4A3KI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI02
4NBGA 3HOWI 4A3FI 2DE7A 4QTUA 1Y1VI 3GTJI 1X3WA 3VMHA 4NBCA 4BBRI 4A3II 3GTQI 3Q87A 4NBDA 2DE5A 1TWFI 3PO2I 4BY1I 3GTKI 1QYPA 2F4OA 1RO4A 3VB9A 3RZDI 3PO3I 4A3MI 1R9TI 3HOVI 3S1NI 2B63I 5C3EI 1TWHI 3EERA 4NB9A 2R7ZI 4A3BI 3K7AI 4A3EI 5FLMI 4NBEA 3VMIA 4Y52I 3RZOI 1LQLA 2JNYA 1NUIA 2F4MA 4A3JI 3FKII 3GTMI 1X3ZA 5IP9I 1N2FA 2JR6A 1TWAI 2P3YA 5IP7I 1USPA 1I6HI 2VUMI 3S15I 2HF1A 2JA7I 1WW9A 4QTTA 1Y1WI 4NBHA 3S1QI 3PO3S 5C44I 2NVTI 4NB8A 3GKQA 4BBSI 3S1RI 3VMGA 1VLAA 3S17I 2AKLA 3S16I 3ESWA 1ZB9A 4A3LI 2NVXI 5C4JI 3M3YI 2YU9I 2R93I 1Y1VS 2RBLA 3GCFA 3GTGI 4BY7I 2BJOA 4NBFA 2E2II 4NBAA 3HOYI 2JA5I 2DE6A 1SFOI 1ML8A 4A3CI 2NVQI 3H3VJ 3LUSA 3U50C 3S2DI 5CM2M 2K5RA 1L1OC 3HOXI 4A3GI 3GTOI 4Y7NI 2KPIA 2PK7A 1TFIA 3HOUI 3S2HI 1WCMI 4A3KI 4A3DI 2J6AA 3S1MI 3GTPI 4A93I 3S14I 2E2HI 4XX2A 1I3QI 3I4NI 1RLYA 1I50I 4X6AI 2E2JI 3GTLI 1PFTA 4BXXI 1TWCI 1YUAA 1DL6A 3D6WA 3M4OI 1TWGI 2JA6I 2JA8I 3CQZI 2NVYI 3I4MI 4MH4A 2R92I 3I07A 3GTMS 3HOZI 1K83I 3H0GI 1ZB8A 2JS4A 4NBBA 5C4XI 1USPB 4NOZA
chains in the Genus database with same CATH superfamily
3EEDA 3G711 4A3FI 1Y1VI 4E2XA 4E31A 1N8R2 1YJNZ 4NH1C 3VMHA 4NBCA 4A3II 3GTQI 4DQYB 3Q87A 2DE5A 2V8KA 1TWFI 4BY1I 1QYPA 2F4OA 1K731 1YI21 2JIPA 2OTJ1 5D1OB 2OTL1 1VQNZ 4A3EI 1KQSY 3T4NB 1ZH1A 4RVDA 1QVGZ 2JNYA 1YJ91 1X3ZA 3NH8A 1N2FA 1USPA 2WB1A 2HF1A 4RVGA 1VQ91 3CMA1 4HGYA 4HH4A 4NB8A 3I551 5A2Qf 1YITZ 1KC82 3MZLB 3ESWA 1K9M2 1ZB9A 3J80b 3CCQZ 1VQPZ 5T64A 4MXUA 2YU9I 2QRDB 2HU9A 2O53A 4RS4A 5IT9f 1M1K2 2NVQI 3U50C 1JJ2Y 3NH5A 2P28A 3GTOI 4Y7NI 2PK7A 2VPZA 4A3KI 1X0TA 2J6AA 2M48A 1YJN1 4E33A 4A93I 1Z03A 2KI7B 3CCU1 1KRLA 3I4NI 2E2JI 3GTLI 1PFTA 1TWCI 1YUAA 1VQ6Z 3I56Z 1VQMZ 2NVYI 2R92I 4EWCA 3HOZI 1Q861 3CD6Z 2I3CA 1ZB8A 5C4XI 4NBBA 3NFZA 4NOZA 4MD8A 2QEX1 1VQN1 2DE7A 2M6NA 3CC7Z 4BBRI 3G4SZ 1RO2A 3PO2I 2VF1A 5FLXf 2QRCB 3GTKI 3PO3I 1W2BZ 3HOVI 3JAMf 2VPWA 3IX0A 5IT9b 3OW2Y 2V8IA 4DGLA 3D2LA 4HGZA 1Q812 4A3BI 3K7AI 3QWUA 2E9HA 3IR7A 1YIT1 2W03A 4CL1A 3HKZA 3CCE1 3J80f 3CCQ1 1VQP1 1I6HI 1M901 2GU2A 2OZKA 1VQ7Z 2VPYA 3BG0B 1NJI2 3KIFA 3CMEZ 4NBHA 1KC81 5C44I 