4A3KI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3kI02
1R9TI 3GCFA 2AKLA 4A3KI 3I4MI 4MH4A 2R93I 3S1MI 3I07A 2JS4A 5CM2M 3PO3I 3HOXI 2JA8I 2K5RA 4NBDA 2JA7I 3GTMS 3GTJI 2P3YA 5IP7I 2E2JI 3GKQA 4BXXI 3GTGI 3HOZI 3S2HI 2PK7A 1TWGI 3CQZI 3S14I 1X3WA 2NVQI 3LUSA 3S1NI 4NBEA 4A3LI 3PO2I 3K7AI 2F4OA 4A3EI 1RLYA 1TFIA 2R7ZI 4BY7I 2DE7A 4A3GI 4A3JI 3GTLI 1QYPA 1RO4A 4A3CI 1TWAI 1I3QI 3ESWA 4NBFA 3VMIA 4A3FI 4NBGA 3VB9A 3GTPI 2DE5A 2NVYI 1X3ZA 2JA6I 1N2FA 3H3VJ 1ZB9A 3S17I 5C3EI 4XX2A 3HOUI 4NB9A 1WW9A 1I50I 4A3MI 1L1OC 1USPA 4NBAA 1DL6A 4NBBA 1I6HI 3S15I 4NOZA 2KPIA 4BBRI 4BBSI 3S1RI 3GTMI 1USPB 2JNYA 3H0GI 3RZDI 4NBCA 1VLAA 2VUMI 5C44I 4BY1I 4NB8A 2JR6A 1ZB8A 4QTTA 5IP9I 1NUIA 1WCMI 1Y1VS 2NVTI 3HOYI 3VMGA 3PO3S 2RBLA 3M4OI 1ML8A 1PFTA 2DE6A 4Y52I 3VMHA 3RZOI 3D6WA 1YUAA 3HOWI 2NVXI 4A3II 3I4NI 4A93I 1SFOI 2BJOA 3HOVI 3S1QI 2YU9I 4Y7NI 2J6AA 3S2DI 4X6AI 3GTOI 4QTUA 1Y1VI 3U50C 1TWHI 2E2HI 4A3DI 3GTKI 4NBHA 3S16I 3FKII 1TWCI 1LQLA 2R92I 3GTQI 1Y1WI 2JA5I 1K83I 2HF1A 3M3YI 2F4MA 4A3BI 5C4JI 3Q87A 3EERA 1TWFI 2B63I 5FLMI 5C4XI 2E2II
chains in the Genus database with same CATH superfamily
2Y0SA 3CCU1 3I4MI 5CM2M 1Z01A 4NBDA 1NJI2 4RS4A 4HGZA 1QXFA 3GTMS 1M902 2Q51A 4BXXI 3KIHA 3CCRZ 1K731 2QR1B 3CPWZ 3S14I 5T67A 2QA4Z 2P28A 4RVHA 4NBEA 3CC21 4MXUA 3VTNA 2F4OA 3J80b 3CCLZ 2R7ZI 1VQ6Z 4A3GI 3G4SZ 1WZNA 3CCMZ 2OTJZ 2JUBA 3GTPI 2NVYI 1Q822 1JJ2Z 2JA6I 3H3VJ 5C3EI 4MD9A 3G711 4NB9A 1L1OC 4NBAA 1I6HI 1Q812 4NOZA 4BBRI 3CD61 3HKZA 3S1RI 3NH4A 2HU9A 2GTIA 3KIFA 3JAMf 2VUMI 2JIMA 3EEDA 3IR7A 1YJN1 2G2KA 4MD7A 1VQOZ 1ML8A 2DE6A 2M6NA 2H85A 3T4NB 3NH8A 3HOWI 2NVXI 3P5JB 2JIOA 4CL1A 3CCUZ 3HOVI 3S2DI 2J6AA 3CME1 2RIQA 3U50C 4A3DI 2PMZA 3I551 2R92I 1Q16A 3GTQI 1K83I 3M3YI 2F4MA 1Q862 1NJI1 1Q7Y2 3CCS1 1TWFI 2B63I 5C4XI 1M901 1R9TI 3CC2Z 4A3KI 4E2YA 3I561 1M1K2 3D9XA 1VQK1 3S1MI 3PO3I 3CC41 5IT9f 2JA8I 1X0TA 2QEX1 2V3VA 2QRCB 2W03A 4E31A 3JAMb 3CCV1 1KC81 2VF1A 1K8A2 3G71Z 3GTGI 3HOZI 1QF8A 3S2HI 3MZKB 1YJ91 1NP6A 4NH1C 1Q821 3CD6Z 1X3WA 1YJWZ 4BY7I 4TNUA 2VPXA 1Q811 3GTLI 1RO4A 4A3CI 3ESWA 4NBFA 3VMIA 4NBGA 3VB9A 1VQP1 2DE5A 5LL6f 1S72Z 2EGTA 1QVFY 3S17I 