4A3KI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI02
4QTUA 1WCMI 4NB8A 2P3YA 3VMIA 4BXXI 3GTMS 5FLMI 1TFIA 2E2JI 4A3FI 2AKLA 4A3KI 3HOVI 3S2HI 4NBGA 2F4MA 3HOYI 3PO3I 3D6WA 3GTOI 3FKII 3S16I 3ESWA 2RBLA 4A3EI 3GTLI 1WW9A 4A3LI 1K83I 3VMGA 1TWAI 2JNYA 3K7AI 1TWHI 3GTJI 3VMHA 3I4MI 4NBDA 1DL6A 3VB9A 3Q87A 3PO2I 1R9TI 4NB9A 4Y52I 1YUAA 2JR6A 2R93I 5CM2M 1USPB 3GTMI 4A93I 4A3DI 2R92I 1ZB8A 4NBBA 4A3CI 2PK7A 4A3MI 1RLYA 3RZOI 3H0GI 4MH4A 4NBFA 1X3ZA 4NBAA 1ML8A 2J6AA 3S1RI 2NVTI 4XX2A 2DE7A 3HOZI 3S1MI 2E2HI 3S2DI 3M3YI 1X3WA 2JS4A 2KPIA 3CQZI 2VUMI 2R7ZI 3HOUI 1NUIA 1I6HI 1PFTA 2NVQI 1LQLA 3GTGI 4NBHA 1TWGI 5IP9I 2NVYI 3S14I 2JA8I 4QTTA 1QYPA 3I4NI 3EERA 3S1NI 1Y1VS 3S1QI 2BJOA 3LUSA 4A3GI 2YU9I 1I50I 3S15I 3U50C 1VLAA 3GTKI 5C4JI 2K5RA 4A3JI 2NVXI 3HOWI 1TWCI 4BBSI 2HF1A 2DE5A 1RO4A 2JA5I 3GKQA 2B63I 5C3EI 3GTPI 3M4OI 4NBCA 4BY1I 4NOZA 4A3II 4BY7I 2JA7I 4A3BI 3RZDI 3GTQI 3PO3S 2F4OA 4X6AI 1L1OC 5IP7I 1ZB9A 1SFOI 2E2II 4Y7NI 3S17I 1USPA 1Y1VI 5C4XI 3I07A 4NBEA 2DE6A 1Y1WI 1I3QI 5C44I 3H3VJ 4BBRI 1N2FA 1TWFI 2JA6I 3HOXI 3GCFA
chains in the Genus database with same CATH superfamily
4DGLA 4QTUA 2LFUA 1WJ2A 1YJN1 1TFIA 2O53A 4A3FI 1VQ71 4A3KI 3HOVI 3NDIA 3NH8A 3QWUA 4RVHA 4HGYA 3FKII 3I551 2VPWA 2OTJ1 2WB1A 3HKZA 1WIIA 4A3LI 1YI21 2JNYA 3D9XA 2NAPA 1VQKZ 2GTIA 2QRCB 3CMEZ 3J7A4 3P5JB 5T64A 3PO2I 1YUAA 2R93I 2QKDA 3EEDA 2V8JA 3I56Z 1QVGZ 1NJI2 2M6NA 5LL6f 3RZOI 1X3ZA 2JUBA 1ML8A 2J6AA 3S1RI 2NVTI 2DE7A 3S1MI 1YJWZ 2JIPA 2OOXB 2JS4A 3CQZI 3CCU1 1I6HI 3GTGI 2HU9A 5AN9F 1FDIA 1RNIA 1VQPZ 1Y1VS 1K731 1VQM1 1VQ91 1VQO1 2IZ3A 1VQ8Z 2YU9I 3CCVZ 3S15I 2PM9A 4E2WA 2VPYA 3GTKI 5C4JI 2K5RA 3HOWI 1YITZ 4BBSI 2HF1A 1QVFZ 4E2ZA 3CCM1 5C3EI 1Q812 3NDJA 4BY1I 1K8A1 1Q862 2Q51A 2VPZA 2JIOA 3CCJZ 3PO3S 3CC41 1JJ2Z 3MONA 1ZB9A 1FDOA 3S17I 1Y1VI 1Z02A 1VQ51 1YJ91 2DE6A 1Y1WI 3H3VJ 4BBRI 2P28A 1QVGY 3HOXI 3CCE1 1VQ6Z 2QLVB 1Q822 1S721 3JAMf 2E2JI 2OTL1 4MRIA 1M902 4NBGA 1Z03A 3CC21 3PO3I 3ESWA 2RBLA 3BG1B 1WW9A 2YADA 1TWAI 1YJNZ 1VQ7Z 2VPXA 3GTJI 2LIYA 3OW2Z 1DL6A 3CCQ1 3Q87A 3I55Z 1R9TI 2OTJZ 3IX0A 4A93I 4NFRA 5D1PA 1AA6A 1YI2Z 1QVFY 4MXUA 2R92I 2Y0SA 4A3CI 2JIQA 