I;  1K8A 1;  3S2D I;  1VQ8 Z;  3HOX I;  1K73 2;  3MON A;  1FDI A;  2QA4 Z;  2V8J A;  4NBE A;  1VQK Z;  3CCR 1;  3CCE 1;  1VQ6 1;  2JA6 I;  3CC4 1;  3S14 I;  1WII A;  1QVG Z;  3GKQ A;  3CCL Z;  3HOZ I;  3CCV Z;  1WCM I;  1YUK A;  1QF8 A;  2R6M A;  2PM9 A;  1NP6 A;  2RBL A;  3GTK I;  3J7A 4;  2IV2 X;  5AN9 F;  3LUS A;  4A3K I;  2JIM A;  1M1K 2;  3D2L A;  3I55 Z;  1M90 1;  4NBC A;  4QTT A; 
#chains in the Genus database with same CATH homology
 4E2X A;  4Y52 I;  1VQP 1;  1USP A;  1VQ8 1;  3GTL I;  4A3L I;  3CXC Y;  4NBF A;  1KD1 2;  3G71 Z;  1KRL A;  2HU9 A;  2W03 A;  5D1O A;  1W2B Z;  4E33 A;  1YHQ Z;  4AYB A;  3G71 1;  3CME 1;  5FLM I;  3MZK B;  3CD6 1;  3HOY I;  3CCQ 1;  3F3P C;  1ZB8 A;  2Y0S A;  4DQY B;  4E30 A;  1S7M A;  1YUA A;  3HOV I;  5T6B A;  1TWA I;  1Q86 1;  2R7Z I;  4A3D I;  1VQ4 1;  1X0T A;  1VQ5 1;  5IP9 I;  3VB9 A;  1TWC I;  1Q81 1;  3CCR Z;  3NDJ A;  2BJO A;  2V8I A;  2F4M A;  3HOU I;  2QEX Z;  3D9X A;  1VQ9 1;  2JA7 I;  3I56 Z;  1USP B;  4BXX I;  5A2Q b;  2QR1 B;  3I4M I;  1NJI 2;  1VQN 1;  4DGL A;  4X6A I;  3CPW Y;  2VF1 A;  2I3C A;  4RVD A;  3GTM I;  4S1T A;  4NBG A;  1Z02 A;  5C44 I;  4MD8 A;  4A3J I;  3MZL B;  3TE5 B;  1VQ9 Z;  2O53 A;  1I6H I;  2NVT I;  1RLY A;  1VQM Z;  2V8K A;  1QVF Z;  3VMH A;  1KC8 1;  3I56 1;  4MRI A;  2NVQ I;  5IT9 f;  1K73 1;  4MXU A;  2RHB A;  3CCE Z;  1QYP A;  3CCQ Z;  3RZD I;  1QVF Y;  2M6N A;  3TDH B;  3G6E Z;  1X3W A;  4E2W A;  1Q86 2;  2LFU A;  3HKZ A;  3G4S 1;  2JS4 A;  3HOW I;  5D1P A;  3T4N B;  1VQ5 Z;  3CC2 1;  3CCS Z;  1RNI A;  2GTH A;  2QRC B;  4NH1 C;  1ZH1 A;  3I4N I;  4A3C I;  2KPI A;  2OTL Z;  1Y1W I;  1SFO I;  3I07 A;  1TFI A;  3FQQ A;  3CCM Z;  4MH4 A;  4A3I I;  1Q82 1;  5D1O B;  1S72 Z;  1Y1V I;  2QLV B;  1M1K 1;  2R92 I;  1KD1 1;  1ML8 A;  2WB1 A;  3CC2 Z;  1VQ7 1;  3CCU 1;  3IFU A;  4BBR I;  4RV9 A;  1VQP Z;  1YIJ Z;  1YI2 Z;  2O4H A;  4NB9 A;  3S1Q I;  2F4O A;  1RO2 A;  1YJW 1;  4BBS I;  4DK1 A;  1YJ9 Z;  1Q82 2;  2R93 I;  1TWH I;  1KQS Z;  3S17 I;  1K83 I;  2OZK A;  3KIF A;  3CCS 1;  2OOX B;  2J6A A;  5C4X I;  3NFZ A;  4NBD A;  2LIY A;  1VQ6 Z;  1K9M 2;  2OOY B;  2YAD A;  3M4O I;  3D6W A;  1N8R 1;  2DE7 A;  4QTU A;  3H0G I;  5LL6 f;  1Q81 2;  3CQZ I;  3BG0 B;  3CPW Z;  2JNY A;  2E2H I;  1VQ7 Z;  3QWU A;  3IX0 A;  2W04 A;  1VQN Z;  1VQL 1;  3S1M I;  