2NVQI

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI02
3I4MI 3H3VJ 3S2HI 3VB9A 4Y52I 2KPIA 2R93I 3GTJI 5C44I 1WW9A 3GTMI 1WCMI 2AKLA 2E2HI 1K83I 2P3YA 3S16I 2NVYI 3ESWA 3K7AI 1X3ZA 3S1QI 1Y1VI 5FLMI 1SFOI 3CQZI 1ML8A 1TWAI 1USPA 3H0GI 3GTGI 3GTKI 3I4NI 5C4XI 1N2FA 2F4OA 3HOWI 2JA8I 3EERA 2JA6I 4NBEA 1I3QI 3S15I 4A3DI 3GKQA 4A3II 3PO3I 3PO2I 3S1RI 4A3BI 4NB8A 4MH4A 1R9TI 2DE5A 1TWFI 4NOZA 3VMIA 1TWGI 2JA7I 4NBHA 3FKII 1VLAA 4BXXI 4A3EI 3GTPI 2K5RA 4NB9A 1X3WA 5C3EI 4A3MI 2F4MA 1QYPA 4NBCA 3HOZI 1ZB9A 5IP9I 3Q87A 1TWCI 3RZOI 2DE7A 4XX2A 1LQLA 1RLYA 4BBRI 3GTMS 3RZDI 2VUMI 4NBGA 2BJOA 1Y1VS 2JR6A 2YU9I 3GCFA 2R92I 3HOUI 3HOVI 3GTOI 2JNYA 4NBBA 1USPB 4BY7I 3M4OI 2NVTI 2PK7A 1L1OC 2J6AA 4NBAA 3GTQI 3VMGA 2JS4A 1NUIA 2E2JI 2DE6A 1TFIA 3PO3S 4A93I 2NVQI 1TWHI 3S1NI 4A3GI 4NBDA 1ZB8A 4QTTA 1YUAA 1PFTA 3S17I 5C4JI 2B63I 4NBFA 1RO4A 2JA5I 1DL6A 1Y1WI 3S14I 4Y7NI 4BBSI 4QTUA 1I6HI 4A3JI 3M3YI 1I50I 3D6WA 3VMHA 4BY1I 3HOYI 5IP7I 3S1MI 3I07A 4A3KI 2E2II 2NVXI 3LUSA 4A3FI 5CM2M 3S2DI 2R7ZI 2HF1A 4X6AI 3HOXI 4A3LI 4A3CI 2RBLA 3U50C 3GTLI
chains in the Genus database with same CATH superfamily
3I4MI 3VB9A 3CCQ1 3CCE1 4Y52I 2KPIA 2R93I 2JUBA 5FLXf 3CCR1 2P3YA 1VQP1 1NJI2 2NVYI 3K7AI 1X3ZA 3S1QI 2QEX1 3CQZI 3VTNA 3OW2Y 3H0GI 1Z02A 4RVGA 3P5JB 3I4NI 5T6BA 3IR7A 2F4OA 1YI2Z 1K8A2 2E9HA 4NBEA 1VQ51 4A3II 1VQ41 3S1RI 1R9TI 3CCVZ 2IZ3A 3VMIA 1VQ7Z 5D1PA 3NH8A 3J80f 3CCMZ 2QRCB 4BXXI 2QREB 4A3EI 1YJW1 2O53A 3IF8A 2VPWA 2OTJ1 2WAQA 5C3EI 2F4MA 4NBCA 1ZB9A 1VQ6Z 3CXCZ 4TNUA 1KD12 5T67A 2LEXA 4BBRI 1YI21 4E30A 1VQKZ 3HOVI 3GTOI 3QWUA 2OTL1 3G71Z 3CCV1 1USPB 2VF1A 4EWCA 1K9M1 1VQ71 2NVTI 1VQL1 1L1OC 3TE5B 2Q4ZA 3T4NB 3CCM1 4DQYB 1Y8CA 2AYDA 2QLVB 3PO3S 2NVQI 2QA4Z 3S1NI 4A3GI 3NFZA 1FDOA 5A2Qf 1PFTA 1P9NA 1W2BZ 5C4JI 1DL6A 2JA5I 5D1OB 1I6HI 1I50I 3D6WA 1YIT1 1YIJZ 1JJ2Z 3NDIA 3VMHA 4BY1I 1Q16A 1Q821 1S72Z 3S1MI 2IZ4A 1VQK1 4E2XA 5CM2M 2OZKA 3G711 3FQQA 2PM9A 2OOXB 2JMOA 3CMAZ 3NDJA 