4S1TA 1YIJ1 3H0GI 1KC82 4RS4A 5FLXf 2VUGA 4RVGA 3M3YI 2KPIA 4HGZA 1Q7Y1 2R7ZI 1LQLA 2JIMA 5IP9I 1VQ41 2QEX1 1Y8CA 3S1NI 3LUSA 3CCUZ 4A3GI 3U50C 4A3JI 1ZH1A 2NVXI 1TWCI 3KIHA 3VTNA 4MD8A 2B63I 2AYDA 3IR7A 2QA41 5T6BA 4BY7I 3F3PC 1VQMZ 1VQ9Z 1RO0A 2E7ZA 1VQOZ 2V8KA 4RVFA 2JA7I 4A3BI 1RO2A 3RZDI 3G711 1N8R1 2V8IA 5D1OB 1Z01A 1L1OC 1M1K2 3CCMZ 1RQFA 4E2XA 3OW2Y 4Y7NI 3J80b 1NJI1 5C4XI 3I07A 1I3QI 3T4NB 2I3CA 3F3FC 3MZKB 1VQL1 4NH1C 1Q16A 3CC4Z 4BXXI 2RT9A 1NP6A 1VQ5Z 2R6MA 1YJ9Z 2AKLA 3S2HI 2RPRA 2JIRA 3GTOI 3S16I 3CCR1 1YHQ1 2IZ4A 2H85A 3CCEZ 3VMGA 3CPWZ 2W03A 1S72Z 3K7AI 2E9HA 2OTLZ 1TWHI 3VMHA 3CC2Z 3I4MI 3VB9A 4Y52I 1KD11 3J80f 2V3VA 2RHBA 4E33A 1W2BZ 4A3DI 1ZB8A 2QRDB 2G2KA 3CD61 4MH4A 5D1OA 4NBFA 4RV9A 1WZNA 1KRLA 3CCQZ 3CCS1 5A2Qb 4MD9A 3TDHB 2O4HA 3CMA1 1X3WA 3HOUI 4E30A 1NUIA 1PFTA 1TWGI 2NVYI 1YIJZ 3S14I 1X0TA 1VQN1 3G4S1 1Q821 1QYPA 2V45A 3G6E1 1M901 1VLAA 3CCL1 1Q7Y2 4DK1A 1QF8A 2PMZA 1VQ4Z 1RO4A 2JA5I 2JMOA 3GKQA 4E2YA 2QEXZ 4TNUA 1JJ2Y 3CC71 2K3RA 3GTPI 4NBCA 4A3II 3BG0B 1K9M1 1KQSZ 2IV2X 3CPWY 2F4OA 4X6AI 3NH5A 3CXCZ 5IP7I 4AYBA 5A2Qf 1SFOI 1QXFA 2QA4Z 4E31A 2OOYB 5T67A 5IT9b 5C44I 1W2BY 3G71Z 1KC81 2JA6I 1N8R2 1WCMI 4NB8A 2P3YA 2GTHA 4E32A 3VMIA 3GTMS 5FLMI 2KI7B 3FQQA 2Q4ZA 1VQK1 1K732 3CME1 2OZKA 2F4MA 3HOYI 3D6WA 4RVDA 1VQLZ 4A3EI 3GTLI 1K83I 3D2LA 3I561 2RIQA 4MD7A 3TE5B 1K8A2 2VF1A 4NBDA 3CCRZ 3FQMA 1YHQZ 4NB9A 2JR6A 4DQYB 5CM2M 1USPB 3GTMI 2ZAEB 1YJW1 5IT9f 4CL1A 3MZLB 4NBBA 3JAMb 2PK7A 4A3MI 1RLYA 1JWHC 1KQSY 4NBAA 1M1K1 2LEXA 1VQP1 3J81b 4MONA 4XX2A 3HOZI 2E2HI 3S2DI 3CXCY 2EGTA 1KD12 2VUMI 1VQ81 3CCV1 2NVQI 4NBHA 1YIT1 2M48A 3CD6Z 2W04A 1S7MA 1Q811 2JA8I 4QTTA 2QREB 1Q861 3CCSZ 2QR1B 3I4NI 3NH4A 3EERA 3S1QI 3CMAZ 3CCJ1 2BJOA 1I50I 1SIWA 2DE5A 3KIFA 1VQNZ 3G4SZ 3M4OI 4NOZA 5FLXb 2GU2A 3IFUA 3G6EZ 3GTQI 4EWCA 3CCLZ 3IF8A 3J81f 4HH4A 2E2II 1VQ61 3CC7Z 1USPA 4NBEA 2WAQA 1YUKA 1N2FA 1P9NA 3NFZA 1K9M2 1TWFI 3GCFA
chains in the Genus database with same CATH topology
