2NVQI

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI02
5C3EI 2PK7A 1ZB9A 3FKII 3GTQI 3U50C 4QTUA 3GKQA 4A3KI 1Y1VS 3S1RI 3LUSA 1TWHI 3K7AI 1R9TI 3RZOI 1QYPA 2AKLA 3D6WA 5C4JI 5IP9I 3PO3S 2JA7I 3H0GI 3I4NI 4NBEA 3GTMI 5FLMI 5C44I 2NVTI 4A3DI 4NOZA 3PO2I 4NB8A 1TWAI 1X3WA 2F4MA 1YUAA 4BBSI 2BJOA 3S15I 2R93I 1VLAA 3I07A 2JR6A 1USPB 4NBGA 3EERA 3GTLI 4A3II 3S2HI 4NBDA 2E2JI 2NVQI 3M4OI 3GTOI 1TWGI 1I6HI 4Y7NI 2K5RA 4A3MI 2JS4A 1RO4A 2F4OA 2RBLA 2YU9I 3S17I 4BY1I 4QTTA 1Y1VI 3VMGA 3M3YI 3HOWI 1K83I 2VUMI 2KPIA 3H3VJ 2E2HI 4NBAA 4XX2A 3VB9A 4MH4A 2E2II 3S2DI 1I50I 2JNYA 4BXXI 2J6AA 3HOYI 1X3ZA 3VMHA 3CQZI 2DE5A 1RLYA 3S1MI 3GTGI 4A3FI 3S1QI 3GTMS 5IP7I 1N2FA 3GTKI 4X6AI 4NBHA 2NVYI 4A3EI 2DE7A 5CM2M 1SFOI 2JA6I 3HOZI 1DL6A 4A3BI 4NB9A 5C4XI 4A3CI 4A3GI 3HOXI 1TWCI 3I4MI 3PO3I 2JA8I 2HF1A 4NBBA 3S1NI 4NBFA 1NUIA 2R92I 3VMIA 2JA5I 1USPA 1PFTA 4A3LI 3GTJI 3HOUI 4BY7I 4A93I 2DE6A 1Y1WI 1LQLA 4A3JI 2NVXI 1ML8A 3GTPI 1WCMI 3GCFA 3ESWA 2B63I 3RZDI 3HOVI 3S14I 2P3YA 1I3QI 1TFIA 1WW9A 4BBRI 4Y52I 1L1OC 1TWFI 1ZB8A 3Q87A 4NBCA 2R7ZI 3S16I
chains in the Genus database with same CATH superfamily
2PK7A 3FKII 1VQO1 1Z02A 1TWHI 2E7ZA 3CCUZ 1NP6A 3RZOI 5C4JI 5IP9I 1QXFA 2JA7I 1K8A2 1VQ41 3GTMI 1YJN1 1YJW1 3CCJZ 1X3WA 3G71Z 4DQYB 2F4MA 4BBSI 5A2Qb 1VLAA 2LEXA 2GU2A 1USPB 3CD6Z 5T64A 5T6BA 4A3MI 2M6NA 2JS4A 1M1K2 1KRLA 4EWCA 1KC81 2VPZA 2YU9I 3S17I 1S721 1YITZ 2HU9A 3CCQ1 2OTL1 1Y1VI 1K83I 2VUMI 2LFUA 1YUKA 1Q862 2OOXB 3H3VJ 2E2HI 3VB9A 1VQL1 1Q822 1RQFA 5AN9F 2QRDB 1X3ZA 3VMHA 1NJI1 5A2Qf 1VQOZ 2V8IA 1QVGZ 3CCR1 1W2BZ 4NBHA 1VQ4Z 1SFOI 1YJNZ 3FQMA 1YJWZ 2WB1A 4A3GI 1TWCI 3I4MI 3FQQA 2G2KA 2IZ4A 3CC41 2JA5I 1USPA 1K9M2 3MZKB 3GTJI 1VQP1 2QLVB 2RIQA 2IV2X 4A93I 2DE6A 1S72Z 3MZLB 3CCQZ 2OTLZ 2NVXI 2PM9A 3HOVI 1I3QI 1TFIA 1WW9A 3I551 1VQLZ 4HH4A 2EGTA 4NBCA 1WIIA 3GTQI 4S1TA 1Q7Y2 4QTUA 2V8KA 1Y1VS 2QEX1 3LUSA 3MONA 3CCRZ 3PO3S 1SIWA 3H0GI 1P9NA 4RVDA 5FLMI 2RPRA 1JJ2Y 2LIYA 4NFRA 3CPWZ 1YUAA 2R93I 3F3PC 4HGZA 2JR6A 1RO2A 3NH8A 3CC4Z 4A3II 3S2HI 4E2XA 1TWGI 1QVFY 2K5RA 3CC21 1VQN1 1VQPZ 2F4OA 2RBLA 2OTJ1 3J80b 1K8A1 1YJ91 1KQSY 2KPIA 2QREB 4XX2A 3I55Z 4MH4A 