2ZAEB 2JIRA 3GTJI 5C44I 3GTMI 1WCMI 3MZLB 4E2YA 3CC41 2QA41 1K83I 1QVFY 3ESWA 2O4HA 4E2WA 1Y1VI 1SFOI 1ML8A 1Q812 1USPA 3F3PC 4NFRA 1VQ9Z 1WIIA 5LL6f 1YIJ1 3HOWI 1S721 3S15I 4A3DI 1RO2A 3PO2I 5D1OA 1Q7Y2 3CMA1 1TWGI 1KC82 2JA7I 2V3VA 1K731 2I3CA 3GTPI 2V45A 3KIHA 1M1K2 3G6EZ 3CCJZ 4A3MI 1RQFA 1K8A1 1X0TA 5IP9I 1Q862 1RNIA 1VQ91 3HKZA 1TWCI 2GU2A 2DE7A 2JIMA 3G4SZ 4NBGA 1N8R2 1M901 2H85A 2VUGA 3GCFA 3HOUI 4HGZA 1QVGY 2VPZA 4NBBA 5IT9b 2PK7A 2J6AA 4MD7A 4CL1A 1Z01A 2E2JI 3D9XA 3CCJ1 3CCUZ 1YUAA 2GTIA 1Z03A 1RO4A 4BBSI 4S1TA 2IV2X 3G4S1 4RVHA 4RVFA 3MONA 3FQMA 4A3FI 2QRDB 3S2DI 2R7ZI 5AN9F 3J81f 1FDIA 3CCLZ 3U50C 3S2HI 4DGLA 1AA6A 2AKLA 1VQ61 3CCU1 4E32A 1KQSZ 3CMEZ 3BG0B 3GTKI 1K9M2 1VQ8Z 2JIOA 2P28A 2W03A 5C4XI 3CXCY 3PO3I 4MRIA 4NB8A 4HGYA 1YHQZ 2RIQA 1WJ2A 1TWFI 4NOZA 3J80b 3FKII 3D2LA 2K5RA 3J7A4 3OW2Z 5IT9f 3CC2Z 1Q822 3I56Z 3HOZI 1NP6A 3CME1 3RZOI 1VQ81 2GTHA 4XX2A 1LQLA 1W2BY 1Q7Y1 4AYBA 4DK1A 3RZDI 1KC81 1NJI1 2VUMI 2M6NA 3IFUA 2JR6A 2Y0SA 2V8JA 4MD8A 3I55Z 2LIYA 1YJNZ 1JJ2Y 4BY7I 2YADA 1VQ5Z 4NBAA 3GTQI 2JS4A 1NUIA 2DE6A 1TFIA 3CC21 1ZB8A 4NBDA 4QTTA 3S17I 3I561 1YJ9Z 1N8R1 1YJWZ 3S14I 2OTJZ 4QTUA 4MXUA 4A3JI 4MD9A 1K732 3CPWZ 3HOYI 5IP7I 4A3KI 3CC7Z 3BG1B 2LFUA 2E2II 3I551 1YJN1 1KD11 4X6AI 3HOXI 4A3CI 2RHBA 2RBLA 3CD6Z 3JAMb 3GTLI 3G6E1 3H3VJ 2OTLZ 2KI7B 1WW9A 1S7MA 3IX0A 4NH1C 3NH5A 2E2HI 2HU9A 3CCSZ 1VQOZ 3S16I 1VQLZ 1YJ91 1M902 2RPRA 5FLMI 1WZNA 1TWAI 4HH4A 3GTGI 1VQNZ 2RT9A 1N2FA 2NAPA 4E33A 2JA8I 3EERA 2JA6I 1I3QI 3CC71 3GKQA 4A3BI 1YITZ 4MH4A 5FLXb 2DE5A 1QVFZ 3CD61 4NBHA 1VLAA 4RV9A 3CPWY 3CCS1 4NB9A 1X3WA 3NH4A 1VQO1 4RVDA 2OOYB 2V8IA 1QYPA 2W04A 4RS4A 3Q87A 3CC4Z 1VQMZ 3F3FC 3TDHB 3MZKB 1VQN1 3GTMS 1RLYA 2VPXA 2JIQA 2K3RA 2BJOA 2JIPA 1Y1VS 4E31A 3CCL1 2YU9I 2R92I 1Q811 2G2KA 2JNYA 2V8KA 3EEDA 2Q51A 2R6MA 3M4OI 2EGTA 1YUKA 3KIFA 2VPYA 3CCQZ 3CCEZ 2QKDA 3VMGA 2QR1B 1JWHC 4A93I 1TWHI 1KRLA 3CCRZ 1VQPZ 2E7ZA 2M48A 1QXFA 3JAMf 4E2ZA 2B63I 4NBFA 2QEXZ 1Y1WI 4Y7NI 1VQM1 3M3YI 1QVGZ 1ZH1A 1M1K1 4MONA 1KQSY 1RO0A 1YHQ1 1SIWA 3I07A 1VQ4Z 1Q861 2NVXI 3LUSA 5T64A 3J81b 2HF1A 2PMZA 4A3LI 5A2Qb 1QF8A 2WB1A
