4A3KI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI02
4BBSI 2F4OA 5IP9I 3ESWA 2J6AA 1USPA 4BBRI 4A3CI 4Y52I 3GTMI 5C4XI 4QTTA 2NVTI 3LUSA 4BY7I 2JR6A 3I07A 3HOXI 2KPIA 2DE6A 4X6AI 2B63I 4A3FI 3HOVI 2NVQI 1X3ZA 3S16I 2DE5A 1X3WA 2P3YA 3VMHA 2E2II 1I50I 3RZDI 4A3LI 4XX2A 3VMIA 1Y1VS 3HOUI 4QTUA 1WCMI 1TWCI 4NBEA 1USPB 1PFTA 3S1QI 3GTMS 1SFOI 1TFIA 2JS4A 2E2HI 1TWFI 3S17I 2JA5I 3HOWI 2E2JI 4NB9A 1YUAA 2R92I 3M3YI 4NOZA 1RLYA 2HF1A 4MH4A 4NBCA 2NVYI 2JA8I 4NB8A 1DL6A 3FKII 4A3BI 2PK7A 2NVXI 1RO4A 3HOZI 3VMGA 1TWAI 3Q87A 4A3DI 3H3VJ 3VB9A 3EERA 4NBDA 4A3MI 5FLMI 2JA6I 2K5RA 1VLAA 1ZB9A 4A3II 4A3JI 2YU9I 2RBLA 3S15I 1TWHI 2AKLA 2F4MA 3PO2I 3H0GI 3GTKI 4NBBA 5C44I 3D6WA 3GCFA 3GTLI 3K7AI 3S2DI 3PO3I 1R9TI 1WW9A 2JNYA 3U50C 4A3GI 1K83I 5C4JI 4NBFA 3HOYI 2JA7I 2VUMI 4NBGA 1LQLA 3GTJI 5CM2M 5IP7I 1ML8A 3CQZI 3S1MI 4NBHA 1QYPA 3GTPI 1Y1WI 1N2FA 1I3QI 3M4OI 1L1OC 2R7ZI 4NBAA 3S2HI 2BJOA 2DE7A 4A3EI 4Y7NI 3S14I 3I4MI 5C3EI 3PO3S 3GKQA 1TWGI 3I4NI 3GTGI 4A93I 1ZB8A 1I6HI 3GTOI 3GTQI 4A3KI 3RZOI 3S1NI 2R93I 4BY1I 1NUIA 3S1RI 4BXXI 1Y1VI
chains in the Genus database with same CATH superfamily
1YHQZ 4BBRI 4A3CI 1KD11 4QTTA 2NVTI 3CPWY 4BY7I 1KQSY 2QA4Z 3MONA 1VQOZ 2B63I 3D9XA 3IFUA 2NVQI 2QRCB 1M901 3QWUA 2V8JA 2LIYA 4XX2A 1NP6A 1Y1VS 3HOUI 5IT9f 5D1OA 1WCMI 1USPB 1PFTA 3S1QI 2LEXA 1VQ6Z 1M1K1 4RVHA 1K732 1QF8A 1RO2A 4MD8A 4E2XA 1VQ4Z 1FDOA 2E2JI 4NB9A 2R92I 1VQK1 1VQNZ 1VQ7Z 2NVYI 4E2ZA 2V8KA 4NB8A 1P9NA 3HKZA 4A3BI 2W03A 3J80b 1RO4A 1TWAI 4A3DI 2QKDA 3CCU1 1KRLA 1KQSZ 3G6EZ 2K5RA 3CC7Z 4E31A 3J80f 3CD61 1Q822 2RBLA 4S1TA 1TWHI 1Q812 3GTKI 3IX0A 4MRIA 1VQ41 3GCFA 1RQFA 2QR1B 2JNYA 1VQ61 2JA7I 3BG1B 3MZKB 3GTJI 4RVFA 3CCV1 1Q16A 1N8R1 5D1PA 1M902 3CMEZ 4NBHA 3M4OI 1YJWZ 2O53A 4NBAA 2QA41 3CPWZ 1M1K2 3S14I 2H85A 5C3EI 3I4MI 2KI7B 1YJ91 3PO3S 1K731 3I4NI 1ZB8A 1I6HI 1VQPZ 3GTOI 3RZOI 3S1RI 1Y1VI 4BBSI 1K9M1 2J6AA 1USPA 5FLXf 2IZ3A 4E2WA 1AA6A 4Y52I 3IF8A 3GTMI 2JR6A 2KPIA 4DGLA 3NH5A 3NH4A 2OTJ1 3CCS1 3CCE1 1Q821 1WIIA 1X3WA 2P3YA 3VMHA 3CCQZ 2E2II 2VPZA 4RV9A 5LL6f 5T6BA 4QTUA 3D2LA 3CCLZ 1VQ51 2G2KA 3GTMS 2WB1A 2OTL1 1TFIA 1K8A1 2P28A 3JAMf 1RO0A 