2QA41 3S2DI 1Z03A 2E9HA 2JNYA 2VF1A 3OW2Z 2J6AA 2WAQA 3HOYI 4MXUA 2V3VA 3GTGI 2JIPA 4A3FI 4E30A 2QEXZ 4E31A 3CXCY 1M1K1 1FDIA 2R6MA 1DL6A 3KIHA 4NB9A 3J80f 3PO3I 1Q861 3S1NI 4NBFA 1WZNA 1Q821 1NUIA 3VMIA 2QKDA 1WJ2A 1PFTA 2YADA 3CC2Z 3J81f 2VPWA 1VQNZ 2OTJZ 2GTIA 2RT9A 1LQLA 2PMZA 4RVGA 1YJ9Z 1ML8A 3KIFA 1Y8CA 3D9XA 2NAPA 2GTHA 3RZDI 2P3YA 4Y52I 5D1PA 3I561 1X0TA 2QA4Z 1ZB8A 1NJI2 1VQM1 3HKZA 2O53A 1JWHC 1YI21 4MD7A 1VQK1 5C3EI 2P28A 1ZB9A 2Q51A 1S7MA 3U50C 3CME1 3GKQA 2V45A 4A3KI 1K9M1 4MD9A 1R9TI 1QF8A 4NBEA 3G4S1 1N8R1 4DGLA 5C44I 2ZAEB 5FLXb 4NOZA 4A3DI 2JIOA 1KD12 1VQ91 3D2LA 2QRCB 4NBGA 3EERA 3GTLI 3JAMb 3M4OI 1FDOA 3NH5A 1ZH1A 2V8JA 1Q7Y1 1K732 1JJ2Z 3NH4A 2AYDA 4BY1I 4QTTA 3EEDA 3VMGA 3M3YI 3CCM1 2KI7B 1AA6A 4NBAA 2JIMA 2JIRA 3I56Z 5FLXf 1VQMZ 2Q4ZA 3CC71 1YI2Z 2DE5A 3CQZI 1RLYA 3S1MI 1VQKZ 1VQ51 2IZ3A 3G6E1 3CMEZ 3S1QI 5IT9f 3JAMf 5IP7I 1VQ61 3GTKI 2JMOA 1M902 2OZKA 2NVYI 4NH1C 2DE7A 3G4SZ 3HOZI 5C4XI 2Y0SA 4A3CI 2OOYB 3HOXI 1Q812 1VQ9Z 2JA8I 2HF1A 3NDIA 3IFUA 3CXCZ 2R92I 3CPWY 3CCV1 3J81b 2QR1B 3NFZA 3TE5B 3HOUI 3NDJA 4BY7I 1Y1WI 4A3JI 3T4NB 2JIQA 1VQ71 3F3FC 3CCMZ 2B63I 4DK1A 2W04A 4MRIA 3S14I 1L1OC 2H85A 1TWFI 3CCS1 3Q87A 3BG1B 3CC7Z 4E2YA 1VQ5Z 3P5JB 3G6EZ 3OW2Y 4E2WA 3S1RI 1KC82 1VQ6Z 3K7AI 1QYPA 2AKLA 3D6WA 3VTNA 3I4NI 4RVFA 4AYBA 2NVTI 3CCE1 3PO2I 4NB8A 1TWAI 5D1OA 2K3RA 2BJOA 4RVHA 3S15I 3I07A 3BG0B 4MONA 4NBDA 2E2JI 2NVQI 3IX0A 3GTOI 3CMA1 3CCVZ 1I6HI 4Y7NI 4CL1A 3CCL1 1YIJ1 4E2ZA 2VPYA 1RO4A 1Z01A 2O4HA 1VQ7Z 3HOWI 1QVGY 3IF8A 1YHQ1 4TNUA 2M48A 1W2BY 4RV9A 1KD11 1VQ81 2E2II 4MD8A 3CCSZ 1I50I 4BXXI 3IR7A 2VUGA 5IT9b 3GTMS 4E33A 1N2FA 3CCU1 4X6AI 1K731 1N8R2 4A3EI 5CM2M 2JA6I 4A3BI 5LL6f 3CCJ1 3CCEZ 3G711 1Q16A 4HGYA 4NBBA 1QVFZ 3CD61 3QWUA 3CMAZ 4E32A 2RHBA 3CCLZ 1YIJZ 4A3LI 1RO0A 2VPXA 2W03A 1KQSZ 1YIT1 4RS4A 1M901 1RNIA 5D1OB 5T67A 3GTPI 1WCMI 3GCFA 3ESWA 1YHQZ 2I3CA 4BBRI 1Q811 1VQ8Z 2JUBA 2R7ZI 3J7A4 3TDHB 3S16I
chains in the Genus database with same CATH topology