chains in the Genus database with same CATH topology
3I4MI 3VB9A 3CCQ1 3CCE1 4Y52I 2KPIA 2R93I 2JUBA 5FLXf 3CCR1 2P3YA 1VQP1 1NJI2 2NVYI 3K7AI 1X3ZA 3S1QI 2QEX1 3CQZI 3VTNA 3OW2Y 3H0GI 1Z02A 4RVGA 3P5JB 3I4NI 5T6BA 2F4OA 1YI2Z 1K8A2 2E9HA 4NBEA 1VQ51 4A3II 1VQ41 3S1RI 1R9TI 3CCVZ 2IZ3A 3VMIA 1VQ7Z 5D1PA 3NH8A 3J80f 3CCMZ 2QRCB 4BXXI 2QREB 4A3EI 1YJW1 2O53A 3IF8A 2OTJ1 2WAQA 5C3EI 2F4MA 4NBCA 1ZB9A 1VQ6Z 3CXCZ 4TNUA 1KD12 5T67A 4BBRI 1YI21 4E30A 1VQKZ 3HOVI 3GTOI 3QWUA 2OTL1 3G71Z 3CCV1 1USPB 2VF1A 4EWCA 1K9M1 1VQ71 2NVTI 1VQL1 1L1OC 3TE5B 2Q4ZA 3T4NB 3CCM1 4DQYB 2QLVB 3PO3S 2NVQI 2QA4Z 3S1NI 4A3GI 3NFZA 5A2Qf 1PFTA 1P9NA 1W2BZ 5C4JI 1DL6A 2JA5I 5D1OB 1I6HI 1I50I 3D6WA 1YIT1 1YIJZ 1JJ2Z 3NDIA 3VMHA 4BY1I 1Q821 1S72Z 3S1MI 2IZ4A 1VQK1 4E2XA 5CM2M 2OZKA 3G711 3FQQA 2PM9A 2OOXB 2JMOA 3CMAZ 3NDJA 2ZAEB 3GTJI 5C44I 3GTMI 1WCMI 3MZLB 4E2YA 3CC41 2QA41 1K83I 1QVFY 3ESWA 2O4HA 4E2WA 1Y1VI 1SFOI 1ML8A 1Q812 1USPA 3F3PC 4NFRA 1VQ9Z 1WIIA 5LL6f 1YIJ1 3HOWI 1S721 3S15I 4A3DI 1RO2A 3PO2I 5D1OA 1Q7Y2 3CMA1 1TWGI 1KC82 2JA7I 1K731 2I3CA 3GTPI 3KIHA 1M1K2 3G6EZ 3CCJZ 4A3MI 1RQFA 1K8A1 1X0TA 5IP9I 1Q862 1RNIA 1VQ91 3HKZA 1TWCI 2GU2A 2DE7A 3G4SZ 4NBGA 1N8R2 1M901 2H85A 2VUGA 3GCFA 3HOUI 4HGZA 1QVGY 4NBBA 5IT9b 2PK7A 2J6AA 4MD7A 4CL1A 1Z01A 2E2JI 3D9XA 3CCJ1 3CCUZ 1YUAA 2GTIA 1Z03A 1RO4A 4BBSI 4S1TA 3G4S1 4RVHA 4RVFA 3MONA 3FQMA 4A3FI 2QRDB 3S2DI 2R7ZI 5AN9F 3J81f 3CCLZ 3U50C 3S2HI 4DGLA 2AKLA 1VQ61 3CCU1 4E32A 1KQSZ 3CMEZ 3BG0B 3GTKI 1K9M2 1VQ8Z 2P28A 2W03A 5C4XI 3CXCY 3PO3I 4MRIA 4NB8A 4HGYA 1YHQZ 2RIQA 1TWFI 4NOZA 3J80b 3FKII 2K5RA 3J7A4 3OW2Z 5IT9f 3CC2Z 1Q822 3I56Z 3HOZI 1NP6A 3CME1 3RZOI 1VQ81 2GTHA 4XX2A 1LQLA 1W2BY 1Q7Y1 4AYBA 4DK1A 3RZDI 1KC81 1NJI1 2VUMI 2M6NA 3IFUA 2JR6A 2Y0SA 2V8JA 4MD8A 3I55Z 2LIYA 1YJNZ 1JJ2Y 4BY7I 2YADA 