4DGLA 4QTUA 2LFUA 1YJN1 1TFIA 2O53A 4A3FI 1VQ71 4A3KI 3HOVI 3NDIA 3NH8A 3QWUA 4RVHA 4HGYA 3FKII 3I551 2OTJ1 2WB1A 3HKZA 1WIIA 4A3LI 1YI21 2JNYA 3D9XA 1VQKZ 2GTIA 2QRCB 3CMEZ 3J7A4 3P5JB 5T64A 3PO2I 1YUAA 2R93I 2QKDA 3EEDA 2V8JA 3I56Z 1QVGZ 1NJI2 2M6NA 5LL6f 3RZOI 1X3ZA 2JUBA 1ML8A 2J6AA 3S1RI 2NVTI 2DE7A 3S1MI 1YJWZ 2OOXB 2JS4A 3CQZI 3CCU1 1I6HI 3GTGI 2HU9A 5AN9F 1RNIA 1VQPZ 1Y1VS 1K731 1VQM1 1VQ91 1VQO1 2IZ3A 1VQ8Z 2YU9I 3CCVZ 3S15I 2PM9A 4E2WA 3GTKI 5C4JI 2K5RA 3HOWI 1YITZ 4BBSI 2HF1A 1QVFZ 4E2ZA 5C3EI 3CCM1 1Q812 3NDJA 4BY1I 1K8A1 1Q862 2Q51A 3CCJZ 3PO3S 3CC41 1JJ2Z 3MONA 1ZB9A 3S17I 1Y1VI 1Z02A 1VQ51 1YJ91 2DE6A 1Y1WI 3H3VJ 4BBRI 2P28A 1QVGY 3HOXI 3CCE1 1VQ6Z 2QLVB 1Q822 1S721 3JAMf 2E2JI 2OTL1 4MRIA 1M902 4NBGA 1Z03A 3CC21 3PO3I 3ESWA 2RBLA 3BG1B 1WW9A 2YADA 1TWAI 1YJNZ 1VQ7Z 3GTJI 2LIYA 3OW2Z 1DL6A 3CCQ1 3Q87A 3I55Z 1R9TI 2OTJZ 3IX0A 4A93I 4NFRA 5D1PA 1YI2Z 1QVFY 4MXUA 2R92I 2Y0SA 4A3CI 4S1TA 1YIJ1 3H0GI 1KC82 4RS4A 5FLXf 2VUGA 4RVGA 3M3YI 2KPIA 4HGZA 1Q7Y1 2R7ZI 1LQLA 5IP9I 1VQ41 2QEX1 3S1NI 3LUSA 3CCUZ 4A3GI 3U50C 4A3JI 1ZH1A 2NVXI 1TWCI 3KIHA 3VTNA 4MD8A 2B63I 2QA41 5T6BA 4BY7I 3F3PC 1VQMZ 1VQ9Z 1RO0A 1VQOZ 2JA7I 2V8KA 4RVFA 4A3BI 1RO2A 3RZDI 3G711 1N8R1 2V8IA 5D1OB 1Z01A 1L1OC 1M1K2 3CCMZ 1RQFA 4E2XA 3OW2Y 4Y7NI 3J80b 1NJI1 5C4XI 3I07A 1I3QI 3T4NB 2I3CA 3F3FC 3MZKB 1VQL1 4NH1C 3CC4Z 4BXXI 2RT9A 1NP6A 1VQ5Z 2R6MA 1YJ9Z 2AKLA 3S2HI 2RPRA 3GTOI 3S16I 3CCR1 1YHQ1 2IZ4A 2H85A 3CCEZ 3VMGA 3CPWZ 2W03A 1S72Z 3K7AI 2E9HA 2OTLZ 1TWHI 3VMHA 3CC2Z 3I4MI 3VB9A 4Y52I 1KD11 3J80f 2RHBA 4E33A 1W2BZ 4A3DI 1ZB8A 2QRDB 2G2KA 3CD61 4MH4A 5D1OA 4NBFA 4RV9A 3CCQZ 1KRLA 3CCS1 5A2Qb 4MD9A 3TDHB 2O4HA 3CMA1 1X3WA 3HOUI 4E30A 1NUIA 1PFTA 1TWGI 2NVYI 1YIJZ 3S14I 1X0TA 1VQN1 3G4S1 1Q821 1QYPA 3G6E1 1M901 1VLAA 3CCL1 1Q7Y2 4DK1A 1QF8A 2PMZA 1VQ4Z 1RO4A 2JA5I 2JMOA 3GKQA 4E2YA 2QEXZ 4TNUA 1JJ2Y 3CC71 2K3RA 3GTPI 4NBCA 4A3II 3BG0B 1K9M1 1KQSZ 3CPWY 2F4OA 4X6AI 3NH5A 3CXCZ 5IP7I 4AYBA 5A2Qf 1SFOI 2QA4Z 4E31A 2OOYB 5T67A 5IT9b 5C44I 1W2BY 3G71Z 1KC81 2JA6I 1N8R2 1WCMI 4NB8A 2P3YA 2GTHA 4E32A 3VMIA 3GTMS 5FLMI 2KI7B 3FQQA 2Q4ZA 1VQK1 1K732 3CME1 2OZKA 2F4MA 3HOYI 3D6WA 4RVDA 1VQLZ 4A3EI 3GTLI 1K83I 3I561 2RIQA 4MD7A 3TE5B 1K8A2 2VF1A 4NBDA 3CCRZ 3FQMA 1YHQZ 4NB9A 2JR6A 4DQYB 5CM2M 1USPB 3GTMI 2ZAEB 1YJW1 5IT9f 4CL1A 3MZLB 