2NVTI 1K9M1 2QA4Z 3VMGA 1Q7Y2 3J7A4 3G6EZ 2R6MA 4A3LI 1KQSZ 1SIWA 5D1OA 3CCS1 3CCVZ 5FLXb 3M3YI 1VQ61 2RBLA 1VQM1 1FDOA 2JA5I 3JAMb 3CCJZ 3CD61 2E7ZA 3LUSA 1VQ8Z 3D9XA 1L1OC 4A3GI 1VQK1 2EGTA 2NAPA 3S2HI 1VQ4Z 2H85A 3GTPI 3CC71 3G4S1 3S14I 3MONA 1KD11 4E30A 4BXXI 4TNUA 2JA8I 3CQZI 3I4MI 2LFUA 3GTMS 1K732 2LEXA 1K83I 3CPWY 1S7MA 4NBGA 4QTUA 2JIMA 1VQOZ 5AN9F 4NFRA 1JJ2Z 2YADA 4NBDA 1K8A1 1QVFY 1FDIA 3IFUA 1RO4A 3VB9A 1YI2Z 3RZDI 2RPRA 4DK1A 3S1NI 1RQFA 3CCLZ 3KIHA 1RO0A 5C3EI 3EERA 2RT9A 3CME1 5D1PA 4NB9A 4E2YA 2OTLZ 1N8R1 2QA41 5LL6f 3CC2Z 3CXCY 4NBEA 3VMIA 4Y52I 1WIIA 2OOXB 2AYDA 2F4MA 2Y0SA 4MD9A 1QF8A 3G6E1 1WZNA 5IP9I 2QR1B 3FQMA 2JR6A 4E32A 3CCV1 4RVHA 1TWAI 2P3YA 2RHBA 4S1TA 2GTHA 5IP7I 1YUKA 3S15I 3J81f 2JA7I 3CCJ1 1JWHC 1Y1WI 1YIJZ 1VQ81 1P9NA 2VPXA 3I55Z 3S1QI 3PO3S 3GKQA 1YHQZ 3S1RI 2IZ3A 1VQ41 2K3RA 2AKLA 3OW2Z 1WJ2A 3S16I 1Q822 1QXFA 4AYBA 2NVXI 2G2KA 1Y1VS 2PM9A 2BJOA 2QREB 4NBFA 2E2II 4NBAA 3CC4Z 4A3CI 2O4HA 3H3VJ 4MRIA 1S72Z 3S2DI 5CM2M 1Q862 2LIYA 3F3PC 1TFIA 3HOUI 4A3DI 1VQO1 3CCMZ 2Q4ZA 3CCUZ 3MZKB 4XX2A 1I3QI 2Q51A 2IV2X 3CCRZ 1RLYA 4X6AI 2JMOA 3D6WA 1TWGI 3I561 2PMZA 4MD7A 1M1K1 2GTIA 4MH4A 3VTNA 3J81b 3BG1B 2V8JA 1Q16A 3NH4A 3H0GI 3P5JB 3CCL1 2JS4A 2R7ZI 1QVGY 1USPB 1ML8A 2QEXZ 3HOWI 1VQLZ 1VQ5Z 3CC21 3GTJI 1X3WA 3TE5B 1YJWZ 1Z01A 2V45A 3F3FC 4A3MI 1R9TI 2IZ4A 2B63I 5T6BA 2V3VA 1YIJ1 1M902 1TWHI 3G71Z 1YHQ1 1Y8CA 3CPWZ 5FLMI 3RZOI 1LQLA 2W04A 3FQQA 1NUIA 3GTMI 4A3JI 3FKII 1RNIA 3CCEZ 2VUMI 1QVFZ 4RV9A 2ZAEB 1AA6A 2OOYB 3CC41 2OTJZ 1WW9A 4QTTA 1VQ71 1Q811 1S721 1NP6A 2VUGA 1Q821 4BBSI 1VLAA 3S17I 3IF8A 4MONA 4RVFA 3CCM1 1YJ9Z 3CCR1 2JIOA 3CCSZ 3CXCZ 5C4JI 2R93I 3GCFA 3GTGI 1KD12 4BY7I 1NJI1 3NDIA 3HOYI 2DE6A 1SFOI 5T67A 1VQ9Z 3CMAZ 4E2ZA 2QLVB 1Q7Y1 3NDJA 2K5RA 3HOXI 1VQKZ 1VQL1 2KPIA 1VQ51 1WCMI 5A2Qb 3S1MI 2E2HI 1W2BY 2JIRA 1I50I 2JIQA 1YJW1 3TDHB 1K8A2 3M4OI 4E2WA 1DL6A 2JA6I 2WAQA 3I07A 1Z02A 2QKDA 2JUBA 2RIQA
chains in the Genus database with same CATH topology