2JA5I 2QRDB 3M3YI 2GU2A 5T67A 4E30A 4NOZA 1N8R2 1RLYA 2HF1A 1JJ2Y 2QREB 1QXFA 3CC41 1VQ81 3BG0B 2JA8I 2PK7A 3Q87A 3CC2Z 1Z01A 3F3PC 5FLMI 5T64A 2GTHA 1VQMZ 3CC4Z 3PO2I 4NBBA 4EWCA 2RIQA 4HH4A 3D6WA 3T4NB 2V8IA 1K9M2 1R9TI 2QEXZ 5AN9F 4A3GI 1K83I 4NBFA 1VQ5Z 3J81f 2VUMI 1LQLA 3J7A4 5CM2M 3CCR1 1Y1WI 2VPWA 2OTJZ 1L1OC 1YI21 1VQL1 2R7ZI 3I551 4AYBA 1Y8CA 1NJI2 1S7MA 2DE7A 2OOYB 3CMAZ 4Y7NI 3EEDA 1K8A2 2LFUA 3GTGI 3KIFA 2JIMA 2R93I 3S1NI 3G711 1NUIA 1VQP1 4BXXI 4E33A 5IP9I 1YJ9Z 3ESWA 1ZH1A 2O4HA 1YIT1 5C4XI 1VQN1 3LUSA 3IR7A 3HOXI 4X6AI 1YJW1 1X3ZA 3NFZA 3G4S1 1JJ2Z 3CCJ1 2DE5A 2HU9A 2GTIA 3CME1 1I50I 1YUKA 3RZDI 3CCVZ 4NFRA 2RPRA 1TWCI 4NBEA 3NDIA 2RHBA 3CCJZ 3G4SZ 1SFOI 1VQO1 3S17I 3HOWI 1WJ2A 2AYDA 2M6NA 1QVFZ 1YIJZ 2E7ZA 3FKII 1YHQ1 3HOZI 3VMGA 1YJNZ 1NJI1 5D1OB 3H3VJ 2RT9A 3VB9A 2QLVB 3EERA 2K3RA 4A3MI 2JA6I 1YIJ1 1VLAA 1ZB9A 4A3II 4A3JI 2YU9I 2R6MA 4RS4A 3S15I 1VQ71 2F4MA 3CMA1 3H0GI 1VQKZ 5C44I 3GTLI 1YI2Z 5A2Qb 1VQLZ 1WW9A 4CL1A 5C4JI 3JAMb 1VQ9Z 3HOYI 2NAPA 3I56Z 1W2BZ 3TE5B 5A2Qf 1Z03A 1ML8A 3CQZI 2ZAEB 1W2BY 3GTPI 1N2FA 3S2HI 2PMZA 2OOXB 1Q7Y1 1YITZ 2VPXA 3GKQA 3CCMZ 4HGYA 2JUBA 3CC21 4E32A 3GTQI 3G71Z 3J81b 1S721 2JIPA 1JWHC 2F4OA 4NH1C 1VQ8Z 3CXCZ 2V3VA 3I07A 3I55Z 2DE6A 4MD9A 1KC81 4A3FI 1Q861 3VTNA 3HOVI 2OTLZ 3NDJA 2Q4ZA 2IV2X 3S16I 3CCRZ 2JMOA 4A3LI 2W04A 3VMIA 3FQQA 2I3CA 3CCQ1 1SIWA 2QEX1 3CCSZ 2JS4A 2E2HI 1TWFI 3FQMA 1YUAA 3OW2Y 4TNUA 4MH4A 4NBCA 1WZNA 3TDHB 1VQM1 3P5JB 3OW2Z 1DL6A 2EGTA 2NVXI 1RNIA 1S72Z 1QVFY 1KD12 2PM9A 1Q7Y2 2Y0SA 4RVDA 2YADA 2VUGA 4NBDA 3CCM1 2JIQA 2WAQA 5IT9b 2AKLA 3KIHA 4MONA 4E2YA 2M48A 1X0TA 4HGZA 2E9HA 3K7AI 3S2DI 4DK1A 3PO3I 2VPYA 2VF1A 3F3FC 3U50C 3CCL1 1QVGY 4NBGA 3CXCY 2JIRA 1KC82 5IP7I 3I561 1Q862 4RVGA 1VQ91 4MD7A 3S1MI 1QYPA 3CCEZ 1I3QI 2JIOA 1QVGZ 2Q51A 2BJOA 4A3EI 2V45A 2OZKA 3MZLB 4MXUA 1FDIA 3CC71 3CD6Z 2IZ4A 1TWGI 3G6E1 1Z02A 4A93I 5FLXb 4A3KI 4DQYB 4BY1I 1Q811 3CCUZ 1YJN1 3NH8A
chains in the Genus database with same CATH topology