1VQ5Z 4NBAA 3GTQI 2JS4A 1NUIA 2DE6A 1TFIA 3CC21 1ZB8A 4NBDA 4QTTA 3S17I 3I561 1YJ9Z 1N8R1 1YJWZ 3S14I 2OTJZ 4QTUA 4MXUA 4A3JI 4MD9A 1K732 3CPWZ 3HOYI 5IP7I 4A3KI 3CC7Z 3BG1B 2LFUA 2E2II 3I551 1YJN1 1KD11 4X6AI 3HOXI 4A3CI 2RHBA 2RBLA 3CD6Z 3JAMb 3GTLI 3G6E1 3H3VJ 2OTLZ 2KI7B 1WW9A 1S7MA 3IX0A 4NH1C 3NH5A 2E2HI 2HU9A 3CCSZ 1VQOZ 3S16I 1VQLZ 1YJ91 1M902 2RPRA 5FLMI 1TWAI 4HH4A 3GTGI 1VQNZ 2RT9A 1N2FA 4E33A 2JA8I 3EERA 2JA6I 1I3QI 3CC71 3GKQA 4A3BI 1YITZ 4MH4A 5FLXb 2DE5A 1QVFZ 3CD61 4NBHA 1VLAA 4RV9A 3CPWY 3CCS1 4NB9A 1X3WA 3NH4A 1VQO1 4RVDA 2OOYB 2V8IA 1QYPA 2W04A 4RS4A 3Q87A 3CC4Z 1VQMZ 3F3FC 3TDHB 3MZKB 1VQN1 3GTMS 1RLYA 2K3RA 2BJOA 1Y1VS 4E31A 3CCL1 2YU9I 2R92I 1Q811 2G2KA 2JNYA 2V8KA 3EEDA 2Q51A 2R6MA 3M4OI 2EGTA 1YUKA 3KIFA 3CCQZ 3CCEZ 2QKDA 3VMGA 2QR1B 1JWHC 4A93I 1TWHI 1KRLA 3CCRZ 1VQPZ 2M48A 3JAMf 4E2ZA 2B63I 4NBFA 2QEXZ 1Y1WI 4Y7NI 1VQM1 3M3YI 1QVGZ 1ZH1A 1M1K1 4MONA 1KQSY 1RO0A 1YHQ1 3I07A 1VQ4Z 1Q861 2NVXI 3LUSA 5T64A 3J81b 2HF1A 2PMZA 4A3LI 5A2Qb 1QF8A 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4M I;  3H3V J;  3S2H I;  3VB9 A;  4Y52 I;  2KPI A;  2R93 I;  3GTJ I;  5C44 I;  1WW9 A;  3GTM I;  1WCM I;  2AKL A;  2E2H I;  1K83 I;  2P3Y A;  3S16 I;  2NVY I;  3ESW A;  3K7A I;  1X3Z A;  3S1Q I;  1Y1V I;  5FLM I;  1SFO I;  3CQZ I;  1ML8 A;  1TWA I;  1USP A;  3H0G I;  3GTG I;  3GTK I;  3I4N I;  5C4X I;  1N2F A;  2F4O A;  3HOW I;  2JA8 I;  3EER A;  2JA6 I;  4NBE A;  1I3Q I;  3S15 I;  4A3D I;  3GKQ A;  4A3I I;  3PO3 I;  3PO2 I;  3S1R I;  4A3B I;  4NB8 A;  4MH4 A;  1R9T I;  2DE5 A;  1TWF I;  4NOZ A;  3VMI A;  1TWG I;  2JA7 I;  4NBH A;  3FKI I;  1VLA A;  4BXX I;  4A3E I;  3GTP I;  2K5R A;  4NB9 A;  1X3W A;  5C3E I;  4A3M I;  2F4M A;  1QYP A;  4NBC A;  3HOZ I;  1ZB9 A;  5IP9 I;  3Q87 A;  1TWC I;  3RZO I;  2DE7 A;  4XX2 A;  1LQL A;  1RLY A;  4BBR I;  3GTM S;  3RZD I;  2VUM I;  4NBG A;  2BJO A;  1Y1V S;  2JR6 A;  2YU9 I;  3GCF A;  2R92 I;  3HOU I;  3HOV I;  3GTO