1S7MA 3CMA1 3CMEZ 4XX2A 3HOUI 1I50I 1USPA 2VPWA 1DL6A 4NBBA 1YIJ1 2OOYB 4AYBA 3I55Z 4HH4A 2AYDA 3IF8A 2JNYA 4NBCA 4MD8A 5C44I 1K9M2 4BY1I 4E2ZA 4DQYB 5IP9I 1NUIA 3HOYI 5IT9b 4DK1A 3CCSZ 2WAQA 5A2Qb 4RV9A 4A3II 4A93I 2VUGA 1SFOI 3S1QI 3I56Z 1Q861 3CCQ1 1Q7Y1 1VQL1 4X6AI 1KRLA 1VQKZ 2QLVB 3J81f 3CC4Z 2E2HI 2JIRA 2QEXZ 3FKII 1JWHC 2LIYA 3CCVZ 2WB1A 1M1K1 3TDHB 2HF1A 2QRDB 2VPYA 4A3BI 2I3CA 1YJ9Z 1VQ91 2VPZA 2IZ3A 1K8A1 3GCFA 2AKLA 4E33A 1VQ51 2PM9A 2R93I 2RHBA 1QVFZ 3I07A 1Z02A 2JS4A 1FDOA 3CCE1 2JA7I 1K732 2K3RA 1VQPZ 3GTJI 2V8IA 2OTL1 3GKQA 3CMAZ 2OZKA 2PK7A 1TWGI 4S1TA 1YHQ1 3OW2Y 1YIJZ 2O4HA 3CQZI 3F3PC 4E2WA 3S1NI 3PO2I 2IZ4A 3K7AI 1TFIA 2DE7A 4A3JI 2JMOA 1YIT1 3J81b 1TWAI 1I3QI 2E7ZA 3CXCY 4A3FI 1KD12 2M48A 1VQN1 1N2FA 1ZB9A 1K9M1 2V8JA 3CCQZ 1WW9A 2JIPA 3S15I 4EWCA 2KPIA 1JJ2Y 2LEXA 3GTMI 1SIWA 1USPB 3NDJA 4RVFA 2OOXB 1W2BY 3RZDI 1VQM1 1YJNZ 1KQSY 1ZB8A 4QTTA 3BG0B 1WCMI 1Y1VS 1VQ41 2NVTI 3VMGA 3PO3S 3CCJ1 2RBLA 2ZAEB 3MZLB 2V45A 3TE5B 1VQ9Z 3J7A4 3CC71 1RO2A 3BG1B 3I4NI 5D1OA 1N8R2 2QREB 2GU2A 1VQ5Z 1YI21 4MONA 3IX0A 4DGLA 2O53A 3CCEZ 2E9HA 3NH5A 3OW2Z 3S16I 1TWCI 1LQLA 2RPRA 2OTLZ 1Y1WI 4NFRA 1YHQZ 3EERA 3G6E1 5FLMI 3QWUA 2KI7B 2YADA 3CXCZ 1RQFA 1QVGY 3D2LA 5AN9F 2GTHA 4MH4A 1YITZ 5FLXf 1KC82 3HOXI 2K5RA 4MRIA 3IFUA 1VQNZ 2P3YA 5IP7I 2E2JI 1W2BZ 3MONA 1KD11 1KQSZ 5D1PA 1VQ71 2NVQI 2IV2X 3LUSA 1VQ81 1AA6A 1YJW1 4A3LI 1VQMZ 1Y8CA 4A3EI 1RLYA 2JIQA 1QYPA 1VQ4Z 3CCJZ 1RO0A 2LFUA 1Z03A 3CC7Z 1WJ2A 1X3ZA 1S721 1WIIA 4HGYA 3CCR1 1FDIA 1YUKA 2V8KA 4A3MI 1YI2Z 4BBSI 2QKDA 2QA41 5T64A 4E2XA 1N8R1 3H0GI 1VLAA 2W04A 1P9NA 4NB8A 3CCL1 2JR6A 3CPWY 1VQ61 1QVGZ 3FQMA 5FLXb 3G4S1 3G6EZ 3M4OI 1PFTA 3CCM1 4Y52I 3VMHA 2OTJ1 1RNIA 3RZOI 3D6WA 3FQQA 4E32A 1YUAA 2BJOA 1VQLZ 2Q4ZA 2YU9I 4Y7NI 2NAPA 3J80f 3GTOI 4QTUA 5D1OB 3F3FC 1Y1VI 1TWHI 1ZH1A 5T6BA 3GTKI 4NBHA 4E30A 2RT9A 5A2Qf 2JA5I 4RVGA 4RVDA 5C4JI 3NFZA 3Q87A 2R6MA 1VQO1 1VQ7Z 3NDIA 2E2II 1VQ8Z
chains in the Genus database with same CATH topology