1YHQZ 4BBRI 4A3CI 1KD11 4QTTA 2NVTI 3CPWY 4BY7I 1KQSY 2QA4Z 3MONA 1VQOZ 2B63I 3D9XA 3IFUA 2NVQI 2QRCB 1M901 3QWUA 2V8JA 2LIYA 4XX2A 1NP6A 1Y1VS 3HOUI 5IT9f 5D1OA 1WCMI 1USPB 1PFTA 3S1QI 1VQ6Z 1M1K1 4RVHA 1K732 1QF8A 1RO2A 4MD8A 4E2XA 1VQ4Z 2E2JI 4NB9A 2R92I 1VQK1 1VQNZ 1VQ7Z 2NVYI 4E2ZA 2V8KA 4NB8A 1P9NA 3HKZA 4A3BI 2W03A 3J80b 1RO4A 1TWAI 4A3DI 2QKDA 3CCU1 1KRLA 1KQSZ 3G6EZ 2K5RA 3CC7Z 4E31A 3J80f 3CD61 1Q822 2RBLA 4S1TA 1TWHI 1Q812 3GTKI 3IX0A 4MRIA 1VQ41 3GCFA 1RQFA 2QR1B 2JNYA 1VQ61 2JA7I 3BG1B 3MZKB 3GTJI 4RVFA 3CCV1 1N8R1 5D1PA 1M902 3CMEZ 4NBHA 3M4OI 1YJWZ 2O53A 4NBAA 2QA41 3CPWZ 1M1K2 3S14I 2H85A 5C3EI 3I4MI 2KI7B 1YJ91 3PO3S 1K731 3I4NI 1ZB8A 1I6HI 1VQPZ 3GTOI 3RZOI 3S1RI 1Y1VI 4BBSI 1K9M1 2J6AA 1USPA 5FLXf 2IZ3A 4E2WA 4Y52I 3IF8A 3GTMI 2JR6A 2KPIA 4DGLA 3NH5A 3NH4A 2OTJ1 3CCS1 3CCE1 1Q821 1WIIA 1X3WA 2P3YA 3VMHA 3CCQZ 2E2II 4RV9A 5LL6f 5T6BA 4QTUA 3CCLZ 1VQ51 2G2KA 3GTMS 2WB1A 2OTL1 1TFIA 1K8A1 2P28A 3JAMf 1RO0A 2JA5I 2QRDB 3M3YI 2GU2A 5T67A 4E30A 4NOZA 1N8R2 1RLYA 2HF1A 1JJ2Y 2QREB 3CC41 1VQ81 3BG0B 2JA8I 2PK7A 3Q87A 3CC2Z 1Z01A 3F3PC 5FLMI 5T64A 2GTHA 1VQMZ 3CC4Z 3PO2I 4NBBA 4EWCA 2RIQA 4HH4A 3D6WA 3T4NB 2V8IA 1K9M2 1R9TI 2QEXZ 5AN9F 4A3GI 1K83I 4NBFA 1VQ5Z 3J81f 2VUMI 1LQLA 3J7A4 5CM2M 3CCR1 1Y1WI 2OTJZ 1L1OC 1YI21 1VQL1 2R7ZI 3I551 4AYBA 1NJI2 1S7MA 2DE7A 2OOYB 3CMAZ 4Y7NI 3EEDA 1K8A2 2LFUA 3GTGI 3KIFA 2R93I 3S1NI 3G711 1NUIA 1VQP1 4BXXI 4E33A 5IP9I 1YJ9Z 3ESWA 1ZH1A 2O4HA 1YIT1 5C4XI 1VQN1 3LUSA 3HOXI 4X6AI 1YJW1 1X3ZA 3NFZA 3G4S1 1JJ2Z 3CCJ1 2DE5A 2HU9A 2GTIA 3CME1 1I50I 1YUKA 3RZDI 3CCVZ 4NFRA 2RPRA 1TWCI 4NBEA 3NDIA 2RHBA 3CCJZ 3G4SZ 1SFOI 1VQO1 3S17I 3HOWI 2M6NA 1QVFZ 1YIJZ 3FKII 1YHQ1 3HOZI 3VMGA 1YJNZ 1NJI1 5D1OB 3H3VJ 2RT9A 3VB9A 2QLVB 3EERA 2K3RA 4A3MI 2JA6I 1YIJ1 1VLAA 1ZB9A 4A3II 4A3JI 2YU9I 2R6MA 4RS4A 3S15I 1VQ71 2F4MA 3CMA1 3H0GI 1VQKZ 5C44I 3GTLI 1YI2Z 5A2Qb 1VQLZ 1WW9A 4CL1A 5C4JI 3JAMb 1VQ9Z 3HOYI 3I56Z 1W2BZ 3TE5B 5A2Qf 1Z03A 1ML8A 3CQZI 2ZAEB 1W2BY 3GTPI 1N2FA 3S2HI 2PMZA 2OOXB 1Q7Y1 1YITZ 3GKQA 3CCMZ 4HGYA 2JUBA 3CC21 4E32A 3GTQI 3G71Z 3J81b 1S721 1JWHC 2F4OA 4NH1C 1VQ8Z 3CXCZ 3I07A 3I55Z 2DE6A 4MD9A 1KC81 4A3FI 1Q861 3VTNA 3HOVI 2OTLZ 3NDJA 2Q4ZA 3S16I 3CCRZ 2JMOA 4A3LI 2W04A 3VMIA 3FQQA 2I3CA 3CCQ1 2QEX1 3CCSZ 2JS4A 2E2HI 1TWFI 3FQMA 1YUAA 3OW2Y 4TNUA 4MH4A 