2PK7A 3FKII 1VQO1 1Z02A 1TWHI 3CCUZ 1NP6A 3RZOI 5C4JI 5IP9I 2JA7I 1K8A2 1VQ41 3GTMI 1YJN1 1YJW1 3CCJZ 1X3WA 3G71Z 4DQYB 2F4MA 4BBSI 5A2Qb 1VLAA 2GU2A 1USPB 3CD6Z 5T64A 5T6BA 4A3MI 2M6NA 2JS4A 1M1K2 1KRLA 4EWCA 1KC81 2YU9I 3S17I 1S721 1YITZ 2HU9A 3CCQ1 2OTL1 1Y1VI 1K83I 2VUMI 2LFUA 1YUKA 1Q862 2OOXB 3H3VJ 2E2HI 3VB9A 1VQL1 1Q822 1RQFA 5AN9F 2QRDB 1X3ZA 3VMHA 1NJI1 5A2Qf 1VQOZ 2V8IA 1QVGZ 3CCR1 1W2BZ 4NBHA 1VQ4Z 1SFOI 1YJNZ 3FQMA 1YJWZ 2WB1A 4A3GI 1TWCI 3I4MI 3FQQA 2G2KA 2IZ4A 3CC41 2JA5I 1USPA 1K9M2 3MZKB 3GTJI 1VQP1 2QLVB 2RIQA 4A93I 2DE6A 1S72Z 3MZLB 3CCQZ 2OTLZ 2NVXI 2PM9A 3HOVI 1I3QI 1TFIA 1WW9A 3I551 1VQLZ 4HH4A 2EGTA 4NBCA 1WIIA 3GTQI 4S1TA 1Q7Y2 4QTUA 2V8KA 1Y1VS 2QEX1 3LUSA 3MONA 3CCRZ 3PO3S 3H0GI 1P9NA 4RVDA 5FLMI 2RPRA 1JJ2Y 2LIYA 4NFRA 3CPWZ 1YUAA 2R93I 3F3PC 4HGZA 2JR6A 1RO2A 3NH8A 3CC4Z 4A3II 3S2HI 4E2XA 1TWGI 1QVFY 2K5RA 3CC21 1VQN1 1VQPZ 2F4OA 2RBLA 2OTJ1 3J80b 1K8A1 1YJ91 1KQSY 2KPIA 2QREB 4XX2A 3I55Z 4MH4A 2QA41 3S2DI 1Z03A 2E9HA 2JNYA 2VF1A 3OW2Z 2J6AA 2WAQA 3HOYI 4MXUA 3GTGI 4A3FI 4E30A 2QEXZ 4E31A 3CXCY 1M1K1 2R6MA 1DL6A 3KIHA 4NB9A 3J80f 3PO3I 1Q861 3S1NI 4NBFA 1Q821 1NUIA 3VMIA 2QKDA 1PFTA 2YADA 3CC2Z 3J81f 1VQNZ 2OTJZ 2GTIA 2RT9A 1LQLA 2PMZA 4RVGA 1YJ9Z 1ML8A 3KIFA 3D9XA 2GTHA 3RZDI 2P3YA 4Y52I 5D1PA 3I561 1X0TA 2QA4Z 1ZB8A 1NJI2 1VQM1 3HKZA 2O53A 1JWHC 1YI21 4MD7A 1VQK1 5C3EI 2P28A 1ZB9A 2Q51A 1S7MA 3U50C 3CME1 3GKQA 1K9M1 4A3KI 4MD9A 1R9TI 1QF8A 4NBEA 3G4S1 1N8R1 4DGLA 5C44I 2ZAEB 5FLXb 4NOZA 4A3DI 1KD12 1VQ91 2QRCB 4NBGA 3EERA 3GTLI 3JAMb 3M4OI 3NH5A 1ZH1A 2V8JA 1Q7Y1 1K732 1JJ2Z 3NH4A 4BY1I 4QTTA 3EEDA 3VMGA 3M3YI 3CCM1 2KI7B 4NBAA 3I56Z 5FLXf 1VQMZ 2Q4ZA 3CC71 1YI2Z 2DE5A 3CQZI 1RLYA 3S1MI 1VQKZ 1VQ51 2IZ3A 3G6E1 3CMEZ 3S1QI 5IT9f 3JAMf 5IP7I 1VQ61 3GTKI 2JMOA 1M902 2OZKA 2NVYI 4NH1C 2DE7A 3G4SZ 3HOZI 5C4XI 2Y0SA 4A3CI 2OOYB 3HOXI 1Q812 1VQ9Z 2JA8I 2HF1A 3NDIA 3IFUA 3CXCZ 2R92I 3CPWY 3CCV1 3J81b 2QR1B 3NFZA 3TE5B 3HOUI 3NDJA 4BY7I 1Y1WI 4A3JI 3T4NB 1VQ71 3F3FC 3CCMZ 2B63I 4DK1A 2W04A 4MRIA 3S14I 1L1OC 2H85A 1TWFI 3CCS1 3Q87A 3BG1B 3CC7Z 4E2YA 1VQ5Z 3P5JB 3G6EZ 3OW2Y 4E2WA 3S1RI 1KC82 1VQ6Z 3K7AI 1QYPA 2AKLA 3D6WA 3VTNA 3I4NI 4RVFA 4AYBA 2NVTI 3CCE1 3PO2I 4NB8A 1TWAI 5D1OA 2K3RA 2BJOA 4RVHA 3S15I 3I07A 3BG0B 4MONA 4NBDA 2E2JI 2NVQI 3IX0A 3GTOI 3CMA1 3CCVZ 1I6HI 4Y7NI 4CL1A 