4E32 A;  1X3Z A;  2JUB A;  1YIT Z;  3PO2 I;  3J80 f;  3J80 b;  2QRD B;  3G4S Z;  1I50 I;  1VQO 1;  1TWF I;  1JJ2 Y;  3OW2 Z;  1K9M 1;  4MD9 A;  2IZ4 A;  3CMA Z;  1N8R 2;  3GTP I;  1LQL A;  3G6E 1;  3VMI A;  1YIJ 1;  2HF1 A;  4A3E I;  2E2J I;  3H3V J;  1RO4 A;  4TNU A;  2QA4 1;  3U50 C;  3VMG A;  2NVX I;  5FLX b;  2JR6 A;  3IF8 A;  1P9N A;  4EWC A;  2PMZ A;  2NVY I;  2OTJ Z;  3NH4 A;  3FQM A;  1ZB9 A;  4MON A;  5IT9 b;  4HGZ A;  1WW9 A;  1M90 2;  1Q7Y 1;  2OTJ 1;  1KC8 2;  3GCF A;  4A93 I;  2E2I I;  1S72 1;  3CCV 1;  3NH5 A;  4RVH A;  4HH4 A;  4RVF A;  1RO0 A;  1QVG Y;  3I55 1;  2M48 A;  1Z01 A;  1VQM 1;  2P3Y A;  3BG1 B;  2K5R A;  5C3E I;  5IP7 I;  4NBA A;  1K8A 2;  3GTM S;  3EER A;  2VUM I;  2JMO A;  4A3F I;  3CD6 Z;  1VLA A;  3ESW A;  2AKL A;  3CCJ 1;  4HGY A;  4MD7 A;  1YHQ 1;  2QRE B;  1I3Q I;  2K3R A;  3F3F C;  2B63 I;  4A3B I;  4XX2 A;  3NH8 A;  4NOZ A;  1R9T I;  1DL6 A;  2OTL 1;  1Y1V S;  1VQL Z;  1JWH C;  2ZAE B;  3FKI I;  2JA5 I;  3M3Y I;  3EED A;  5CM2 M;  2KI7 B;  1L1O C;  3J81 b;  1YJN 1;  2GU2 A;  4RVG A;  3GTG I;  2Q4Z A;  4E2Z A;  2QEX 1;  1NUI A;  2YU9 I;  3CCM 1;  1Z03 A;  5T64 A;  3CCL 1;  2E9H A;  3K7A I;  4NBB A;  2WAQ A;  3S1N I;  4CL1 A;  3J81 f;  3RZO I;  1Q7Y 2;  1YJ9 1;  3GTO I;  4RS4 A;  3CXC Z;  3GTQ I;  1YI2 1;  3CMA 1;  3JAM b;  3CC4 Z;  4BY1 I;  3CME Z;  1YJW Z;  1YIT 1;  1JJ2 Z;  4Y7N I;  5C4J I;  5FLX f;  1W2B Y;  3OW2 Y;  2EGT A;  4E31 A;  4A3G I;  3S2H I;  4NFR A;  3CCJ Z;  2H85 A;  4NBH A;  3S1R I;  3S15 I;  2RPR A;  2QKD A;  3VTN A;  1VQ4 Z;  3S16 I;  2PK7 A;  4E2Y A;  5T67 A;  4BY7 I;  2DE6 A;  3GTJ I;  2G2K A;  2IZ3 A;  1VQK 1;  2DE5 A;  1VQO Z;  5A2Q f;  4A3M I;  1N2F A;  2RT9 A;  1RQF A;  2RIQ A;  3KIH A;  3PO3 S;  1PFT A;  1NJI 1;  3P5J B;  1KQS Y;  3Q87 A;  2VUG A;  4NB8 A;  3CC7 1;  1YJN Z;  3CCU Z;  2Q51 A;  2GTI A;  3CC7 Z;  3JAM f;  3NDI A;  1TWG I;  3PO3 I;  2P28 A;  2JA8 I;  1K8A 1;  3S2D I;  1VQ8 Z;  3HOX I;  1K73 2;  3MON A;  2QA4 Z;  2V8J A;  4NBE A;  1VQK Z;  3CCR 1;  3CCE 1;  1VQ6 1;  2JA6 I;  3CC4 1;  3S14 I;  1WII A;  1QVG Z;  3GKQ A;  3CCL Z;  3HOZ I;  3CCV Z;  1WCM I;  1YUK A;  1QF8 A;  2R6M A;  2PM9 A;  1NP6 A;  2RBL A;  3GTK I;  3J7A 4;  5AN9 F;  3LUS A;  4A3K I;  1M1K 2;  3I55 Z;  1M90 1;  4NBC A;  4QTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...