4NBCA 3TDHB 1VQM1 3P5JB 3OW2Z 1DL6A 2EGTA 2NVXI 1RNIA 1S72Z 1QVFY 1KD12 2PM9A 1Q7Y2 2Y0SA 4RVDA 2YADA 2VUGA 4NBDA 3CCM1 2WAQA 5IT9b 2AKLA 3KIHA 4MONA 4E2YA 2M48A 1X0TA 4HGZA 2E9HA 3K7AI 3S2DI 4DK1A 3PO3I 3F3FC 2VF1A 3U50C 3CCL1 1QVGY 4NBGA 3CXCY 1KC82 5IP7I 3I561 1Q862 4RVGA 1VQ91 4MD7A 3S1MI 1QYPA 3CCEZ 1I3QI 1QVGZ 2Q51A 2BJOA 4A3EI 2OZKA 3MZLB 4MXUA 3CC71 3CD6Z 2IZ4A 1TWGI 3G6E1 1Z02A 4A93I 5FLXb 4A3KI 4DQYB 4BY1I 1Q811 3CCUZ 1YJN1 3NH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS I;  2F4O A;  5IP9 I;  3ESW A;  2J6A A;  1USP A;  4BBR I;  4A3C I;  4Y52 I;  3GTM I;  5C4X I;  4QTT A;  2NVT I;  3LUS A;  4BY7 I;  2JR6 A;  3I07 A;  3HOX I;  2KPI A;  2DE6 A;  4X6A I;  2B63 I;  4A3F I;  3HOV I;  2NVQ I;  1X3Z A;  3S16 I;  2DE5 A;  1X3W A;  2P3Y A;  3VMH A;  2E2I I;  1I50 I;  3RZD I;  4A3L I;  4XX2 A;  3VMI A;  1Y1V S;  3HOU I;  4QTU A;  1WCM I;  1TWC I;  4NBE A;  1USP B;  1PFT A;  3S1Q I;  3GTM S;  1SFO I;  1TFI A;  2JS4 A;  2E2H I;  1TWF I;  3S17 I;  2JA5 I;  3HOW I;  2E2J I;  4NB9 A;  1YUA A;  2R92 I;  3M3Y I;  4NOZ A;  1RLY A;  2HF1 A;  4MH4 A;  4NBC A;  2NVY I;  2JA8 I;  4NB8 A;  1DL6 A;  3FKI I;  4A3B I;  2PK7 A;  2NVX I;  1RO4 A;  3HOZ I;  3VMG A;  1TWA I;  3Q87 A;  4A3D I;  3H3V J;  3VB9 A;  3EER A;  4NBD A;  4A3M I;  5FLM I;  2JA6 I;  2K5R A;  1VLA A;  1ZB9 A;  4A3I I;  4A3J I;  2YU9 I;  2RBL A;  3S15 I;  1TWH I;  2AKL A;  2F4M A;  3PO2 I;  3H0G I;  3GTK I;  4NBB A;  5C44 I;  3D6W A;  3GCF A;  3GTL I;  3K7A I;  3S2D I;  3PO3 I;  1R9T I;  1WW9 A;  2JNY A;  3U50 C;  4A3G I;  1K83 I;  5C4J I;  4NBF A;  3HOY I;  2JA7 I;  2VUM I;  4NBG A;  1LQL A;  3GTJ I;  5CM2 M;  5IP7 I;  1ML8 A;  3CQZ I;  3S1M I;  4NBH A;  1QYP A;  3GTP I;  1Y1W I;  1N2F A;  1I3Q I;  3M4O I;  1L1O C;  2R7Z I;  4NBA A;  3S2H I;  2BJO A;  2DE7 A;  4A3E I;  4Y7N I;  3S14 I;  3I4M I;  5C3E I;  3PO3 S;  3GKQ A;  1TWG I;  3I4N I;  3GTG I;  4A93 I;  1ZB8 A;  1I6H I;  3GTO I;  3GTQ I;  4A3K I;  3RZO I;  3S1N I;  2R93 I;  4BY1 I;  1NUI A;  3S1R I;  4BXX I;  1Y1V I; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  4BBR I;  4A3C I;  1KD1 1;  4QTT A;  2NVT I;  3CPW Y;  