3EEDA 3G711 4A3FI 1Y1VI 4E2XA 4E31A 1N8R2 1YJNZ 4NH1C 3VMHA 4NBCA 4A3II 3GTQI 4DQYB 3Q87A 2DE5A 2V8KA 1TWFI 4BY1I 1QYPA 2F4OA 1K731 1YI21 2OTJ1 5D1OB 2OTL1 1VQNZ 4A3EI 1KQSY 3T4NB 1ZH1A 4RVDA 1QVGZ 2JNYA 1YJ91 1X3ZA 3NH8A 1N2FA 1USPA 2WB1A 2HF1A 4RVGA 1VQ91 3CMA1 4HGYA 4HH4A 4NB8A 3I551 5A2Qf 1YITZ 1KC82 3MZLB 3ESWA 1K9M2 1ZB9A 3J80b 3CCQZ 1VQPZ 5T64A 4MXUA 2YU9I 2QRDB 2HU9A 2O53A 4RS4A 5IT9f 1M1K2 2NVQI 3U50C 1JJ2Y 3NH5A 2P28A 3GTOI 4Y7NI 2PK7A 4A3KI 1X0TA 2J6AA 2M48A 1YJN1 4E33A 4A93I 1Z03A 2KI7B 3CCU1 1KRLA 3I4NI 2E2JI 3GTLI 1PFTA 1TWCI 1YUAA 1VQ6Z 3I56Z 1VQMZ 2NVYI 2R92I 4EWCA 3HOZI 1Q861 3CD6Z 2I3CA 1ZB8A 5C4XI 4NBBA 3NFZA 4NOZA 4MD8A 2QEX1 1VQN1 2DE7A 2M6NA 3CC7Z 4BBRI 3G4SZ 1RO2A 3PO2I 2VF1A 5FLXf 2QRCB 3GTKI 3PO3I 1W2BZ 3HOVI 3JAMf 3IX0A 5IT9b 3OW2Y 2V8IA 4DGLA 4HGZA 1Q812 4A3BI 3K7AI 3QWUA 2E9HA 1YIT1 2W03A 4CL1A 3HKZA 3CCE1 3J80f 3CCQ1 1VQP1 1I6HI 1M901 2GU2A 2OZKA 1VQ7Z 3BG0B 1NJI2 3KIFA 3CMEZ 4NBHA 1KC81 5C44I 2NVTI 1K9M1 2QA4Z 3VMGA 1Q7Y2 3J7A4 3G6EZ 2R6MA 4A3LI 1KQSZ 5D1OA 3CCS1 3CCVZ 5FLXb 3M3YI 1VQ61 2RBLA 1VQM1 2JA5I 3JAMb 3CCJZ 3CD61 3LUSA 1VQ8Z 3D9XA 1L1OC 4A3GI 1VQK1 2EGTA 3S2HI 1VQ4Z 2H85A 3GTPI 3CC71 3G4S1 3S14I 3MONA 1KD11 4E30A 4BXXI 4TNUA 2JA8I 3CQZI 3I4MI 2LFUA 3GTMS 1K732 1K83I 3CPWY 1S7MA 4NBGA 4QTUA 1VQOZ 5AN9F 4NFRA 1JJ2Z 2YADA 4NBDA 1K8A1 1QVFY 3IFUA 1RO4A 3VB9A 1YI2Z 3RZDI 2RPRA 4DK1A 3S1NI 1RQFA 3CCLZ 3KIHA 1RO0A 5C3EI 3EERA 2RT9A 3CME1 5D1PA 4NB9A 4E2YA 2OTLZ 1N8R1 2QA41 5LL6f 3CC2Z 3CXCY 4NBEA 3VMIA 4Y52I 1WIIA 2OOXB 2F4MA 2Y0SA 4MD9A 3G6E1 1QF8A 5IP9I 2QR1B 3FQMA 2JR6A 4E32A 3CCV1 4RVHA 1TWAI 2P3YA 2RHBA 4S1TA 2GTHA 5IP7I 1YUKA 3S15I 3J81f 2JA7I 3CCJ1 1JWHC 1Y1WI 1YIJZ 1VQ81 1P9NA 3I55Z 3S1QI 3PO3S 3GKQA 1YHQZ 3S1RI 2IZ3A 1VQ41 2K3RA 2AKLA 3OW2Z 3S16I 1Q822 4AYBA 2NVXI 2G2KA 1Y1VS 2PM9A 2BJOA 2QREB 4NBFA 2E2II 4NBAA 3CC4Z 4A3CI 2O4HA 3H3VJ 4MRIA 1S72Z 3S2DI 5CM2M 1Q862 2LIYA 3F3PC 1TFIA 3HOUI 4A3DI 1VQO1 3CCMZ 2Q4ZA 3CCUZ 3MZKB 4XX2A 1I3QI 2Q51A 3CCRZ 1RLYA 4X6AI 2JMOA 3D6WA 1TWGI 3I561 2PMZA 4MD7A 1M1K1 2GTIA 4MH4A 3VTNA 3J81b 3BG1B 2V8JA 3NH4A 3H0GI 3P5JB 3CCL1 2JS4A 2R7ZI 1QVGY 1USPB 1ML8A 2QEXZ 3HOWI 1VQLZ 1VQ5Z 3CC21 3GTJI 1X3WA 3TE5B 1YJWZ 1Z01A 3F3FC 4A3MI 1R9TI 2IZ4A 2B63I 5T6BA 1YIJ1 1M902 1TWHI 3G71Z 1YHQ1 3CPWZ 5FLMI 3RZOI 1LQLA 2W04A 3FQQA 1NUIA 3GTMI 