3CCL1 1YIJ1 4E2ZA 1RO4A 1Z01A 2O4HA 1VQ7Z 3HOWI 1QVGY 3IF8A 1YHQ1 4TNUA 2M48A 1W2BY 4RV9A 1KD11 1VQ81 2E2II 4MD8A 3CCSZ 1I50I 4BXXI 2VUGA 5IT9b 3GTMS 4E33A 1N2FA 3CCU1 4X6AI 1K731 1N8R2 4A3EI 5CM2M 2JA6I 4A3BI 5LL6f 3CCJ1 3CCEZ 3G711 4HGYA 4NBBA 1QVFZ 3CD61 3QWUA 3CMAZ 4E32A 2RHBA 3CCLZ 1YIJZ 4A3LI 1RO0A 2W03A 1KQSZ 1YIT1 4RS4A 1M901 1RNIA 5D1OB 5T67A 3GTPI 1WCMI 3GCFA 3ESWA 1YHQZ 2I3CA 4BBRI 1Q811 1VQ8Z 2JUBA 2R7ZI 3J7A4 3TDHB 3S16I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E I;  2PK7 A;  1ZB9 A;  3FKI I;  3GTQ I;  3U50 C;  4QTU A;  3GKQ A;  4A3K I;  1Y1V S;  3S1R I;  3LUS A;  1TWH I;  3K7A I;  1R9T I;  3RZO I;  1QYP A;  2AKL A;  3D6W A;  5C4J I;  5IP9 I;  3PO3 S;  2JA7 I;  3H0G I;  3I4N I;  4NBE A;  3GTM I;  5FLM I;  5C44 I;  2NVT I;  4A3D I;  4NOZ A;  3PO2 I;  4NB8 A;  1TWA I;  1X3W A;  2F4M A;  1YUA A;  4BBS I;  2BJO A;  3S15 I;  2R93 I;  1VLA A;  3I07 A;  2JR6 A;  1USP B;  4NBG A;  3EER A;  3GTL I;  4A3I I;  3S2H I;  4NBD A;  2E2J I;  2NVQ I;  3M4O I;  3GTO I;  1TWG I;  1I6H I;  4Y7N I;  2K5R A;  4A3M I;  2JS4 A;  1RO4 A;  2F4O A;  2RBL A;  2YU9 I;  3S17 I;  4BY1 I;  4QTT A;  1Y1V I;  3VMG A;  3M3Y I;  3HOW I;  1K83 I;  2VUM I;  2KPI A;  3H3V J;  2E2H I;  4NBA A;  4XX2 A;  3VB9 A;  4MH4 A;  2E2I I;  3S2D I;  1I50 I;  2JNY A;  4BXX I;  2J6A A;  3HOY I;  1X3Z A;  3VMH A;  3CQZ I;  2DE5 A;  1RLY A;  3S1M I;  3GTG I;  4A3F I;  3S1Q I;  3GTM S;  5IP7 I;  1N2F A;  3GTK I;  4X6A I;  4NBH A;  2NVY I;  4A3E I;  2DE7 A;  5CM2 M;  1SFO I;  2JA6 I;  3HOZ I;  1DL6 A;  4A3B I;  4NB9 A;  5C4X I;  4A3C I;  4A3G I;  3HOX I;  1TWC I;  3I4M I;  3PO3 I;  2JA8 I;  2HF1 A;  4NBB A;  3S1N I;  4NBF A;  1NUI A;  2R92 I;  3VMI A;  2JA5 I;  1USP A;  1PFT A;  4A3L I;  3GTJ I;  3HOU I;  4BY7 I;  4A93 I;  2DE6 A;  1Y1W I;  1LQL A;  4A3J I;  2NVX I;  1ML8 A;  3GTP I;  1WCM I;  3GCF A;  3ESW A;  2B63 I;  3RZD I;  3HOV I;  3S14 I;  2P3Y A;  1I3Q I;  1TFI A;  1WW9 A;  4BBR I;  4Y52 I;  1L1O C;  1TWF I;  1ZB8 A;  3Q87 A;  4NBC A;  2R7Z I;  3S16 I; 
#chains in the Genus database with same CATH topology