4BY7 I;  1KQS Y;  2QA4 Z;  3MON A;  1VQO Z;  2B63 I;  3D9X A;  3IFU A;  2NVQ I;  2QRC B;  1M90 1;  3QWU A;  2V8J A;  2LIY A;  4XX2 A;  1NP6 A;  1Y1V S;  3HOU I;  5IT9 f;  5D1O A;  1WCM I;  1USP B;  1PFT A;  3S1Q I;  2LEX A;  1VQ6 Z;  1M1K 1;  4RVH A;  1K73 2;  1QF8 A;  1RO2 A;  4MD8 A;  4E2X A;  1VQ4 Z;  1FDO A;  2E2J I;  4NB9 A;  2R92 I;  1VQK 1;  1VQN Z;  1VQ7 Z;  2NVY I;  4E2Z A;  2V8K A;  4NB8 A;  1P9N A;  3HKZ A;  4A3B I;  2W03 A;  3J80 b;  1RO4 A;  1TWA I;  4A3D I;  2QKD A;  3CCU 1;  1KRL A;  1KQS Z;  3G6E Z;  2K5R A;  3CC7 Z;  4E31 A;  3J80 f;  3CD6 1;  1Q82 2;  2RBL A;  4S1T A;  1TWH I;  1Q81 2;  3GTK I;  3IX0 A;  4MRI A;  1VQ4 1;  3GCF A;  1RQF A;  2QR1 B;  2JNY A;  1VQ6 1;  2JA7 I;  3BG1 B;  3MZK B;  3GTJ I;  4RVF A;  3CCV 1;  1Q16 A;  1N8R 1;  5D1P A;  1M90 2;  3CME Z;  4NBH A;  3M4O I;  1YJW Z;  2O53 A;  4NBA A;  2QA4 1;  3CPW Z;  1M1K 2;  3S14 I;  2H85 A;  5C3E I;  3I4M I;  2KI7 B;  1YJ9 1;  3PO3 S;  1K73 1;  3I4N I;  1ZB8 A;  1I6H I;  1VQP Z;  3GTO I;  3RZO I;  3S1R I;  1Y1V I;  4BBS I;  1K9M 1;  2J6A A;  1USP A;  5FLX f;  2IZ3 A;  4E2W A;  1AA6 A;  4Y52 I;  3IF8 A;  3GTM I;  2JR6 A;  2KPI A;  4DGL A;  3NH5 A;  3NH4 A;  2OTJ 1;  3CCS 1;  3CCE 1;  1Q82 1;  1WII A;  1X3W A;  2P3Y A;  3VMH A;  3CCQ Z;  2E2I I;  2VPZ A;  4RV9 A;  5LL6 f;  5T6B A;  4QTU A;  3D2L A;  3CCL Z;  1VQ5 1;  2G2K A;  3GTM S;  2WB1 A;  2OTL 1;  1TFI A;  1K8A 1;  2P28 A;  3JAM f;  1RO0 A;  2JA5 I;  2QRD B;  3M3Y I;  2GU2 A;  5T67 A;  4E30 A;  4NOZ A;  1N8R 2;  1RLY A;  2HF1 A;  1JJ2 Y;  2QRE B;  1QXF A;  3CC4 1;  1VQ8 1;  3BG0 B;  2JA8 I;  2PK7 A;  3Q87 A;  3CC2 Z;  1Z01 A;  3F3P C;  5FLM I;  5T64 A;  2GTH A;  1VQM Z;  3CC4 Z;  3PO2 I;  4NBB A;  4EWC A;  2RIQ A;  4HH4 A;  3D6W A;  3T4N B;  2V8I A;  1K9M 2;  1R9T I;  2QEX Z;  5AN9 F;  4A3G I;  1K83 I;  4NBF A;  1VQ5 Z;  3J81 f;  2VUM I;  1LQL A;  3J7A 4;  5CM2 M;  3CCR 1;  1Y1W I;  2VPW A;  2OTJ Z;  1L1O C;  1YI2 1;  1VQL 1;  2R7Z I;  3I55 1;  4AYB A;  1Y8C A;  1NJI 2;  1S7M A;  2DE7 A;  2OOY B;  3CMA Z;  4Y7N I;  3EED A;  1K8A 2;  2LFU A;  3GTG I;  3KIF A;  2JIM A;  2R93 I;  3S1N I;  3G71 1;  1NUI A;  1VQP 