4NBBA 3JAMb 2PK7A 4A3MI 1RLYA 1JWHC 1KQSY 4NBAA 1M1K1 1VQP1 3J81b 4MONA 4XX2A 3HOZI 2E2HI 3S2DI 3CXCY 2EGTA 1KD12 2VUMI 1VQ81 3CCV1 2NVQI 4NBHA 1YIT1 2M48A 3CD6Z 2W04A 1S7MA 1Q811 2JA8I 4QTTA 2QREB 1Q861 3CCSZ 2QR1B 3I4NI 3NH4A 3EERA 3S1QI 3CMAZ 3CCJ1 2BJOA 1I50I 2DE5A 3KIFA 1VQNZ 3G4SZ 3M4OI 4NOZA 5FLXb 2GU2A 3IFUA 3G6EZ 3GTQI 4EWCA 3CCLZ 3IF8A 3J81f 4HH4A 2E2II 1VQ61 3CC7Z 1USPA 4NBEA 2WAQA 1YUKA 1N2FA 1P9NA 3NFZA 1K9M2 1TWFI 3GCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTU A;  1WCM I;  4NB8 A;  2P3Y A;  3VMI A;  4BXX I;  3GTM S;  5FLM I;  1TFI A;  2E2J I;  4A3F I;  2AKL A;  4A3K I;  3HOV I;  3S2H I;  4NBG A;  2F4M A;  3HOY I;  3PO3 I;  3D6W A;  3GTO I;  3FKI I;  3S16 I;  3ESW A;  2RBL A;  4A3E I;  3GTL I;  1WW9 A;  4A3L I;  1K83 I;  3VMG A;  1TWA I;  2JNY A;  3K7A I;  1TWH I;  3GTJ I;  3VMH A;  3I4M I;  4NBD A;  1DL6 A;  3VB9 A;  3Q87 A;  3PO2 I;  1R9T I;  4NB9 A;  4Y52 I;  1YUA A;  2JR6 A;  2R93 I;  5CM2 M;  1USP B;  3GTM I;  4A93 I;  4A3D I;  2R92 I;  1ZB8 A;  4NBB A;  4A3C I;  2PK7 A;  4A3M I;  1RLY A;  3RZO I;  3H0G I;  4MH4 A;  4NBF A;  1X3Z A;  4NBA A;  1ML8 A;  2J6A A;  3S1R I;  2NVT I;  4XX2 A;  2DE7 A;  3HOZ I;  3S1M I;  2E2H I;  3S2D I;  3M3Y I;  1X3W A;  2JS4 A;  2KPI A;  3CQZ I;  2VUM I;  2R7Z I;  3HOU I;  1NUI A;  1I6H I;  1PFT A;  2NVQ I;  1LQL A;  3GTG I;  4NBH A;  1TWG I;  5IP9 I;  2NVY I;  3S14 I;  2JA8 I;  4QTT A;  1QYP A;  3I4N I;  3EER A;  3S1N I;  1Y1V S;  3S1Q I;  2BJO A;  3LUS A;  4A3G I;  2YU9 I;  1I50 I;  3S15 I;  3U50 C;  1VLA A;  3GTK I;  5C4J I;  2K5R A;  4A3J I;  2NVX I;  3HOW I;  1TWC I;  4BBS I;  2HF1 A;  2DE5 A;  1RO4 A;  2JA5 I;  3GKQ A;  2B63 I;  5C3E I;  3GTP I;  3M4O I;  4NBC A;  4BY1 I;  4NOZ A;  4A3I I;  4BY7 I;  2JA7 I;  4A3B I;  3RZD I;  3GTQ I;  3PO3 S;  2F4O A;  4X6A I;  1L1O C;  5IP7 I;  1ZB9 A;  1SFO I;  2E2I I;  4Y7N I;  3S17 I;  1USP A;  1Y1V I;  5C4X I;  3I07 A;  4NBE A;  2DE6 A;  1Y1W I;  1I3Q I;  5C44 I;  3H3V J;  4BBR I;  1N2F A;  1TWF I;  2JA6 I;  3HOX I;  3GCF A; 
#chains in the Genus database with same CATH topology