4A3JI 3FKII 1RNIA 3CCEZ 2VUMI 1QVFZ 4RV9A 2ZAEB 2OOYB 3CC41 2OTJZ 1WW9A 4QTTA 1VQ71 1Q811 1S721 1NP6A 2VUGA 1Q821 4BBSI 1VLAA 3S17I 3IF8A 4MONA 4RVFA 3CCM1 1YJ9Z 3CCR1 3CCSZ 3CXCZ 5C4JI 2R93I 3GCFA 3GTGI 1KD12 4BY7I 1NJI1 3NDIA 3HOYI 2DE6A 1SFOI 5T67A 1VQ9Z 3CMAZ 4E2ZA 2QLVB 1Q7Y1 3NDJA 2K5RA 3HOXI 1VQKZ 1VQL1 2KPIA 1VQ51 1WCMI 5A2Qb 3S1MI 2E2HI 1W2BY 1I50I 1YJW1 3TDHB 1K8A2 3M4OI 4E2WA 1DL6A 2JA6I 2WAQA 3I07A 1Z02A 2QKDA 2JUBA 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBG A;  3HOW I;  4A3F I;  2DE7 A;  4QTU A;  1Y1V I;  3GTJ I;  1X3W A;  3VMH A;  4NBC A;  4BBR I;  4A3I I;  3GTQ I;  3Q87 A;  4NBD A;  2DE5 A;  1TWF I;  3PO2 I;  4BY1 I;  3GTK I;  1QYP A;  2F4O A;  1RO4 A;  3VB9 A;  3RZD I;  3PO3 I;  4A3M I;  1R9T I;  3HOV I;  3S1N I;  2B63 I;  5C3E I;  1TWH I;  3EER A;  4NB9 A;  2R7Z I;  4A3B I;  3K7A I;  4A3E I;  5FLM I;  4NBE A;  3VMI A;  4Y52 I;  3RZO I;  1LQL A;  2JNY A;  1NUI A;  2F4M A;  4A3J I;  3FKI I;  3GTM I;  1X3Z A;  5IP9 I;  1N2F A;  2JR6 A;  1TWA I;  2P3Y A;  5IP7 I;  1USP A;  1I6H I;  2VUM I;  3S15 I;  2HF1 A;  2JA7 I;  1WW9 A;  4QTT A;  1Y1W I;  4NBH A;  3S1Q I;  3PO3 S;  5C44 I;  2NVT I;  4NB8 A;  3GKQ A;  4BBS I;  3S1R I;  3VMG A;  1VLA A;  3S17 I;  2AKL A;  3S16 I;  3ESW A;  1ZB9 A;  4A3L I;  2NVX I;  5C4J I;  3M3Y I;  2YU9 I;  2R93 I;  1Y1V S;  2RBL A;  3GCF A;  3GTG I;  4BY7 I;  2BJO A;  4NBF A;  2E2I I;  4NBA A;  3HOY I;  2JA5 I;  2DE6 A;  1SFO I;  1ML8 A;  4A3C I;  2NVQ I;  3H3V J;  3LUS A;  3U50 C;  3S2D I;  5CM2 M;  2K5R A;  1L1O C;  3HOX I;  4A3G I;  3GTO I;  4Y7N I;  2KPI A;  2PK7 A;  1TFI A;  3HOU I;  3S2H I;  1WCM I;  4A3K I;  4A3D I;  2J6A A;  3S1M I;  3GTP I;  4A93 I;  3S14 I;  2E2H I;  4XX2 A;  1I3Q I;  3I4N I;  1RLY A;  1I50 I;  4X6A I;  2E2J I;  3GTL I;  1PFT A;  4BXX I;  1TWC I;  1YUA A;  1DL6 A;  3D6W A;  3M4O I;  1TWG I;  2JA6 I;  2JA8 I;  3CQZ I;  2NVY I;  3I4M I;  4MH4 A;  2R92 I;  3I07 A;  3GTM S;  3HOZ I;  1K83 I;  3H0G I;  1ZB8 A;  2JS4 A;  4NBB A;  5C4X I;  1USP B;  4NOZ A; 
#chains in the Genus database with same CATH topology