1;  4BXX I;  4E33 A;  5IP9 I;  1YJ9 Z;  3ESW A;  1ZH1 A;  2O4H A;  1YIT 1;  5C4X I;  1VQN 1;  3LUS A;  3IR7 A;  3HOX I;  4X6A I;  1YJW 1;  1X3Z A;  3NFZ A;  3G4S 1;  1JJ2 Z;  3CCJ 1;  2DE5 A;  2HU9 A;  2GTI A;  3CME 1;  1I50 I;  1YUK A;  3RZD I;  3CCV Z;  4NFR A;  2RPR A;  1TWC I;  4NBE A;  3NDI A;  2RHB A;  3CCJ Z;  3G4S Z;  1SFO I;  1VQO 1;  3S17 I;  3HOW I;  1WJ2 A;  2AYD A;  2M6N A;  1QVF Z;  1YIJ Z;  2E7Z A;  3FKI I;  1YHQ 1;  3HOZ I;  3VMG A;  1YJN Z;  1NJI 1;  5D1O B;  3H3V J;  2RT9 A;  3VB9 A;  2QLV B;  3EER A;  2K3R A;  4A3M I;  2JA6 I;  1YIJ 1;  1VLA A;  1ZB9 A;  4A3I I;  4A3J I;  2YU9 I;  2R6M A;  4RS4 A;  3S15 I;  1VQ7 1;  2F4M A;  3CMA 1;  3H0G I;  1VQK Z;  5C44 I;  3GTL I;  1YI2 Z;  5A2Q b;  1VQL Z;  1WW9 A;  4CL1 A;  5C4J I;  3JAM b;  1VQ9 Z;  3HOY I;  2NAP A;  3I56 Z;  1W2B Z;  3TE5 B;  5A2Q f;  1Z03 A;  1ML8 A;  3CQZ I;  2ZAE B;  1W2B Y;  3GTP I;  1N2F A;  3S2H I;  2PMZ A;  2OOX B;  1Q7Y 1;  1YIT Z;  2VPX A;  3GKQ A;  3CCM Z;  4HGY A;  2JUB A;  3CC2 1;  4E32 A;  3GTQ I;  3G71 Z;  3J81 b;  1S72 1;  2JIP A;  1JWH C;  2F4O A;  4NH1 C;  1VQ8 Z;  3CXC Z;  2V3V A;  3I07 A;  3I55 Z;  2DE6 A;  4MD9 A;  1KC8 1;  4A3F I;  1Q86 1;  3VTN A;  3HOV I;  2OTL Z;  3NDJ A;  2Q4Z A;  2IV2 X;  3S16 I;  3CCR Z;  2JMO A;  4A3L I;  2W04 A;  3VMI A;  3FQQ A;  2I3C A;  3CCQ 1;  1SIW A;  2QEX 1;  3CCS Z;  2JS4 A;  2E2H I;  1TWF I;  3FQM A;  1YUA A;  3OW2 Y;  4TNU A;  4MH4 A;  4NBC A;  1WZN A;  3TDH B;  1VQM 1;  3P5J B;  3OW2 Z;  1DL6 A;  2EGT A;  2NVX I;  1RNI A;  1S72 Z;  1QVF Y;  1KD1 2;  2PM9 A;  1Q7Y 2;  2Y0S A;  4RVD A;  2YAD A;  2VUG A;  4NBD A;  3CCM 1;  2JIQ A;  2WAQ A;  5IT9 b;  2AKL A;  3KIH A;  4MON A;  4E2Y A;  2M48 A;  1X0T A;  4HGZ A;  2E9H A;  3K7A I;  3S2D I;  4DK1 A;  3PO3 I;  2VPY A;  2VF1 A;  3F3F C;  3U50 C;  3CCL 1;  1QVG Y;  4NBG A;  3CXC Y;  2JIR A;  1KC8 2;  5IP7 I;  3I56 1;  1Q86 2;  4RVG A;  1VQ9 1;  4MD7 A;  3S1M I;  1QYP A;  3CCE Z;  1I3Q I;  2JIO A;  1QVG Z;  2Q51 A;  2BJO A;  4A3E I;  2V45 A;  2OZK A;  3MZL B;  4MXU A;  1FDI A;  3CC7 1;  3CD6 Z;  2IZ4 A;  1TWG I;  3G6E 1;  1Z02 A;  4A93 I;  5FLX b;  4A3K I;  4DQY B;  4BY1 