2Y0SA 3CCU1 3I4MI 5CM2M 1Z01A 4NBDA 1NJI2 4RS4A 4HGZA 3GTMS 1M902 2Q51A 4BXXI 3KIHA 3CCRZ 1K731 2QR1B 3CPWZ 3S14I 5T67A 2QA4Z 2P28A 4RVHA 4NBEA 3CC21 4MXUA 3VTNA 2F4OA 3J80b 3CCLZ 2R7ZI 1VQ6Z 4A3GI 3G4SZ 3CCMZ 2OTJZ 2JUBA 3GTPI 2NVYI 1Q822 1JJ2Z 2JA6I 3H3VJ 5C3EI 4MD9A 3G711 4NB9A 1L1OC 4NBAA 1I6HI 1Q812 4NOZA 4BBRI 3CD61 3HKZA 3S1RI 3NH4A 2HU9A 2GTIA 3KIFA 3JAMf 2VUMI 3EEDA 1YJN1 2G2KA 4MD7A 1VQOZ 1ML8A 2DE6A 2M6NA 2H85A 3T4NB 3NH8A 3HOWI 2NVXI 3P5JB 3CCUZ 4CL1A 3HOVI 3S2DI 2J6AA 3CME1 2RIQA 3U50C 4A3DI 2PMZA 3I551 2R92I 3GTQI 1K83I 3M3YI 2F4MA 1Q862 1NJI1 1Q7Y2 3CCS1 1TWFI 2B63I 5C4XI 1M901 1R9TI 3CC2Z 4A3KI 4E2YA 3I561 1M1K2 3D9XA 1VQK1 3S1MI 3PO3I 3CC41 5IT9f 2JA8I 1X0TA 2QEX1 2QRCB 2W03A 4E31A 3JAMb 3CCV1 1KC81 2VF1A 1K8A2 3G71Z 3GTGI 3HOZI 1QF8A 3S2HI 3MZKB 1YJ91 1NP6A 4NH1C 1Q821 3CD6Z 1X3WA 1YJWZ 4BY7I 4TNUA 1Q811 3GTLI 1RO4A 4A3CI 3ESWA 4NBFA 3VMIA 4NBGA 3VB9A 1VQP1 2DE5A 5LL6f 1S72Z 2EGTA 1QVFY 3S17I 1S7MA 3CMA1 3CMEZ 4XX2A 3HOUI 1I50I 1USPA 1DL6A 4NBBA 1YIJ1 2OOYB 4AYBA 3I55Z 4HH4A 3IF8A 2JNYA 4NBCA 4MD8A 5C44I 1K9M2 4BY1I 4E2ZA 4DQYB 5IP9I 1NUIA 3HOYI 5IT9b 4DK1A 3CCSZ 2WAQA 5A2Qb 4RV9A 4A3II 4A93I 2VUGA 1SFOI 3S1QI 3I56Z 1Q861 3CCQ1 1Q7Y1 1VQL1 4X6AI 1KRLA 1VQKZ 2QLVB 3J81f 3CC4Z 2E2HI 2QEXZ 3FKII 1JWHC 2LIYA 3CCVZ 2WB1A 1M1K1 3TDHB 2HF1A 2QRDB 4A3BI 2I3CA 1YJ9Z 1VQ91 2IZ3A 1K8A1 3GCFA 2AKLA 4E33A 1VQ51 2PM9A 2R93I 2RHBA 1QVFZ 3I07A 1Z02A 2JS4A 3CCE1 2JA7I 1K732 2K3RA 1VQPZ 3GTJI 2V8IA 2OTL1 3GKQA 3CMAZ 2OZKA 2PK7A 1TWGI 4S1TA 1YHQ1 3OW2Y 1YIJZ 2O4HA 3CQZI 3F3PC 4E2WA 3S1NI 3PO2I 2IZ4A 3K7AI 1TFIA 2DE7A 4A3JI 2JMOA 1YIT1 3J81b 1TWAI 1I3QI 3CXCY 4A3FI 1KD12 2M48A 1VQN1 1N2FA 1ZB9A 1K9M1 2V8JA 3CCQZ 1WW9A 3S15I 4EWCA 2KPIA 1JJ2Y 3GTMI 1USPB 3NDJA 4RVFA 2OOXB 1W2BY 3RZDI 1VQM1 1YJNZ 1KQSY 1ZB8A 4QTTA 3BG0B 1WCMI 1Y1VS 1VQ41 2NVTI 3VMGA 3PO3S 3CCJ1 2RBLA 2ZAEB 3MZLB 3TE5B 1VQ9Z 3J7A4 3CC71 1RO2A 3BG1B 3I4NI 5D1OA 1N8R2 2QREB 2GU2A 1VQ5Z 1YI21 4MONA 3IX0A 4DGLA 2O53A 3CCEZ 2E9HA 3NH5A 3OW2Z 3S16I 1TWCI 1LQLA 2RPRA 2OTLZ 1Y1WI 4NFRA 1YHQZ 3EERA 3G6E1 5FLMI 3QWUA 2KI7B 2YADA 3CXCZ 1RQFA 1QVGY 5AN9F 2GTHA 4MH4A 1YITZ 5FLXf 1KC82 3HOXI 2K5RA 4MRIA 3IFUA 1VQNZ 2P3YA 5IP7I 2E2JI 1W2BZ 3MONA 1KD11 1KQSZ 5D1PA 1VQ71 2NVQI 3LUSA 1VQ81 1YJW1 4A3LI 1VQMZ 4A3EI 1RLYA 1QYPA 1VQ4Z 3CCJZ 1RO0A 2LFUA 1Z03A 