 3EED A;  3G71 1;  4A3F I;  1Y1V I;  4E2X A;  4E31 A;  1N8R 2;  1YJN Z;  4NH1 C;  3VMH A;  4NBC A;  4A3I I;  3GTQ I;  4DQY B;  3Q87 A;  2DE5 A;  2V8K A;  1TWF I;  4BY1 I;  1QYP A;  2F4O A;  1K73 1;  1YI2 1;  2JIP A;  2OTJ 1;  5D1O B;  2OTL 1;  1VQN Z;  4A3E I;  1KQS Y;  3T4N B;  1ZH1 A;  4RVD A;  1QVG Z;  2JNY A;  1YJ9 1;  1X3Z A;  3NH8 A;  1N2F A;  1USP A;  2WB1 A;  2HF1 A;  4RVG A;  1VQ9 1;  3CMA 1;  4HGY A;  4HH4 A;  4NB8 A;  3I55 1;  5A2Q f;  1YIT Z;  1KC8 2;  3MZL B;  3ESW A;  1K9M 2;  1ZB9 A;  3J80 b;  3CCQ Z;  1VQP Z;  5T64 A;  4MXU A;  2YU9 I;  2QRD B;  2HU9 A;  2O53 A;  4RS4 A;  5IT9 f;  1M1K 2;  2NVQ I;  3U50 C;  1JJ2 Y;  3NH5 A;  2P28 A;  3GTO I;  4Y7N I;  2PK7 A;  2VPZ A;  4A3K I;  1X0T A;  2J6A A;  2M48 A;  1YJN 1;  4E33 A;  4A93 I;  1Z03 A;  2KI7 B;  3CCU 1;  1KRL A;  3I4N I;  2E2J I;  3GTL I;  1PFT A;  1TWC I;  1YUA A;  1VQ6 Z;  3I56 Z;  1VQM Z;  2NVY I;  2R92 I;  4EWC A;  3HOZ I;  1Q86 1;  3CD6 Z;  2I3C A;  1ZB8 A;  5C4X I;  4NBB A;  3NFZ A;  4NOZ A;  4MD8 A;  2QEX 1;  1VQN 1;  2DE7 A;  2M6N A;  3CC7 Z;  4BBR I;  3G4S Z;  1RO2 A;  3PO2 I;  2VF1 A;  5FLX f;  2QRC B;  3GTK I;  3PO3 I;  1W2B Z;  3HOV I;  3JAM f;  2VPW A;  3IX0 A;  5IT9 b;  3OW2 Y;  2V8I A;  4DGL A;  3D2L A;  4HGZ A;  1Q81 2;  4A3B I;  3K7A I;  3QWU A;  2E9H A;  3IR7 A;  1YIT 1;  2W03 A;  4CL1 A;  3HKZ A;  3CCE 1;  3J80 f;  3CCQ 1;  1VQP 1;  1I6H I;  1M90 1;  2GU2 A;  2OZK A;  1VQ7 Z;  2VPY A;  3BG0 B;  1NJI 2;  3KIF A;  3CME Z;  4NBH A;  1KC8 1;  5C44 I;  2NVT I;  1K9M 1;  2QA4 Z;  3VMG A;  1Q7Y 2;  3J7A 4;  3G6E Z;  2R6M A;  4A3L I;  1KQS Z;  1SIW A;  5D1O A;  3CCS 1;  3CCV Z;  5FLX b;  3M3Y I;  1VQ6 1;  2RBL A;  1VQM 1;  1FDO A;  2JA5 I;  3JAM b;  3CCJ Z;  3CD6 1;  2E7Z A;  3LUS A;  1VQ8 Z;  3D9X A;  1L1O C;  4A3G I;  1VQK 1;  2EGT A;  2NAP A;  3S2H I;  1VQ4 Z;  2H85 A;  3GTP I;  3CC7 1;  3G4S 1;  3S14 I;  3MON A;  1KD1 1;  4E30 A;  4BXX I;  4TNU A;  2JA8 I;  3CQZ I;  3I4M I;  2LFU A;  3GTM S;  1K73 2;  2LEX A;  1K83 I;  3CPW Y;  1S7M A;  4NBG A;  4QTU A;  2JIM A;  1VQO Z;  5AN9 F;  4NFR A;  1JJ2 Z;  2YAD A;  4NBD A;  1K8A 1;  1QVF Y;  1FDI A;  3IFU A;  1RO4 A;  3VB9 A;  1YI2 Z;  3RZD I;  2RPR A;  4DK1 A;  3S1N I;  1RQF