 2PK7 A;  3FKI I;  1VQO 1;  1Z02 A;  1TWH I;  2E7Z A;  3CCU Z;  1NP6 A;  3RZO I;  5C4J I;  5IP9 I;  1QXF A;  2JA7 I;  1K8A 2;  1VQ4 1;  3GTM I;  1YJN 1;  1YJW 1;  3CCJ Z;  1X3W A;  3G71 Z;  4DQY B;  2F4M A;  4BBS I;  5A2Q b;  1VLA A;  2LEX A;  2GU2 A;  1USP B;  3CD6 Z;  5T64 A;  5T6B A;  4A3M I;  2M6N A;  2JS4 A;  1M1K 2;  1KRL A;  4EWC A;  1KC8 1;  2VPZ A;  2YU9 I;  3S17 I;  1S72 1;  1YIT Z;  2HU9 A;  3CCQ 1;  2OTL 1;  1Y1V I;  1K83 I;  2VUM I;  2LFU A;  1YUK A;  1Q86 2;  2OOX B;  3H3V J;  2E2H I;  3VB9 A;  1VQL 1;  1Q82 2;  1RQF A;  5AN9 F;  2QRD B;  1X3Z A;  3VMH A;  1NJI 1;  5A2Q f;  1VQO Z;  2V8I A;  1QVG Z;  3CCR 1;  1W2B Z;  4NBH A;  1VQ4 Z;  1SFO I;  1YJN Z;  3FQM A;  1YJW Z;  2WB1 A;  4A3G I;  1TWC I;  3I4M I;  3FQQ A;  2G2K A;  2IZ4 A;  3CC4 1;  2JA5 I;  1USP A;  1K9M 2;  3MZK B;  3GTJ I;  1VQP 1;  2QLV B;  2RIQ A;  2IV2 X;  4A93 I;  2DE6 A;  1S72 Z;  3MZL B;  3CCQ Z;  2OTL Z;  2NVX I;  2PM9 A;  3HOV I;  1I3Q I;  1TFI A;  1WW9 A;  3I55 1;  1VQL Z;  4HH4 A;  2EGT A;  4NBC A;  1WII A;  3GTQ I;  4S1T A;  1Q7Y 2;  4QTU A;  2V8K A;  1Y1V S;  2QEX 1;  3LUS A;  3MON A;  3CCR Z;  3PO3 S;  1SIW A;  3H0G I;  1P9N A;  4RVD A;  5FLM I;  2RPR A;  1JJ2 Y;  2LIY A;  4NFR A;  3CPW Z;  1YUA A;  2R93 I;  3F3P C;  4HGZ A;  2JR6 A;  1RO2 A;  3NH8 A;  3CC4 Z;  4A3I I;  3S2H I;  4E2X A;  1TWG I;  1QVF Y;  2K5R A;  3CC2 1;  1VQN 1;  1VQP Z;  2F4O A;  2RBL A;  2OTJ 1;  3J80 b;  1K8A 1;  1YJ9 1;  1KQS Y;  2KPI A;  2QRE B;  4XX2 A;  3I55 Z;  4MH4 A;  2QA4 1;  3S2D I;  1Z03 A;  2E9H A;  2JNY A;  2VF1 A;  3OW2 Z;  2J6A A;  2WAQ A;  3HOY I;  4MXU A;  2V3V A;  3GTG I;  2JIP A;  4A3F I;  4E30 A;  2QEX Z;  4E31 A;  3CXC Y;  1M1K 1;  1FDI A;  2R6M A;  1DL6 A;  3KIH A;  4NB9 A;  3J80 f;  3PO3 I;  1Q86 1;  3S1N I;  4NBF A;  1WZN A;  1Q82 1;  1NUI A;  3VMI A;  2QKD A;  1WJ2 A;  1PFT A;  2YAD A;  3CC2 Z;  3J81 f;  2VPW A;  1VQN Z;  2OTJ Z;  2GTI A;  2RT9 A;  1LQL A;  2PMZ A;  4RVG A;  1YJ9 Z;  1ML8 A;  3KIF A;  1Y8C A;  3D9X A;  2NAP A;  2GTH A;  3RZD I;  2P3Y A;  4Y52 I;  5D1P A;  3I56 1;  1X0T A;  2QA4 Z;  1ZB8 A;  1NJI 2;  1VQM 1;  3HKZ A;  2O53 A;  1JWH C;  1YI2 1;  4MD7 A;  1VQK 1;  5C3E I;  2P28 A;  1ZB9 A;  2Q51 A;  1S7M A;  