I;  2JNY A;  4NBB A;  1USP B;  4BY7 I;  3M4O I;  2NVT I;  2PK7 A;  1L1O C;  2J6A A;  4NBA A;  3GTQ I;  3VMG A;  2JS4 A;  1NUI A;  2E2J I;  2DE6 A;  1TFI A;  3PO3 S;  4A93 I;  2NVQ I;  1TWH I;  3S1N I;  4A3G I;  4NBD A;  1ZB8 A;  4QTT A;  1YUA A;  1PFT A;  3S17 I;  5C4J I;  2B63 I;  4NBF A;  1RO4 A;  2JA5 I;  1DL6 A;  1Y1W I;  3S14 I;  4Y7N I;  4BBS I;  4QTU A;  1I6H I;  4A3J I;  3M3Y I;  1I50 I;  3D6W A;  3VMH A;  4BY1 I;  3HOY I;  5IP7 I;  3S1M I;  3I07 A;  4A3K I;  2E2I I;  2NVX I;  3LUS A;  4A3F I;  5CM2 M;  3S2D I;  2R7Z I;  2HF1 A;  4X6A I;  3HOX I;  4A3L I;  4A3C I;  2RBL A;  3U50 C;  3GTL I; 
#chains in the Genus database with same CATH topology
 3I4M I;  3VB9 A;  3CCQ 1;  3CCE 1;  4Y52 I;  2KPI A;  2R93 I;  2JUB A;  5FLX f;  3CCR 1;  2P3Y A;  1VQP 1;  1NJI 2;  2NVY I;  3K7A I;  1X3Z A;  3S1Q I;  2QEX 1;  3CQZ I;  3VTN A;  3OW2 Y;  3H0G I;  1Z02 A;  4RVG A;  3P5J B;  3I4N I;  5T6B A;  3IR7 A;  2F4O A;  1YI2 Z;  1K8A 2;  2E9H A;  4NBE A;  1VQ5 1;  4A3I I;  1VQ4 1;  3S1R I;  1R9T I;  3CCV Z;  2IZ3 A;  3VMI A;  1VQ7 Z;  5D1P A;  3NH8 A;  3J80 f;  3CCM Z;  2QRC B;  4BXX I;  2QRE B;  4A3E I;  1YJW 1;  2O53 A;  3IF8 A;  2VPW A;  2OTJ 1;  2WAQ A;  5C3E I;  2F4M A;  4NBC A;  1ZB9 A;  1VQ6 Z;  3CXC Z;  4TNU A;  1KD1 2;  5T67 A;  2LEX A;  4BBR I;  1YI2 1;  4E30 A;  1VQK Z;  3HOV I;  3GTO I;  3QWU A;  2OTL 1;  3G71 Z;  3CCV 1;  1USP B;  2VF1 A;  4EWC A;  1K9M 1;  1VQ7 1;  2NVT I;  1VQL 1;  1L1O C;  3TE5 B;  2Q4Z A;  3T4N B;  3CCM 1;  4DQY B;  1Y8C A;  2AYD A;  2QLV B;  3PO3 S;  2NVQ I;  2QA4 Z;  3S1N I;  4A3G I;  3NFZ A;  1FDO A;  5A2Q f;  1PFT A;  1P9N A;  1W2B Z;  5C4J I;  1DL6 A;  2JA5 I;  5D1O B;  1I6H I;  1I50 I;  3D6W A;  1YIT 1;  1YIJ Z;  1JJ2 Z;  3NDI A;  3VMH A;  4BY1 I;  1Q16 A;  1Q82 1;  1S72 Z;  3S1M I;  2IZ4 A;  1VQK 1;  4E2X A;  5CM2 M;  2OZK A;  3G71 1;  3FQQ A;  2PM9 A;  2OOX B;  2JMO A;  3CMA Z;  3NDJ A;  2ZAE B;  2JIR A;  3GTJ I;  5C44 I;  3GTM I;  