A;  3CCL Z;  3KIH A;  1RO0 A;  5C3E I;  3EER A;  2RT9 A;  3CME 1;  5D1P A;  4NB9 A;  4E2Y A;  2OTL Z;  1N8R 1;  2QA4 1;  5LL6 f;  3CC2 Z;  3CXC Y;  4NBE A;  3VMI A;  4Y52 I;  1WII A;  2OOX B;  2AYD A;  2F4M A;  2Y0S A;  4MD9 A;  1QF8 A;  3G6E 1;  1WZN A;  5IP9 I;  2QR1 B;  3FQM A;  2JR6 A;  4E32 A;  3CCV 1;  4RVH A;  1TWA I;  2P3Y A;  2RHB A;  4S1T A;  2GTH A;  5IP7 I;  1YUK A;  3S15 I;  3J81 f;  2JA7 I;  3CCJ 1;  1JWH C;  1Y1W I;  1YIJ Z;  1VQ8 1;  1P9N A;  2VPX A;  3I55 Z;  3S1Q I;  3PO3 S;  3GKQ A;  1YHQ Z;  3S1R I;  2IZ3 A;  1VQ4 1;  2K3R A;  2AKL A;  3OW2 Z;  1WJ2 A;  3S16 I;  1Q82 2;  1QXF A;  4AYB A;  2NVX I;  2G2K A;  1Y1V S;  2PM9 A;  2BJO A;  2QRE B;  4NBF A;  2E2I I;  4NBA A;  3CC4 Z;  4A3C I;  2O4H A;  3H3V J;  4MRI A;  1S72 Z;  3S2D I;  5CM2 M;  1Q86 2;  2LIY A;  3F3P C;  1TFI A;  3HOU I;  4A3D I;  1VQO 1;  3CCM Z;  2Q4Z A;  3CCU Z;  3MZK B;  4XX2 A;  1I3Q I;  2Q51 A;  2IV2 X;  3CCR Z;  1RLY A;  4X6A I;  2JMO A;  3D6W A;  1TWG I;  3I56 1;  2PMZ A;  4MD7 A;  1M1K 1;  2GTI A;  4MH4 A;  3VTN A;  3J81 b;  3BG1 B;  2V8J A;  1Q16 A;  3NH4 A;  3H0G I;  3P5J B;  3CCL 1;  2JS4 A;  2R7Z I;  1QVG Y;  1USP B;  1ML8 A;  2QEX Z;  3HOW I;  1VQL Z;  1VQ5 Z;  3CC2 1;  3GTJ I;  1X3W A;  3TE5 B;  1YJW Z;  1Z01 A;  2V45 A;  3F3F C;  4A3M I;  1R9T I;  2IZ4 A;  2B63 I;  5T6B A;  2V3V A;  1YIJ 1;  1M90 2;  1TWH I;  3G71 Z;  1YHQ 1;  1Y8C A;  3CPW Z;  5FLM I;  3RZO I;  1LQL A;  2W04 A;  3FQQ A;  1NUI A;  3GTM I;  4A3J I;  3FKI I;  1RNI A;  3CCE Z;  2VUM I;  1QVF Z;  4RV9 A;  2ZAE B;  1AA6 A;  2OOY B;  3CC4 1;  2OTJ Z;  1WW9 A;  4QTT A;  1VQ7 1;  1Q81 1;  1S72 1;  1NP6 A;  2VUG A;  1Q82 1;  4BBS I;  1VLA A;  3S17 I;  3IF8 A;  4MON A;  4RVF A;  3CCM 1;  1YJ9 Z;  3CCR 1;  2JIO A;  3CCS Z;  3CXC Z;  5C4J I;  2R93 I;  3GCF A;  3GTG I;  1KD1 2;  4BY7 I;  1NJI 1;  3NDI A;  3HOY I;  2DE6 A;  1SFO I;  5T67 A;  1VQ9 Z;  3CMA Z;  4E2Z A;  2QLV B;  1Q7Y 1;  3NDJ A;  2K5R A;  3HOX I;  1VQK Z;  1VQL 1;  2KPI A;  1VQ5 1;  1WCM I;  5A2Q b;  3S1M I;  2E2H I;  1W2B Y;  2JIR A;  1I50 I;  2JIQ A;  1YJW 1;  3TDH B;  1K8A 2;  3M4O I;  4E2W A;  1DL6 A;  2JA6 I;  2WAQ A;  3I07 A;  1Z02 A;  2QKD A;  2JUB A;  2RIQ A; 