3CC7Z 1X3ZA 1S721 1WIIA 4HGYA 3CCR1 1YUKA 2V8KA 4A3MI 1YI2Z 4BBSI 2QKDA 2QA41 5T64A 4E2XA 1N8R1 3H0GI 1VLAA 2W04A 1P9NA 4NB8A 3CCL1 2JR6A 3CPWY 1VQ61 1QVGZ 3FQMA 5FLXb 3G4S1 3G6EZ 3M4OI 1PFTA 3CCM1 4Y52I 3VMHA 2OTJ1 1RNIA 3RZOI 3D6WA 3FQQA 4E32A 1YUAA 2BJOA 1VQLZ 2Q4ZA 2YU9I 4Y7NI 3J80f 3GTOI 4QTUA 5D1OB 3F3FC 1Y1VI 1TWHI 1ZH1A 5T6BA 3GTKI 4NBHA 4E30A 2RT9A 5A2Qf 2JA5I 4RVGA 4RVDA 5C4JI 3NFZA 3Q87A 2R6MA 1VQO1 1VQ7Z 3NDIA 2E2II 1VQ8Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T I;  3GCF A;  2AKL A;  4A3K I;  3I4M I;  4MH4 A;  2R93 I;  3S1M I;  3I07 A;  2JS4 A;  5CM2 M;  3PO3 I;  3HOX I;  2JA8 I;  2K5R A;  4NBD A;  2JA7 I;  3GTM S;  3GTJ I;  2P3Y A;  5IP7 I;  2E2J I;  3GKQ A;  4BXX I;  3GTG I;  3HOZ I;  3S2H I;  2PK7 A;  1TWG I;  3CQZ I;  3S14 I;  1X3W A;  2NVQ I;  3LUS A;  3S1N I;  4NBE A;  4A3L I;  3PO2 I;  3K7A I;  2F4O A;  4A3E I;  1RLY A;  1TFI A;  2R7Z I;  4BY7 I;  2DE7 A;  4A3G I;  4A3J I;  3GTL I;  1QYP A;  1RO4 A;  4A3C I;  1TWA I;  1I3Q I;  3ESW A;  4NBF A;  3VMI A;  4A3F I;  4NBG A;  3VB9 A;  3GTP I;  2DE5 A;  2NVY I;  1X3Z A;  2JA6 I;  1N2F A;  3H3V J;  1ZB9 A;  3S17 I;  5C3E I;  4XX2 A;  3HOU I;  4NB9 A;  1WW9 A;  1I50 I;  4A3M I;  1L1O C;  1USP A;  4NBA A;  1DL6 A;  4NBB A;  1I6H I;  3S15 I;  4NOZ A;  2KPI A;  4BBR I;  4BBS I;  3S1R I;  3GTM I;  1USP B;  2JNY A;  3H0G I;  3RZD I;  4NBC A;  1VLA A;  2VUM I;  5C44 I;  4BY1 I;  4NB8 A;  2JR6 A;  1ZB8 A;  4QTT A;  5IP9 I;  1NUI A;  1WCM I;  1Y1V S;  2NVT I;  3HOY I;  3VMG A;  3PO3 S;  2RBL A;  3M4O I;  1ML8 A;  1PFT A;  2DE6 A;  4Y52 I;  3VMH A;  3RZO I;  3D6W A;  1YUA A;  3HOW I;  2NVX I;  4A3I I;  3I4N I;  4A93 I;  1SFO I;  2BJO A;  3HOV I;  3S1Q I;  2YU9 I;  4Y7N I;  2J6A A;  3S2D I;  4X6A I;  3GTO I;  4QTU A;  1Y1V I;  3U50 C;  1TWH I;  2E2H I;  4A3D I;  3GTK I;  4NBH A;  3S16 I;  3FKI I;  1TWC I;  1LQL A;  2R92 I;  3GTQ I;  1Y1W I;  2JA5 I;  1K83 I;  2HF1 A;  3M3Y I;  2F4M A;  4A3B I;  5C4J I;  3Q87 A;  3EER A;  1TWF I;  2B63 I;  5FLM I;  5C4X I;  2E2I I; 
#chains in the Genus database with same CATH topology