 4DGL A;  4QTU A;  2LFU A;  1WJ2 A;  1YJN 1;  1TFI A;  2O53 A;  4A3F I;  1VQ7 1;  4A3K I;  3HOV I;  3NDI A;  3NH8 A;  3QWU A;  4RVH A;  4HGY A;  3FKI I;  3I55 1;  2VPW A;  2OTJ 1;  2WB1 A;  3HKZ A;  1WII A;  4A3L I;  1YI2 1;  2JNY A;  3D9X A;  2NAP A;  1VQK Z;  2GTI A;  2QRC B;  3CME Z;  3J7A 4;  3P5J B;  5T64 A;  3PO2 I;  1YUA A;  2R93 I;  2QKD A;  3EED A;  2V8J A;  3I56 Z;  1QVG Z;  1NJI 2;  2M6N A;  5LL6 f;  3RZO I;  1X3Z A;  2JUB A;  1ML8 A;  2J6A A;  3S1R I;  2NVT I;  2DE7 A;  3S1M I;  1YJW Z;  2JIP A;  2OOX B;  2JS4 A;  3CQZ I;  3CCU 1;  1I6H I;  3GTG I;  2HU9 A;  5AN9 F;  1FDI A;  1RNI A;  1VQP Z;  1Y1V S;  1K73 1;  1VQM 1;  1VQ9 1;  1VQO 1;  2IZ3 A;  1VQ8 Z;  2YU9 I;  3CCV Z;  3S15 I;  2PM9 A;  4E2W A;  2VPY A;  3GTK I;  5C4J I;  2K5R A;  3HOW I;  1YIT Z;  4BBS I;  2HF1 A;  1QVF Z;  4E2Z A;  3CCM 1;  5C3E I;  1Q81 2;  3NDJ A;  4BY1 I;  1K8A 1;  1Q86 2;  2Q51 A;  2VPZ A;  2JIO A;  3CCJ Z;  3PO3 S;  3CC4 1;  1JJ2 Z;  3MON A;  1ZB9 A;  1FDO A;  3S17 I;  1Y1V I;  1Z02 A;  1VQ5 1;  1YJ9 1;  2DE6 A;  1Y1W I;  3H3V J;  4BBR I;  2P28 A;  1QVG Y;  3HOX I;  3CCE 1;  1VQ6 Z;  2QLV B;  1Q82 2;  1S72 1;  3JAM f;  2E2J I;  2OTL 1;  4MRI A;  1M90 2;  4NBG A;  1Z03 A;  3CC2 1;  3PO3 I;  3ESW A;  2RBL A;  3BG1 B;  1WW9 A;  2YAD A;  1TWA I;  1YJN Z;  1VQ7 Z;  2VPX A;  3GTJ I;  2LIY A;  3OW2 Z;  1DL6 A;  3CCQ 1;  3Q87 A;  3I55 Z;  1R9T I;  2OTJ Z;  3IX0 A;  4A93 I;  4NFR A;  5D1P A;  1AA6 A;  1YI2 Z;  1QVF Y;  4MXU A;  2R92 I;  2Y0S A;  4A3C I;  2JIQ A;  4S1T A;  1YIJ 1;  3H0G I;  1KC8 2;  4RS4 A;  5FLX f;  2VUG A;  4RVG A;  3M3Y I;  2KPI A;  4HGZ A;  1Q7Y 1;  2R7Z I;  1LQL A;  2JIM A;  5IP9 I;  1VQ4 1;  2QEX 1;  1Y8C A;  3S1N I;  3LUS A;  3CCU Z;  4A3G I;  3U50 C;  4A3J I;  1ZH1 A;  2NVX I;  1TWC I;  3KIH A;  3VTN A;  4MD8 A;  2B63 I;  2AYD A;  3IR7 A;  2QA4 1;  5T6B A;  4BY7 I;  3F3P C;  1VQM Z;  1VQ9 Z;  1RO0 A;  2E7Z A;  1VQO Z;  2V8K A;  4RVF A;  2JA7 I;  4A3B I;  1RO2 A;  3RZD I;  3G71 1;  1N8R 1;  2V8I A;  5D1O B;  1Z01 A;  1L1O C;  1M1K 2;  3CCM Z;  1RQF A;  4E2X A;  3OW2 Y;  4Y7N I;  3J80 b;  1NJI 1;  5C4X I;  3I07 A;  1I3Q I;  3T4N B;  2I3C A;  3F3F C;  3MZK B;  1VQL 1;  4NH1 C;  1Q16 A;  3CC4 Z;  4BXX I;  