#chains in the Genus database with same CATH homology
 3EED A;  3G71 1;  4A3F I;  1Y1V I;  4E2X A;  4E31 A;  1N8R 2;  1YJN Z;  4NH1 C;  3VMH A;  4NBC A;  4A3I I;  3GTQ I;  4DQY B;  3Q87 A;  2DE5 A;  2V8K A;  1TWF I;  4BY1 I;  1QYP A;  2F4O A;  1K73 1;  1YI2 1;  2OTJ 1;  5D1O B;  2OTL 1;  1VQN Z;  4A3E I;  1KQS Y;  3T4N B;  1ZH1 A;  4RVD A;  1QVG Z;  2JNY A;  1YJ9 1;  1X3Z A;  3NH8 A;  1N2F A;  1USP A;  2WB1 A;  2HF1 A;  4RVG A;  1VQ9 1;  3CMA 1;  4HGY A;  4HH4 A;  4NB8 A;  3I55 1;  5A2Q f;  1YIT Z;  1KC8 2;  3MZL B;  3ESW A;  1K9M 2;  1ZB9 A;  3J80 b;  3CCQ Z;  1VQP Z;  5T64 A;  4MXU A;  2YU9 I;  2QRD B;  2HU9 A;  2O53 A;  4RS4 A;  5IT9 f;  1M1K 2;  2NVQ I;  3U50 C;  1JJ2 Y;  3NH5 A;  2P28 A;  3GTO I;  4Y7N I;  2PK7 A;  4A3K I;  1X0T A;  2J6A A;  2M48 A;  1YJN 1;  4E33 A;  4A93 I;  1Z03 A;  2KI7 B;  3CCU 1;  1KRL A;  3I4N I;  2E2J I;  3GTL I;  1PFT A;  1TWC I;  1YUA A;  1VQ6 Z;  3I56 Z;  1VQM Z;  2NVY I;  2R92 I;  4EWC A;  3HOZ I;  1Q86 1;  3CD6 Z;  2I3C A;  1ZB8 A;  5C4X I;  4NBB A;  3NFZ A;  4NOZ A;  4MD8 A;  2QEX 1;  1VQN 1;  2DE7 A;  2M6N A;  3CC7 Z;  4BBR I;  3G4S Z;  1RO2 A;  3PO2 I;  2VF1 A;  5FLX f;  2QRC B;  3GTK I;  3PO3 I;  1W2B Z;  3HOV I;  3JAM f;  3IX0 A;  5IT9 b;  3OW2 Y;  2V8I A;  4DGL A;  4HGZ A;  1Q81 2;  4A3B I;  3K7A I;  3QWU A;  2E9H A;  1YIT 1;  2W03 A;  4CL1 A;  3HKZ A;  3CCE 1;  3J80 f;  3CCQ 1;  1VQP 1;  1I6H I;  1M90 1;  2GU2 A;  2OZK A;  1VQ7 Z;  3BG0 B;  1NJI 2;  3KIF A;  3CME Z;  4NBH A;  1KC8 1;  5C44 I;  2NVT I;  1K9M 1;  2QA4 Z;  3VMG A;  1Q7Y 2;  3J7A 4;  3G6E Z;  2R6M A;  4A3L I;  1KQS Z;  5D1O A;  3CCS 1;  3CCV Z;  5FLX b;  3M3Y I;  1VQ6 1;  2RBL A;  1VQM 1;  2JA5 I;  3JAM b;  3CCJ Z;  3CD6 1;  3LUS A;  1VQ8 Z;  3D9X A;  1L1O C;  4A3G I;  1VQK 1;  2EGT A;  3S2H I;  1VQ4 Z;  2H85 A;  3GTP I;  3CC7 1;  3G4S 1;  3S14 I;  3MON A;  1KD1 1;  4E30 A;  4BXX I;  4TNU A;  2JA8 I;  3CQZ I;  3I4M I;  2LFU A;  3GTM S;  1K73 2;  1K83 I;  3CPW Y;  1S7M A;  4NBG A;  4QTU A;  1VQO Z;  5AN9 F;  4NFR A;  1JJ2 Z;  2YAD A;  4NBD A;  1K8A 1;  1QVF Y;  3IFU A;  1RO4 A;  3VB9 A;  1YI2 Z;  