3U50 C;  3CME 1;  3GKQ A;  2V45 A;  4A3K I;  1K9M 1;  4MD9 A;  1R9T I;  1QF8 A;  4NBE A;  3G4S 1;  1N8R 1;  4DGL A;  5C44 I;  2ZAE B;  5FLX b;  4NOZ A;  4A3D I;  2JIO A;  1KD1 2;  1VQ9 1;  3D2L A;  2QRC B;  4NBG A;  3EER A;  3GTL I;  3JAM b;  3M4O I;  1FDO A;  3NH5 A;  1ZH1 A;  2V8J A;  1Q7Y 1;  1K73 2;  1JJ2 Z;  3NH4 A;  2AYD A;  4BY1 I;  4QTT A;  3EED A;  3VMG A;  3M3Y I;  3CCM 1;  2KI7 B;  1AA6 A;  4NBA A;  2JIM A;  2JIR A;  3I56 Z;  5FLX f;  1VQM Z;  2Q4Z A;  3CC7 1;  1YI2 Z;  2DE5 A;  3CQZ I;  1RLY A;  3S1M I;  1VQK Z;  1VQ5 1;  2IZ3 A;  3G6E 1;  3CME Z;  3S1Q I;  5IT9 f;  3JAM f;  5IP7 I;  1VQ6 1;  3GTK I;  2JMO A;  1M90 2;  2OZK A;  2NVY I;  4NH1 C;  2DE7 A;  3G4S Z;  3HOZ I;  5C4X I;  2Y0S A;  4A3C I;  2OOY B;  3HOX I;  1Q81 2;  1VQ9 Z;  2JA8 I;  2HF1 A;  3NDI A;  3IFU A;  3CXC Z;  2R92 I;  3CPW Y;  3CCV 1;  3J81 b;  2QR1 B;  3NFZ A;  3TE5 B;  3HOU I;  3NDJ A;  4BY7 I;  1Y1W I;  4A3J I;  3T4N B;  2JIQ A;  1VQ7 1;  3F3F C;  3CCM Z;  2B63 I;  4DK1 A;  2W04 A;  4MRI A;  3S14 I;  1L1O C;  2H85 A;  1TWF I;  3CCS 1;  3Q87 A;  3BG1 B;  3CC7 Z;  4E2Y A;  1VQ5 Z;  3P5J B;  3G6E Z;  3OW2 Y;  4E2W A;  3S1R I;  1KC8 2;  1VQ6 Z;  3K7A I;  1QYP A;  2AKL A;  3D6W A;  3VTN A;  3I4N I;  4RVF A;  4AYB A;  2NVT I;  3CCE 1;  3PO2 I;  4NB8 A;  1TWA I;  5D1O A;  2K3R A;  2BJO A;  4RVH A;  3S15 I;  3I07 A;  3BG0 B;  4MON A;  4NBD A;  2E2J I;  2NVQ I;  3IX0 A;  3GTO I;  3CMA 1;  3CCV Z;  1I6H I;  4Y7N I;  4CL1 A;  3CCL 1;  1YIJ 1;  4E2Z A;  2VPY A;  1RO4 A;  1Z01 A;  2O4H A;  1VQ7 Z;  3HOW I;  1QVG Y;  3IF8 A;  1YHQ 1;  4TNU A;  2M48 A;  1W2B Y;  4RV9 A;  1KD1 1;  1VQ8 1;  2E2I I;  4MD8 A;  3CCS Z;  1I50 I;  4BXX I;  3IR7 A;  2VUG A;  5IT9 b;  3GTM S;  4E33 A;  1N2F A;  3CCU 1;  4X6A I;  1K73 1;  1N8R 2;  4A3E I;  5CM2 M;  2JA6 I;  4A3B I;  5LL6 f;  3CCJ 1;  3CCE Z;  3G71 1;  1Q16 A;  4HGY A;  4NBB A;  1QVF Z;  3CD6 1;  3QWU A;  3CMA Z;  4E32 A;  2RHB A;  3CCL Z;  1YIJ Z;  4A3L I;  1RO0 A;  2VPX A;  2W03 A;  1KQS Z;  1YIT 1;  4RS4 A;  1M90 1;  1RNI A;  5D1O B;  5T67 A;  3GTP I;  1WCM I;  3GCF A;  3ESW A;  1YHQ Z;  2I3C A;  4BBR I;  1Q81 1;  1VQ8 Z;  2JUB A;  2R7Z I;  3J7A 4;  3TDH B;  3S16 I; 