2RT9 A;  1NP6 A;  1VQ5 Z;  2R6M A;  1YJ9 Z;  2AKL A;  3S2H I;  2RPR A;  2JIR A;  3GTO I;  3S16 I;  3CCR 1;  1YHQ 1;  2IZ4 A;  2H85 A;  3CCE Z;  3VMG A;  3CPW Z;  2W03 A;  1S72 Z;  3K7A I;  2E9H A;  2OTL Z;  1TWH I;  3VMH A;  3CC2 Z;  3I4M I;  3VB9 A;  4Y52 I;  1KD1 1;  3J80 f;  2V3V A;  2RHB A;  4E33 A;  1W2B Z;  4A3D I;  1ZB8 A;  2QRD B;  2G2K A;  3CD6 1;  4MH4 A;  5D1O A;  4NBF A;  4RV9 A;  1WZN A;  1KRL A;  3CCQ Z;  3CCS 1;  5A2Q b;  4MD9 A;  3TDH B;  2O4H A;  3CMA 1;  1X3W A;  3HOU I;  4E30 A;  1NUI A;  1PFT A;  1TWG I;  2NVY I;  1YIJ Z;  3S14 I;  1X0T A;  1VQN 1;  3G4S 1;  1Q82 1;  1QYP A;  2V45 A;  3G6E 1;  1M90 1;  1VLA A;  3CCL 1;  1Q7Y 2;  4DK1 A;  1QF8 A;  2PMZ A;  1VQ4 Z;  1RO4 A;  2JA5 I;  2JMO A;  3GKQ A;  4E2Y A;  2QEX Z;  4TNU A;  1JJ2 Y;  3CC7 1;  2K3R A;  3GTP I;  4NBC A;  4A3I I;  3BG0 B;  1K9M 1;  1KQS Z;  2IV2 X;  3CPW Y;  2F4O A;  4X6A I;  3NH5 A;  3CXC Z;  5IP7 I;  4AYB A;  5A2Q f;  1SFO I;  1QXF A;  2QA4 Z;  4E31 A;  2OOY B;  5T67 A;  5IT9 b;  5C44 I;  1W2B Y;  3G71 Z;  1KC8 1;  2JA6 I;  1N8R 2;  1WCM I;  4NB8 A;  2P3Y A;  2GTH A;  4E32 A;  3VMI A;  3GTM S;  5FLM I;  2KI7 B;  3FQQ A;  2Q4Z A;  1VQK 1;  1K73 2;  3CME 1;  2OZK A;  2F4M A;  3HOY I;  3D6W A;  4RVD A;  1VQL Z;  4A3E I;  3GTL I;  1K83 I;  3D2L A;  3I56 1;  2RIQ A;  4MD7 A;  3TE5 B;  1K8A 2;  2VF1 A;  4NBD A;  3CCR Z;  3FQM A;  1YHQ Z;  4NB9 A;  2JR6 A;  4DQY B;  5CM2 M;  1USP B;  3GTM I;  2ZAE B;  1YJW 1;  5IT9 f;  4CL1 A;  3MZL B;  4NBB A;  3JAM b;  2PK7 A;  4A3M I;  1RLY A;  1JWH C;  1KQS Y;  4NBA A;  1M1K 1;  2LEX A;  1VQP 1;  3J81 b;  4MON A;  4XX2 A;  3HOZ I;  2E2H I;  3S2D I;  3CXC Y;  2EGT A;  1KD1 2;  2VUM I;  1VQ8 1;  3CCV 1;  2NVQ I;  4NBH A;  1YIT 1;  2M48 A;  3CD6 Z;  2W04 A;  1S7M A;  1Q81 1;  2JA8 I;  4QTT A;  2QRE B;  1Q86 1;  3CCS Z;  2QR1 B;  3I4N I;  3NH4 A;  3EER A;  3S1Q I;  3CMA Z;  3CCJ 1;  2BJO A;  1I50 I;  1SIW A;  2DE5 A;  3KIF A;  1VQN Z;  3G4S Z;  3M4O I;  4NOZ A;  5FLX b;  2GU2 A;  3IFU A;  3G6E Z;  3GTQ I;  4EWC A;  3CCL Z;  3IF8 A;  3J81 f;  4HH4 A;  2E2I I;  1VQ6 1;  3CC7 Z;  1USP A;  4NBE A;  2WAQ A;  1YUK A;  1N2F A;  1P9N A;  3NFZ A;  1K9M 2;  1TWF I;  3GCF A; 