3RZD I;  2RPR A;  4DK1 A;  3S1N I;  1RQF A;  3CCL Z;  3KIH A;  1RO0 A;  5C3E I;  3EER A;  2RT9 A;  3CME 1;  5D1P A;  4NB9 A;  4E2Y A;  2OTL Z;  1N8R 1;  2QA4 1;  5LL6 f;  3CC2 Z;  3CXC Y;  4NBE A;  3VMI A;  4Y52 I;  1WII A;  2OOX B;  2F4M A;  2Y0S A;  4MD9 A;  3G6E 1;  1QF8 A;  5IP9 I;  2QR1 B;  3FQM A;  2JR6 A;  4E32 A;  3CCV 1;  4RVH A;  1TWA I;  2P3Y A;  2RHB A;  4S1T A;  2GTH A;  5IP7 I;  1YUK A;  3S15 I;  3J81 f;  2JA7 I;  3CCJ 1;  1JWH C;  1Y1W I;  1YIJ Z;  1VQ8 1;  1P9N A;  3I55 Z;  3S1Q I;  3PO3 S;  3GKQ A;  1YHQ Z;  3S1R I;  2IZ3 A;  1VQ4 1;  2K3R A;  2AKL A;  3OW2 Z;  3S16 I;  1Q82 2;  4AYB A;  2NVX I;  2G2K A;  1Y1V S;  2PM9 A;  2BJO A;  2QRE B;  4NBF A;  2E2I I;  4NBA A;  3CC4 Z;  4A3C I;  2O4H A;  3H3V J;  4MRI A;  1S72 Z;  3S2D I;  5CM2 M;  1Q86 2;  2LIY A;  3F3P C;  1TFI A;  3HOU I;  4A3D I;  1VQO 1;  3CCM Z;  2Q4Z A;  3CCU Z;  3MZK B;  4XX2 A;  1I3Q I;  2Q51 A;  3CCR Z;  1RLY A;  4X6A I;  2JMO A;  3D6W A;  1TWG I;  3I56 1;  2PMZ A;  4MD7 A;  1M1K 1;  2GTI A;  4MH4 A;  3VTN A;  3J81 b;  3BG1 B;  2V8J A;  3NH4 A;  3H0G I;  3P5J B;  3CCL 1;  2JS4 A;  2R7Z I;  1QVG Y;  1USP B;  1ML8 A;  2QEX Z;  3HOW I;  1VQL Z;  1VQ5 Z;  3CC2 1;  3GTJ I;  1X3W A;  3TE5 B;  1YJW Z;  1Z01 A;  3F3F C;  4A3M I;  1R9T I;  2IZ4 A;  2B63 I;  5T6B A;  1YIJ 1;  1M90 2;  1TWH I;  3G71 Z;  1YHQ 1;  3CPW Z;  5FLM I;  3RZO I;  1LQL A;  2W04 A;  3FQQ A;  1NUI A;  3GTM I;  4A3J I;  3FKI I;  1RNI A;  3CCE Z;  2VUM I;  1QVF Z;  4RV9 A;  2ZAE B;  2OOY B;  3CC4 1;  2OTJ Z;  1WW9 A;  4QTT A;  1VQ7 1;  1Q81 1;  1S72 1;  1NP6 A;  2VUG A;  1Q82 1;  4BBS I;  1VLA A;  3S17 I;  3IF8 A;  4MON A;  4RVF A;  3CCM 1;  1YJ9 Z;  3CCR 1;  3CCS Z;  3CXC Z;  5C4J I;  2R93 I;  3GCF A;  3GTG I;  1KD1 2;  4BY7 I;  1NJI 1;  3NDI A;  3HOY I;  2DE6 A;  1SFO I;  5T67 A;  1VQ9 Z;  3CMA Z;  4E2Z A;  2QLV B;  1Q7Y 1;  3NDJ A;  2K5R A;  3HOX I;  1VQK Z;  1VQL 1;  2KPI A;  1VQ5 1;  1WCM I;  5A2Q b;  3S1M I;  2E2H I;  1W2B Y;  1I50 I;  1YJW 1;  3TDH B;  1K8A 2;  3M4O I;  4E2W A;  1DL6 A;  2JA6 I;  2WAQ A;  3I07 A;  1Z02 A;  2QKD A;  2JUB A;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...