1WCM I;  3MZL B;  4E2Y A;  3CC4 1;  2QA4 1;  1K83 I;  1QVF Y;  3ESW A;  2O4H A;  4E2W A;  1Y1V I;  1SFO I;  1ML8 A;  1Q81 2;  1USP A;  3F3P C;  4NFR A;  1VQ9 Z;  1WII A;  5LL6 f;  1YIJ 1;  3HOW I;  1S72 1;  3S15 I;  4A3D I;  1RO2 A;  3PO2 I;  5D1O A;  1Q7Y 2;  3CMA 1;  1TWG I;  1KC8 2;  2JA7 I;  2V3V A;  1K73 1;  2I3C A;  3GTP I;  2V45 A;  3KIH A;  1M1K 2;  3G6E Z;  3CCJ Z;  4A3M I;  1RQF A;  1K8A 1;  1X0T A;  5IP9 I;  1Q86 2;  1RNI A;  1VQ9 1;  3HKZ A;  1TWC I;  2GU2 A;  2DE7 A;  2JIM A;  3G4S Z;  4NBG A;  1N8R 2;  1M90 1;  2H85 A;  2VUG A;  3GCF A;  3HOU I;  4HGZ A;  1QVG Y;  2VPZ A;  4NBB A;  5IT9 b;  2PK7 A;  2J6A A;  4MD7 A;  4CL1 A;  1Z01 A;  2E2J I;  3D9X A;  3CCJ 1;  3CCU Z;  1YUA A;  2GTI A;  1Z03 A;  1RO4 A;  4BBS I;  4S1T A;  2IV2 X;  3G4S 1;  4RVH A;  4RVF A;  3MON A;  3FQM A;  4A3F I;  2QRD B;  3S2D I;  2R7Z I;  5AN9 F;  3J81 f;  1FDI A;  3CCL Z;  3U50 C;  3S2H I;  4DGL A;  1AA6 A;  2AKL A;  1VQ6 1;  3CCU 1;  4E32 A;  1KQS Z;  3CME Z;  3BG0 B;  3GTK I;  1K9M 2;  1VQ8 Z;  2JIO A;  2P28 A;  2W03 A;  5C4X I;  3CXC Y;  3PO3 I;  4MRI A;  4NB8 A;  4HGY A;  1YHQ Z;  2RIQ A;  1WJ2 A;  1TWF I;  4NOZ A;  3J80 b;  3FKI I;  3D2L A;  2K5R A;  3J7A 4;  3OW2 Z;  5IT9 f;  3CC2 Z;  1Q82 2;  3I56 Z;  3HOZ I;  1NP6 A;  3CME 1;  3RZO I;  1VQ8 1;  2GTH A;  4XX2 A;  1LQL A;  1W2B Y;  1Q7Y 1;  4AYB A;  4DK1 A;  3RZD I;  1KC8 1;  1NJI 1;  2VUM I;  2M6N A;  3IFU A;  2JR6 A;  2Y0S A;  2V8J A;  4MD8 A;  3I55 Z;  2LIY A;  1YJN Z;  1JJ2 Y;  4BY7 I;  2YAD A;  1VQ5 Z;  4NBA A;  3GTQ I;  2JS4 A;  1NUI A;  2DE6 A;  1TFI A;  3CC2 1;  1ZB8 A;  4NBD A;  4QTT A;  3S17 I;  3I56 1;  1YJ9 Z;  1N8R 1;  1YJW Z;  3S14 I;  2OTJ Z;  4QTU A;  4MXU A;  4A3J I;  4MD9 A;  1K73 2;  3CPW Z;  3HOY I;  5IP7 I;  4A3K I;  3CC7 Z;  3BG1 B;  2LFU A;  2E2I I;  3I55 1;  1YJN 1;  1KD1 1;  4X6A I;  3HOX I;  4A3C I;  2RHB A;  2RBL A;  3CD6 Z;  3JAM b;  3GTL I;  3G6E 1;  3H3V J;  2OTL Z;  2KI7 B;  1WW9 A;  1S7M A;  