#chains in the Genus database with same CATH homology
 4DGL A;  4QTU A;  2LFU A;  1YJN 1;  1TFI A;  2O53 A;  4A3F I;  1VQ7 1;  4A3K I;  3HOV I;  3NDI A;  3NH8 A;  3QWU A;  4RVH A;  4HGY A;  3FKI I;  3I55 1;  2OTJ 1;  2WB1 A;  3HKZ A;  1WII A;  4A3L I;  1YI2 1;  2JNY A;  3D9X A;  1VQK Z;  2GTI A;  2QRC B;  3CME Z;  3J7A 4;  3P5J B;  5T64 A;  3PO2 I;  1YUA A;  2R93 I;  2QKD A;  3EED A;  2V8J A;  3I56 Z;  1QVG Z;  1NJI 2;  2M6N A;  5LL6 f;  3RZO I;  1X3Z A;  2JUB A;  1ML8 A;  2J6A A;  3S1R I;  2NVT I;  2DE7 A;  3S1M I;  1YJW Z;  2OOX B;  2JS4 A;  3CQZ I;  3CCU 1;  1I6H I;  3GTG I;  2HU9 A;  5AN9 F;  1RNI A;  1VQP Z;  1Y1V S;  1K73 1;  1VQM 1;  1VQ9 1;  1VQO 1;  2IZ3 A;  1VQ8 Z;  2YU9 I;  3CCV Z;  3S15 I;  2PM9 A;  4E2W A;  3GTK I;  5C4J I;  2K5R A;  3HOW I;  1YIT Z;  4BBS I;  2HF1 A;  1QVF Z;  4E2Z A;  5C3E I;  3CCM 1;  1Q81 2;  3NDJ A;  4BY1 I;  1K8A 1;  1Q86 2;  2Q51 A;  3CCJ Z;  3PO3 S;  3CC4 1;  1JJ2 Z;  3MON A;  1ZB9 A;  3S17 I;  1Y1V I;  1Z02 A;  1VQ5 1;  1YJ9 1;  2DE6 A;  1Y1W I;  3H3V J;  4BBR I;  2P28 A;  1QVG Y;  3HOX I;  3CCE 1;  1VQ6 Z;  2QLV B;  1Q82 2;  1S72 1;  3JAM f;  2E2J I;  2OTL 1;  4MRI A;  1M90 2;  4NBG A;  1Z03 A;  3CC2 1;  3PO3 I;  3ESW A;  2RBL A;  3BG1 B;  1WW9 A;  2YAD A;  1TWA I;  1YJN Z;  1VQ7 Z;  3GTJ I;  2LIY A;  3OW2 Z;  1DL6 A;  3CCQ 1;  3Q87 A;  3I55 Z;  1R9T I;  2OTJ Z;  3IX0 A;  4A93 I;  4NFR A;  5D1P A;  1YI2 Z;  1QVF Y;  4MXU A;  2R92 I;  2Y0S A;  4A3C I;  4S1T A;  1YIJ 1;  3H0G I;  1KC8 2;  4RS4 A;  5FLX f;  2VUG A;  4RVG A;  3M3Y I;  2KPI A;  4HGZ A;  1Q7Y 1;  2R7Z I;  1LQL A;  5IP9 I;  1VQ4 1;  2QEX 1;  3S1N I;  3LUS A;  3CCU Z;  4A3G I;  3U50 C;  4A3J I;  1ZH1 A;  2NVX I;  1TWC I;  3KIH A;  3VTN A;  4MD8 A;  2B63 I;  2QA4 1;  5T6B A;  4BY7 I;  3F3P C;  1VQM Z;  1VQ9 Z;  1RO0 A;  1VQO Z;  2JA7 I;  2V8K A;  4RVF A;  4A3B I;  1RO2 A;  3RZD I;  3G71 1;  1N8R 1;  2V8I A;  5D1O B;  1Z01 A;  1L1O C;  1M1K 2;  3CCM Z;  1RQF A;  4E2X A;  3OW2 Y;  4Y7N I;  3J80 b;  1NJI 1;  5C4X I;  3I07 A;  1I3Q I;  3T4N B;  2I3C A;  3F3F C;  3MZK B;  1VQL 1;  4NH1 C;  3CC4 Z;  4BXX I;  2RT9 