#chains in the Genus database with same CATH homology
 2PK7 A;  3FKI I;  1VQO 1;  1Z02 A;  1TWH I;  3CCU Z;  1NP6 A;  3RZO I;  5C4J I;  5IP9 I;  2JA7 I;  1K8A 2;  1VQ4 1;  3GTM I;  1YJN 1;  1YJW 1;  3CCJ Z;  1X3W A;  3G71 Z;  4DQY B;  2F4M A;  4BBS I;  5A2Q b;  1VLA A;  2GU2 A;  1USP B;  3CD6 Z;  5T64 A;  5T6B A;  4A3M I;  2M6N A;  2JS4 A;  1M1K 2;  1KRL A;  4EWC A;  1KC8 1;  2YU9 I;  3S17 I;  1S72 1;  1YIT Z;  2HU9 A;  3CCQ 1;  2OTL 1;  1Y1V I;  1K83 I;  2VUM I;  2LFU A;  1YUK A;  1Q86 2;  2OOX B;  3H3V J;  2E2H I;  3VB9 A;  1VQL 1;  1Q82 2;  1RQF A;  5AN9 F;  2QRD B;  1X3Z A;  3VMH A;  1NJI 1;  5A2Q f;  1VQO Z;  2V8I A;  1QVG Z;  3CCR 1;  1W2B Z;  4NBH A;  1VQ4 Z;  1SFO I;  1YJN Z;  3FQM A;  1YJW Z;  2WB1 A;  4A3G I;  1TWC I;  3I4M I;  3FQQ A;  2G2K A;  2IZ4 A;  3CC4 1;  2JA5 I;  1USP A;  1K9M 2;  3MZK B;  3GTJ I;  1VQP 1;  2QLV B;  2RIQ A;  4A93 I;  2DE6 A;  1S72 Z;  3MZL B;  3CCQ Z;  2OTL Z;  2NVX I;  2PM9 A;  3HOV I;  1I3Q I;  1TFI A;  1WW9 A;  3I55 1;  1VQL Z;  4HH4 A;  2EGT A;  4NBC A;  1WII A;  3GTQ I;  4S1T A;  1Q7Y 2;  4QTU A;  2V8K A;  1Y1V S;  2QEX 1;  3LUS A;  3MON A;  3CCR Z;  3PO3 S;  3H0G I;  1P9N A;  4RVD A;  5FLM I;  2RPR A;  1JJ2 Y;  2LIY A;  4NFR A;  3CPW Z;  1YUA A;  2R93 I;  3F3P C;  4HGZ A;  2JR6 A;  1RO2 A;  3NH8 A;  3CC4 Z;  4A3I I;  3S2H I;  4E2X A;  1TWG I;  1QVF Y;  2K5R A;  3CC2 1;  1VQN 1;  1VQP Z;  2F4O A;  2RBL A;  2OTJ 1;  3J80 b;  1K8A 1;  1YJ9 1;  1KQS Y;  2KPI A;  2QRE B;  4XX2 A;  3I55 Z;  4MH4 A;  2QA4 1;  3S2D I;  1Z03 A;  2E9H A;  2JNY A;  2VF1 A;  3OW2 Z;  2J6A A;  2WAQ A;  3HOY I;  4MXU A;  3GTG I;  4A3F I;  4E30 A;  2QEX Z;  4E31 A;  3CXC Y;  1M1K 1;  2R6M A;  1DL6 A;  3KIH A;  4NB9 A;  3J80 f;  3PO3 I;  1Q86 1;  3S1N I;  4NBF A;  1Q82 1;  1NUI A;  3VMI A;  2QKD A;  1PFT A;  2YAD A;  3CC2 Z;  3J81 f;  1VQN Z;  2OTJ Z;  2GTI A;  2RT9 A;  1LQL A;  2PMZ A;  4RVG A;  1YJ9 Z;  1ML8 A;  3KIF A;  3D9X A;  2GTH A;  3RZD I;  2P3Y A;  4Y52 I;  5D1P A;  3I56 1;  1X0T A;  2QA4 Z;  1ZB8 A;  1NJI 2;  1VQM 1;  3HKZ A;  2O53 A;  1JWH C;  1YI2 1;  4MD7 A;  1VQK 1;  5C3E I;  2P28 A;  