 2Y0S A;  3CCU 1;  3I4M I;  5CM2 M;  1Z01 A;  4NBD A;  1NJI 2;  4RS4 A;  4HGZ A;  1QXF A;  3GTM S;  1M90 2;  2Q51 A;  4BXX I;  3KIH A;  3CCR Z;  1K73 1;  2QR1 B;  3CPW Z;  3S14 I;  5T67 A;  2QA4 Z;  2P28 A;  4RVH A;  4NBE A;  3CC2 1;  4MXU A;  3VTN A;  2F4O A;  3J80 b;  3CCL Z;  2R7Z I;  1VQ6 Z;  4A3G I;  3G4S Z;  1WZN A;  3CCM Z;  2OTJ Z;  2JUB A;  3GTP I;  2NVY I;  1Q82 2;  1JJ2 Z;  2JA6 I;  3H3V J;  5C3E I;  4MD9 A;  3G71 1;  4NB9 A;  1L1O C;  4NBA A;  1I6H I;  1Q81 2;  4NOZ A;  4BBR I;  3CD6 1;  3HKZ A;  3S1R I;  3NH4 A;  2HU9 A;  2GTI A;  3KIF A;  3JAM f;  2VUM I;  2JIM A;  3EED A;  3IR7 A;  1YJN 1;  2G2K A;  4MD7 A;  1VQO Z;  1ML8 A;  2DE6 A;  2M6N A;  2H85 A;  3T4N B;  3NH8 A;  3HOW I;  2NVX I;  3P5J B;  2JIO A;  4CL1 A;  3CCU Z;  3HOV I;  3S2D I;  2J6A A;  3CME 1;  2RIQ A;  3U50 C;  4A3D I;  2PMZ A;  3I55 1;  2R92 I;  1Q16 A;  3GTQ I;  1K83 I;  3M3Y I;  2F4M A;  1Q86 2;  1NJI 1;  1Q7Y 2;  3CCS 1;  1TWF I;  2B63 I;  5C4X I;  1M90 1;  1R9T I;  3CC2 Z;  4A3K I;  4E2Y A;  3I56 1;  1M1K 2;  3D9X A;  1VQK 1;  3S1M I;  3PO3 I;  3CC4 1;  5IT9 f;  2JA8 I;  1X0T A;  2QEX 1;  2V3V A;  2QRC B;  2W03 A;  4E31 A;  3JAM b;  3CCV 1;  1KC8 1;  2VF1 A;  1K8A 2;  3G71 Z;  3GTG I;  3HOZ I;  1QF8 A;  3S2H I;  3MZK B;  1YJ9 1;  1NP6 A;  4NH1 C;  1Q82 1;  3CD6 Z;  1X3W A;  1YJW Z;  4BY7 I;  4TNU A;  2VPX A;  1Q81 1;  3GTL I;  1RO4 A;  4A3C I;  3ESW A;  4NBF A;  3VMI A;  4NBG A;  3VB9 A;  1VQP 1;  2DE5 A;  5LL6 f;  1S72 Z;  2EGT A;  1QVF Y;  3S17 I;  1S7M A;  3CMA 1;  3CME Z;  4XX2 A;  3HOU I;  1I50 I;  1USP A;  2VPW A;  1DL6 A;  4NBB A;  1YIJ 1;  2OOY B;  4AYB A;  3I55 Z;  4HH4 A;  2AYD A;  3IF8 A;  2JNY A;  4NBC A;  4MD8 A;  5C44 I;  1K9M 2;  4BY1 I;  4E2Z A;  4DQY B;  5IP9 I;  1NUI A;  3HOY I;  5IT9 b;  4DK1 A;  3CCS Z;  2WAQ A;  5A2Q b;  4RV9 A;  4A3I I;  4A93 I;  2VUG A;  1SFO I;  3S1Q I;  3I56 Z;  1Q86 1;  3CCQ 1;  1Q7Y 1;  1VQL 1;  4X6A I;  1KRL A;  1VQK Z;  2QLV B;  3J81 f;  3CC4 Z;  2E2H I;  2JIR A;  2QEX Z;  3FKI I;  1JWH C;  2LIY A;  3CCV Z;  2WB1 A;  1M1K 1;  3TDH B;  2HF1 A;  2QRD B;  2VPY A;  4A3B I;  2I3C A;  1YJ9 Z;  1VQ9 1;  2VPZ A;  2IZ3 A;  1K8A 1;  3GCF A;  2AKL A;  4E33 A;  1VQ5 1;  2PM9 A;  2R93 I;  