I;  1Q81 1;  3CCU Z;  1YJN 1;  3NH8 A; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  4BBR I;  4A3C I;  1KD1 1;  4QTT A;  2NVT I;  3CPW Y;  4BY7 I;  1KQS Y;  2QA4 Z;  3MON A;  1VQO Z;  2B63 I;  3D9X A;  3IFU A;  2NVQ I;  2QRC B;  1M90 1;  3QWU A;  2V8J A;  2LIY A;  4XX2 A;  1NP6 A;  1Y1V S;  3HOU I;  5IT9 f;  5D1O A;  1WCM I;  1USP B;  1PFT A;  3S1Q I;  1VQ6 Z;  1M1K 1;  4RVH A;  1K73 2;  1QF8 A;  1RO2 A;  4MD8 A;  4E2X A;  1VQ4 Z;  2E2J I;  4NB9 A;  2R92 I;  1VQK 1;  1VQN Z;  1VQ7 Z;  2NVY I;  4E2Z A;  2V8K A;  4NB8 A;  1P9N A;  3HKZ A;  4A3B I;  2W03 A;  3J80 b;  1RO4 A;  1TWA I;  4A3D I;  2QKD A;  3CCU 1;  1KRL A;  1KQS Z;  3G6E Z;  2K5R A;  3CC7 Z;  4E31 A;  3J80 f;  3CD6 1;  1Q82 2;  2RBL A;  4S1T A;  1TWH I;  1Q81 2;  3GTK I;  3IX0 A;  4MRI A;  1VQ4 1;  3GCF A;  1RQF A;  2QR1 B;  2JNY A;  1VQ6 1;  2JA7 I;  3BG1 B;  3MZK B;  3GTJ I;  4RVF A;  3CCV 1;  1N8R 1;  5D1P A;  1M90 2;  3CME Z;  4NBH A;  3M4O I;  1YJW Z;  2O53 A;  4NBA A;  2QA4 1;  3CPW Z;  1M1K 2;  3S14 I;  2H85 A;  5C3E I;  3I4M I;  2KI7 B;  1YJ9 1;  3PO3 S;  1K73 1;  3I4N I;  1ZB8 A;  1I6H I;  1VQP Z;  3GTO I;  3RZO I;  3S1R I;  1Y1V I;  4BBS I;  1K9M 1;  2J6A A;  1USP A;  5FLX f;  2IZ3 A;  4E2W A;  4Y52 I;  3IF8 A;  3GTM I;  2JR6 A;  2KPI A;  4DGL A;  3NH5 A;  3NH4 A;  2OTJ 1;  3CCS 1;  3CCE 1;  1Q82 1;  1WII A;  1X3W A;  2P3Y A;  3VMH A;  3CCQ Z;  2E2I I;  4RV9 A;  5LL6 f;  5T6B A;  4QTU A;  3CCL Z;  1VQ5 1;  2G2K A;  3GTM S;  2WB1 A;  2OTL 1;  1TFI A;  1K8A 1;  2P28 A;  3JAM f;  1RO0 A;  2JA5 I;  2QRD B;  3M3Y I;  2GU2 A;  5T67 A;  4E30 A;  4NOZ A;  1N8R 2;  1RLY A;  2HF1 A;  1JJ2 Y;  2QRE B;  3CC4 1;  1VQ8 1;  3BG0 B;  2JA8 I;  2PK7 A;  3Q87 A;  3CC2 Z;  1Z01 A;  3F3P C;  5FLM I;  5T64 A;  2GTH A;  1VQM Z;  3CC4 Z;  3PO2 I;  4NBB A;  4EWC A;  2RIQ A;  4HH4 A;  3D6W A;  3T4N B;  2V8I A;  1K9M 2;  1R9T I;  2QEX Z;  5AN9 F;  4A3G I;  1K83 I;  4NBF A;  1VQ5 Z;  3J81 f;  2VUM I;  1LQL A;  3J7A 4;  5CM2 M;  3CCR 1;  1Y1W I;  2OTJ Z;  1L1O C;  1YI2 1;  1VQL 1;  2R7Z I;  3I55 1;  4AYB A;  1NJI 2;  1S7M A;  2DE7 A;  2OOY B;  3CMA Z;  4Y7N I;  3EED A;  1K8A 2;  2LFU A;  