1ZB9 A;  2Q51 A;  1S7M A;  3U50 C;  3CME 1;  3GKQ A;  1K9M 1;  4A3K I;  4MD9 A;  1R9T I;  1QF8 A;  4NBE A;  3G4S 1;  1N8R 1;  4DGL A;  5C44 I;  2ZAE B;  5FLX b;  4NOZ A;  4A3D I;  1KD1 2;  1VQ9 1;  2QRC B;  4NBG A;  3EER A;  3GTL I;  3JAM b;  3M4O I;  3NH5 A;  1ZH1 A;  2V8J A;  1Q7Y 1;  1K73 2;  1JJ2 Z;  3NH4 A;  4BY1 I;  4QTT A;  3EED A;  3VMG A;  3M3Y I;  3CCM 1;  2KI7 B;  4NBA A;  3I56 Z;  5FLX f;  1VQM Z;  2Q4Z A;  3CC7 1;  1YI2 Z;  2DE5 A;  3CQZ I;  1RLY A;  3S1M I;  1VQK Z;  1VQ5 1;  2IZ3 A;  3G6E 1;  3CME Z;  3S1Q I;  5IT9 f;  3JAM f;  5IP7 I;  1VQ6 1;  3GTK I;  2JMO A;  1M90 2;  2OZK A;  2NVY I;  4NH1 C;  2DE7 A;  3G4S Z;  3HOZ I;  5C4X I;  2Y0S A;  4A3C I;  2OOY B;  3HOX I;  1Q81 2;  1VQ9 Z;  2JA8 I;  2HF1 A;  3NDI A;  3IFU A;  3CXC Z;  2R92 I;  3CPW Y;  3CCV 1;  3J81 b;  2QR1 B;  3NFZ A;  3TE5 B;  3HOU I;  3NDJ A;  4BY7 I;  1Y1W I;  4A3J I;  3T4N B;  1VQ7 1;  3F3F C;  3CCM Z;  2B63 I;  4DK1 A;  2W04 A;  4MRI A;  3S14 I;  1L1O C;  2H85 A;  1TWF I;  3CCS 1;  3Q87 A;  3BG1 B;  3CC7 Z;  4E2Y A;  1VQ5 Z;  3P5J B;  3G6E Z;  3OW2 Y;  4E2W A;  3S1R I;  1KC8 2;  1VQ6 Z;  3K7A I;  1QYP A;  2AKL A;  3D6W A;  3VTN A;  3I4N I;  4RVF A;  4AYB A;  2NVT I;  3CCE 1;  3PO2 I;  4NB8 A;  1TWA I;  5D1O A;  2K3R A;  2BJO A;  4RVH A;  3S15 I;  3I07 A;  3BG0 B;  4MON A;  4NBD A;  2E2J I;  2NVQ I;  3IX0 A;  3GTO I;  3CMA 1;  3CCV Z;  1I6H I;  4Y7N I;  4CL1 A;  3CCL 1;  1YIJ 1;  4E2Z A;  1RO4 A;  1Z01 A;  2O4H A;  1VQ7 Z;  3HOW I;  1QVG Y;  3IF8 A;  1YHQ 1;  4TNU A;  2M48 A;  1W2B Y;  4RV9 A;  1KD1 1;  1VQ8 1;  2E2I I;  4MD8 A;  3CCS Z;  1I50 I;  4BXX I;  2VUG A;  5IT9 b;  3GTM S;  4E33 A;  1N2F A;  3CCU 1;  4X6A I;  1K73 1;  1N8R 2;  4A3E I;  5CM2 M;  2JA6 I;  4A3B I;  5LL6 f;  3CCJ 1;  3CCE Z;  3G71 1;  4HGY A;  4NBB A;  1QVF Z;  3CD6 1;  3QWU A;  3CMA Z;  4E32 A;  2RHB A;  3CCL Z;  1YIJ Z;  4A3L I;  1RO0 A;  2W03 A;  1KQS Z;  1YIT 1;  4RS4 A;  1M90 1;  1RNI A;  5D1O B;  5T67 A;  3GTP I;  1WCM I;  3GCF A;  3ESW A;  1YHQ Z;  2I3C A;  4BBR I;  1Q81 1;  1VQ8 Z;  2JUB A;  2R7Z I;  3J7A 4;  3TDH B;  3S16 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...