A;  1NP6 A;  1VQ5 Z;  2R6M A;  1YJ9 Z;  2AKL A;  3S2H I;  2RPR A;  3GTO I;  3S16 I;  3CCR 1;  1YHQ 1;  2IZ4 A;  2H85 A;  3CCE Z;  3VMG A;  3CPW Z;  2W03 A;  1S72 Z;  3K7A I;  2E9H A;  2OTL Z;  1TWH I;  3VMH A;  3CC2 Z;  3I4M I;  3VB9 A;  4Y52 I;  1KD1 1;  3J80 f;  2RHB A;  4E33 A;  1W2B Z;  4A3D I;  1ZB8 A;  2QRD B;  2G2K A;  3CD6 1;  4MH4 A;  5D1O A;  4NBF A;  4RV9 A;  3CCQ Z;  1KRL A;  3CCS 1;  5A2Q b;  4MD9 A;  3TDH B;  2O4H A;  3CMA 1;  1X3W A;  3HOU I;  4E30 A;  1NUI A;  1PFT A;  1TWG I;  2NVY I;  1YIJ Z;  3S14 I;  1X0T A;  1VQN 1;  3G4S 1;  1Q82 1;  1QYP A;  3G6E 1;  1M90 1;  1VLA A;  3CCL 1;  1Q7Y 2;  4DK1 A;  1QF8 A;  2PMZ A;  1VQ4 Z;  1RO4 A;  2JA5 I;  2JMO A;  3GKQ A;  4E2Y A;  2QEX Z;  4TNU A;  1JJ2 Y;  3CC7 1;  2K3R A;  3GTP I;  4NBC A;  4A3I I;  3BG0 B;  1K9M 1;  1KQS Z;  3CPW Y;  2F4O A;  4X6A I;  3NH5 A;  3CXC Z;  5IP7 I;  4AYB A;  5A2Q f;  1SFO I;  2QA4 Z;  4E31 A;  2OOY B;  5T67 A;  5IT9 b;  5C44 I;  1W2B Y;  3G71 Z;  1KC8 1;  2JA6 I;  1N8R 2;  1WCM I;  4NB8 A;  2P3Y A;  2GTH A;  4E32 A;  3VMI A;  3GTM S;  5FLM I;  2KI7 B;  3FQQ A;  2Q4Z A;  1VQK 1;  1K73 2;  3CME 1;  2OZK A;  2F4M A;  3HOY I;  3D6W A;  4RVD A;  1VQL Z;  4A3E I;  3GTL I;  1K83 I;  3I56 1;  2RIQ A;  4MD7 A;  3TE5 B;  1K8A 2;  2VF1 A;  4NBD A;  3CCR Z;  3FQM A;  1YHQ Z;  4NB9 A;  2JR6 A;  4DQY B;  5CM2 M;  1USP B;  3GTM I;  2ZAE B;  1YJW 1;  5IT9 f;  4CL1 A;  3MZL B;  4NBB A;  3JAM b;  2PK7 A;  4A3M I;  1RLY A;  1JWH C;  1KQS Y;  4NBA A;  1M1K 1;  1VQP 1;  3J81 b;  4MON A;  4XX2 A;  3HOZ I;  2E2H I;  3S2D I;  3CXC Y;  2EGT A;  1KD1 2;  2VUM I;  1VQ8 1;  3CCV 1;  2NVQ I;  4NBH A;  1YIT 1;  2M48 A;  3CD6 Z;  2W04 A;  1S7M A;  1Q81 1;  2JA8 I;  4QTT A;  2QRE B;  1Q86 1;  3CCS Z;  2QR1 B;  3I4N I;  3NH4 A;  3EER A;  3S1Q I;  3CMA Z;  3CCJ 1;  2BJO A;  1I50 I;  2DE5 A;  3KIF A;  1VQN Z;  3G4S Z;  3M4O I;  4NOZ A;  5FLX b;  2GU2 A;  3IFU A;  3G6E Z;  3GTQ I;  4EWC A;  3CCL Z;  3IF8 A;  3J81 f;  4HH4 A;  2E2I I;  1VQ6 1;  3CC7 Z;  1USP A;  4NBE A;  2WAQ A;  1YUK A;  1N2F A;  1P9N A;  3NFZ A;  1K9M 2;  1TWF I;  3GCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...