2RHB A;  1QVF Z;  3I07 A;  1Z02 A;  2JS4 A;  1FDO A;  3CCE 1;  2JA7 I;  1K73 2;  2K3R A;  1VQP Z;  3GTJ I;  2V8I A;  2OTL 1;  3GKQ A;  3CMA Z;  2OZK A;  2PK7 A;  1TWG I;  4S1T A;  1YHQ 1;  3OW2 Y;  1YIJ Z;  2O4H A;  3CQZ I;  3F3P C;  4E2W A;  3S1N I;  3PO2 I;  2IZ4 A;  3K7A I;  1TFI A;  2DE7 A;  4A3J I;  2JMO A;  1YIT 1;  3J81 b;  1TWA I;  1I3Q I;  2E7Z A;  3CXC Y;  4A3F I;  1KD1 2;  2M48 A;  1VQN 1;  1N2F A;  1ZB9 A;  1K9M 1;  2V8J A;  3CCQ Z;  1WW9 A;  2JIP A;  3S15 I;  4EWC A;  2KPI A;  1JJ2 Y;  2LEX A;  3GTM I;  1SIW A;  1USP B;  3NDJ A;  4RVF A;  2OOX B;  1W2B Y;  3RZD I;  1VQM 1;  1YJN Z;  1KQS Y;  1ZB8 A;  4QTT A;  3BG0 B;  1WCM I;  1Y1V S;  1VQ4 1;  2NVT I;  3VMG A;  3PO3 S;  3CCJ 1;  2RBL A;  2ZAE B;  3MZL B;  2V45 A;  3TE5 B;  1VQ9 Z;  3J7A 4;  3CC7 1;  1RO2 A;  3BG1 B;  3I4N I;  5D1O A;  1N8R 2;  2QRE B;  2GU2 A;  1VQ5 Z;  1YI2 1;  4MON A;  3IX0 A;  4DGL A;  2O53 A;  3CCE Z;  2E9H A;  3NH5 A;  3OW2 Z;  3S16 I;  1TWC I;  1LQL A;  2RPR A;  2OTL Z;  1Y1W I;  4NFR A;  1YHQ Z;  3EER A;  3G6E 1;  5FLM I;  3QWU A;  2KI7 B;  2YAD A;  3CXC Z;  1RQF A;  1QVG Y;  3D2L A;  5AN9 F;  2GTH A;  4MH4 A;  1YIT Z;  5FLX f;  1KC8 2;  3HOX I;  2K5R A;  4MRI A;  3IFU A;  1VQN Z;  2P3Y A;  5IP7 I;  2E2J I;  1W2B Z;  3MON A;  1KD1 1;  1KQS Z;  5D1P A;  1VQ7 1;  2NVQ I;  2IV2 X;  3LUS A;  1VQ8 1;  1AA6 A;  1YJW 1;  4A3L I;  1VQM Z;  1Y8C A;  4A3E I;  1RLY A;  2JIQ A;  1QYP A;  1VQ4 Z;  3CCJ Z;  1RO0 A;  2LFU A;  1Z03 A;  3CC7 Z;  1WJ2 A;  1X3Z A;  1S72 1;  1WII A;  4HGY A;  3CCR 1;  1FDI A;  1YUK A;  2V8K A;  4A3M I;  1YI2 Z;  4BBS I;  2QKD A;  2QA4 1;  5T64 A;  4E2X A;  1N8R 1;  3H0G I;  1VLA A;  2W04 A;  1P9N A;  4NB8 A;  3CCL 1;  2JR6 A;  3CPW Y;  1VQ6 1;  1QVG Z;  3FQM A;  5FLX b;  3G4S 1;  3G6E Z;  3M4O I;  1PFT A;  3CCM 1;  4Y52 I;  3VMH A;  2OTJ 1;  1RNI A;  3RZO I;  3D6W A;  3FQQ A;  4E32 A;  1YUA A;  2BJO A;  1VQL Z;  2Q4Z A;  2YU9 I;  4Y7N I;  2NAP A;  3J80 f;  3GTO I;  4QTU A;  5D1O B;  3F3F C;  1Y1V I;  1TWH I;  1ZH1 A;  5T6B A;  3GTK I;  4NBH A;  4E30 A;  2RT9 A;  5A2Q f;  2JA5 I;  4RVG A;  4RVD A;  5C4J I;  3NFZ A;  3Q87 A;  2R6M A;  1VQO 1;  1VQ7 Z;  3NDI A;  2E2I I;  1VQ8 Z; 