3GTG I;  3KIF A;  2R93 I;  3S1N I;  3G71 1;  1NUI A;  1VQP 1;  4BXX I;  4E33 A;  5IP9 I;  1YJ9 Z;  3ESW A;  1ZH1 A;  2O4H A;  1YIT 1;  5C4X I;  1VQN 1;  3LUS A;  3HOX I;  4X6A I;  1YJW 1;  1X3Z A;  3NFZ A;  3G4S 1;  1JJ2 Z;  3CCJ 1;  2DE5 A;  2HU9 A;  2GTI A;  3CME 1;  1I50 I;  1YUK A;  3RZD I;  3CCV Z;  4NFR A;  2RPR A;  1TWC I;  4NBE A;  3NDI A;  2RHB A;  3CCJ Z;  3G4S Z;  1SFO I;  1VQO 1;  3S17 I;  3HOW I;  2M6N A;  1QVF Z;  1YIJ Z;  3FKI I;  1YHQ 1;  3HOZ I;  3VMG A;  1YJN Z;  1NJI 1;  5D1O B;  3H3V J;  2RT9 A;  3VB9 A;  2QLV B;  3EER A;  2K3R A;  4A3M I;  2JA6 I;  1YIJ 1;  1VLA A;  1ZB9 A;  4A3I I;  4A3J I;  2YU9 I;  2R6M A;  4RS4 A;  3S15 I;  1VQ7 1;  2F4M A;  3CMA 1;  3H0G I;  1VQK Z;  5C44 I;  3GTL I;  1YI2 Z;  5A2Q b;  1VQL Z;  1WW9 A;  4CL1 A;  5C4J I;  3JAM b;  1VQ9 Z;  3HOY I;  3I56 Z;  1W2B Z;  3TE5 B;  5A2Q f;  1Z03 A;  1ML8 A;  3CQZ I;  2ZAE B;  1W2B Y;  3GTP I;  1N2F A;  3S2H I;  2PMZ A;  2OOX B;  1Q7Y 1;  1YIT Z;  3GKQ A;  3CCM Z;  4HGY A;  2JUB A;  3CC2 1;  4E32 A;  3GTQ I;  3G71 Z;  3J81 b;  1S72 1;  1JWH C;  2F4O A;  4NH1 C;  1VQ8 Z;  3CXC Z;  3I07 A;  3I55 Z;  2DE6 A;  4MD9 A;  1KC8 1;  4A3F I;  1Q86 1;  3VTN A;  3HOV I;  2OTL Z;  3NDJ A;  2Q4Z A;  3S16 I;  3CCR Z;  2JMO A;  4A3L I;  2W04 A;  3VMI A;  3FQQ A;  2I3C A;  3CCQ 1;  2QEX 1;  3CCS Z;  2JS4 A;  2E2H I;  1TWF I;  3FQM A;  1YUA A;  3OW2 Y;  4TNU A;  4MH4 A;  4NBC A;  3TDH B;  1VQM 1;  3P5J B;  3OW2 Z;  1DL6 A;  2EGT A;  2NVX I;  1RNI A;  1S72 Z;  1QVF Y;  1KD1 2;  2PM9 A;  1Q7Y 2;  2Y0S A;  4RVD A;  2YAD A;  2VUG A;  4NBD A;  3CCM 1;  2WAQ A;  5IT9 b;  2AKL A;  3KIH A;  4MON A;  4E2Y A;  2M48 A;  1X0T A;  4HGZ A;  2E9H A;  3K7A I;  3S2D I;  4DK1 A;  3PO3 I;  3F3F C;  2VF1 A;  3U50 C;  3CCL 1;  1QVG Y;  4NBG A;  3CXC Y;  1KC8 2;  5IP7 I;  3I56 1;  1Q86 2;  4RVG A;  1VQ9 1;  4MD7 A;  3S1M I;  1QYP A;  3CCE Z;  1I3Q I;  1QVG Z;  2Q51 A;  2BJO A;  4A3E I;  2OZK A;  3MZL B;  4MXU A;  3CC7 1;  3CD6 Z;  2IZ4 A;  1TWG I;  3G6E 1;  1Z02 A;  4A93 I;  5FLX b;  4A3K I;  4DQY B;  4BY1 I;  1Q81 1;  3CCU Z;  1YJN 1;  3NH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...