#chains in the Genus database with same CATH homology
 2Y0S A;  3CCU 1;  3I4M I;  5CM2 M;  1Z01 A;  4NBD A;  1NJI 2;  4RS4 A;  4HGZ A;  3GTM S;  1M90 2;  2Q51 A;  4BXX I;  3KIH A;  3CCR Z;  1K73 1;  2QR1 B;  3CPW Z;  3S14 I;  5T67 A;  2QA4 Z;  2P28 A;  4RVH A;  4NBE A;  3CC2 1;  4MXU A;  3VTN A;  2F4O A;  3J80 b;  3CCL Z;  2R7Z I;  1VQ6 Z;  4A3G I;  3G4S Z;  3CCM Z;  2OTJ Z;  2JUB A;  3GTP I;  2NVY I;  1Q82 2;  1JJ2 Z;  2JA6 I;  3H3V J;  5C3E I;  4MD9 A;  3G71 1;  4NB9 A;  1L1O C;  4NBA A;  1I6H I;  1Q81 2;  4NOZ A;  4BBR I;  3CD6 1;  3HKZ A;  3S1R I;  3NH4 A;  2HU9 A;  2GTI A;  3KIF A;  3JAM f;  2VUM I;  3EED A;  1YJN 1;  2G2K A;  4MD7 A;  1VQO Z;  1ML8 A;  2DE6 A;  2M6N A;  2H85 A;  3T4N B;  3NH8 A;  3HOW I;  2NVX I;  3P5J B;  3CCU Z;  4CL1 A;  3HOV I;  3S2D I;  2J6A A;  3CME 1;  2RIQ A;  3U50 C;  4A3D I;  2PMZ A;  3I55 1;  2R92 I;  3GTQ I;  1K83 I;  3M3Y I;  2F4M A;  1Q86 2;  1NJI 1;  1Q7Y 2;  3CCS 1;  1TWF I;  2B63 I;  5C4X I;  1M90 1;  1R9T I;  3CC2 Z;  4A3K I;  4E2Y A;  3I56 1;  1M1K 2;  3D9X A;  1VQK 1;  3S1M I;  3PO3 I;  3CC4 1;  5IT9 f;  2JA8 I;  1X0T A;  2QEX 1;  2QRC B;  2W03 A;  4E31 A;  3JAM b;  3CCV 1;  1KC8 1;  2VF1 A;  1K8A 2;  3G71 Z;  3GTG I;  3HOZ I;  1QF8 A;  3S2H I;  3MZK B;  1YJ9 1;  1NP6 A;  4NH1 C;  1Q82 1;  3CD6 Z;  1X3W A;  1YJW Z;  4BY7 I;  4TNU A;  1Q81 1;  3GTL I;  1RO4 A;  4A3C I;  3ESW A;  4NBF A;  3VMI A;  4NBG A;  3VB9 A;  1VQP 1;  2DE5 A;  5LL6 f;  1S72 Z;  2EGT A;  1QVF Y;  3S17 I;  1S7M A;  3CMA 1;  3CME Z;  4XX2 A;  3HOU I;  1I50 I;  1USP A;  1DL6 A;  4NBB A;  1YIJ 1;  2OOY B;  4AYB A;  3I55 Z;  4HH4 A;  3IF8 A;  2JNY A;  4NBC A;  4MD8 A;  5C44 I;  1K9M 2;  4BY1 I;  4E2Z A;  4DQY B;  5IP9 I;  1NUI A;  3HOY I;  5IT9 b;  4DK1 A;  3CCS Z;  2WAQ A;  5A2Q b;  4RV9 A;  4A3I I;  4A93 I;  2VUG A;  1SFO I;  3S1Q I;  3I56 Z;  1Q86 1;  3CCQ 1;  1Q7Y 1;  1VQL 1;  4X6A I;  1KRL A;  1VQK Z;  2QLV B;  3J81 f;  3CC4 Z;  2E2H I;  2QEX Z;  3FKI I;  1JWH C;  2LIY A;  3CCV Z;  2WB1 A;  1M1K 1;  3TDH B;  2HF1 A;  2QRD B;  4A3B I;  2I3C A;  1YJ9 Z;  1VQ9 1;  2IZ3 A;  1K8A 1;  3GCF A;  2AKL A;  4E33 A;  1VQ5 1;  2PM9 A;  2R93 I;  2RHB A;  1QVF Z;  3I07 A;  1Z02 A;  2JS4 A;  3CCE 1;  2JA7 I;  1K73 2;  2K3R A;  1VQP Z;  3GTJ I;  2V8I A;  2OTL 1;  3GKQ A;  3CMA Z;  2OZK A;  2PK7 A;  1TWG I;  4S1T A;  1YHQ 1;  3OW2 Y;  1YIJ Z;  2O4H A;  3CQZ I;  3F3P C;  4E2W A;  3S1N I;  3PO2 I;  2IZ4 A;  3K7A I;  1TFI A;  2DE7 A;  4A3J I;  2JMO A;  1YIT 1;  3J81 b;  1TWA I;  1I3Q I;  3CXC Y;  4A3F I;  1KD1 2;  2M48 A;  1VQN 1;  1N2F A;  1ZB9 A;  1K9M 1;  2V8J A;  3CCQ Z;  1WW9 A;  3S15 I;  4EWC A;  2KPI A;  1JJ2 Y;  3GTM I;  1USP B;  3NDJ A;  4RVF A;  2OOX B;  1W2B Y;  3RZD I;  1VQM 1;  1YJN Z;  1KQS Y;  1ZB8 A;  4QTT A;  3BG0 B;  1WCM I;  1Y1V S;  1VQ4 1;  2NVT I;  3VMG A;  3PO3 S;  3CCJ 1;  2RBL A;  2ZAE B;  3MZL B;  3TE5 B;  1VQ9 Z;  3J7A 4;  3CC7 1;  1RO2 A;  3BG1 B;  3I4N I;  5D1O A;  1N8R 2;  2QRE B;  2GU2 A;  1VQ5 Z;  1YI2 1;  4MON A;  3IX0 A;  4DGL A;  2O53 A;  3CCE Z;  2E9H A;  3NH5 A;  3OW2 Z;  3S16 I;  1TWC I;  1LQL A;  2RPR A;  2OTL Z;  1Y1W I;  4NFR A;  1YHQ Z;  3EER A;  3G6E 1;  5FLM I;  3QWU A;  2KI7 B;  2YAD A;  3CXC Z;  1RQF A;  1QVG Y;  5AN9 F;  2GTH A;  4MH4 A;  1YIT Z;  5FLX f;  1KC8 2;  3HOX I;  2K5R A;  4MRI A;  3IFU A;  1VQN Z;  2P3Y A;  5IP7 I;  2E2J I;  1W2B Z;  3MON A;  1KD1 1;  1KQS Z;  5D1P A;  1VQ7 1;  2NVQ I;  3LUS A;  1VQ8 1;  1YJW 1;  4A3L I;  1VQM Z;  4A3E I;  1RLY A;  1QYP A;  1VQ4 Z;  3CCJ Z;  1RO0 A;  2LFU A;  1Z03 A;  3CC7 Z;  1X3Z A;  1S72 1;  1WII A;  4HGY A;  3CCR 1;  1YUK A;  2V8K A;  4A3M I;  1YI2 Z;  4BBS I;  2QKD A;  2QA4 1;  5T64 A;  4E2X A;  1N8R 1;  3H0G I;  1VLA A;  2W04 A;  1P9N A;  4NB8 A;  3CCL 1;  2JR6 A;  3CPW Y;  1VQ6 1;  1QVG Z;  3FQM A;  5FLX b;  3G4S 1;  3G6E Z;  3M4O I;  1PFT A;  3CCM 1;  4Y52 I;  3VMH A;  2OTJ 1;  1RNI A;  3RZO I;  3D6W A;  3FQQ A;  4E32 A;  1YUA A;  2BJO A;  1VQL Z;  2Q4Z A;  2YU9 I;  4Y7N I;  3J80 f;  3GTO I;  4QTU A;  5D1O B;  3F3F C;  1Y1V I;  1TWH I;  1ZH1 A;  5T6B A;  3GTK I;  4NBH A;  4E30 A;  2RT9 A;  5A2Q f;  2JA5 I;  4RVG A;  4RVD A;  5C4J I;  3NFZ A;  3Q87 A;  2R6M A;  1VQO 1;  1VQ7 Z;  3NDI A;  2E2I I;  1VQ8 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...