3IX0 A;  4NH1 C;  3NH5 A;  2E2H I;  2HU9 A;  3CCS Z;  1VQO Z;  3S16 I;  1VQL Z;  1YJ9 1;  1M90 2;  2RPR A;  5FLM I;  1WZN A;  1TWA I;  4HH4 A;  3GTG I;  1VQN Z;  2RT9 A;  1N2F A;  2NAP A;  4E33 A;  2JA8 I;  3EER A;  2JA6 I;  1I3Q I;  3CC7 1;  3GKQ A;  4A3B I;  1YIT Z;  4MH4 A;  5FLX b;  2DE5 A;  1QVF Z;  3CD6 1;  4NBH A;  1VLA A;  4RV9 A;  3CPW Y;  3CCS 1;  4NB9 A;  1X3W A;  3NH4 A;  1VQO 1;  4RVD A;  2OOY B;  2V8I A;  1QYP A;  2W04 A;  4RS4 A;  3Q87 A;  3CC4 Z;  1VQM Z;  3F3F C;  3TDH B;  3MZK B;  1VQN 1;  3GTM S;  1RLY A;  2VPX A;  2JIQ A;  2K3R A;  2BJO A;  2JIP A;  1Y1V S;  4E31 A;  3CCL 1;  2YU9 I;  2R92 I;  1Q81 1;  2G2K A;  2JNY A;  2V8K A;  3EED A;  2Q51 A;  2R6M A;  3M4O I;  2EGT A;  1YUK A;  3KIF A;  2VPY A;  3CCQ Z;  3CCE Z;  2QKD A;  3VMG A;  2QR1 B;  1JWH C;  4A93 I;  1TWH I;  1KRL A;  3CCR Z;  1VQP Z;  2E7Z A;  2M48 A;  1QXF A;  3JAM f;  4E2Z A;  2B63 I;  4NBF A;  2QEX Z;  1Y1W I;  4Y7N I;  1VQM 1;  3M3Y I;  1QVG Z;  1ZH1 A;  1M1K 1;  4MON A;  1KQS Y;  1RO0 A;  1YHQ 1;  1SIW A;  3I07 A;  1VQ4 Z;  1Q86 1;  2NVX I;  3LUS A;  5T64 A;  3J81 b;  2HF1 A;  2PMZ A;  4A3L I;  5A2Q b;  1QF8 A;  2WB1 A; 
#chains in the Genus database with same CATH homology
 3I4M I;  3VB9 A;  3CCQ 1;  3CCE 1;  4Y52 I;  2KPI A;  2R93 I;  2JUB A;  5FLX f;  3CCR 1;  2P3Y A;  1VQP 1;  1NJI 2;  2NVY I;  3K7A I;  1X3Z A;  3S1Q I;  2QEX 1;  3CQZ I;  3VTN A;  3OW2 Y;  3H0G I;  1Z02 A;  4RVG A;  3P5J B;  3I4N I;  5T6B A;  2F4O A;  1YI2 Z;  1K8A 2;  2E9H A;  4NBE A;  1VQ5 1;  4A3I I;  1VQ4 1;  3S1R I;  1R9T I;  3CCV Z;  2IZ3 A;  3VMI A;  1VQ7 Z;  5D1P A;  3NH8 A;  3J80 f;  3CCM Z;  2QRC B;  4BXX I;  2QRE B;  4A3E I;  1YJW 1;  2O53 A;  3IF8 A;  2OTJ 1;  2WAQ A;  5C3E I;  2F4M A;  4NBC A;  1ZB9 A;  1VQ6 Z;  3CXC Z;  4TNU A;  1KD1 2;  5T67 A;  4BBR I;  1YI2 1;  4E30 A;  1VQK Z;  3HOV I;  3GTO I;  3QWU A;  2OTL 1;  3G71 Z;  3CCV 1;  1USP B;  2VF1 A;  4EWC A;  1K9M 1;  1VQ7 1;  2NVT I;  1VQL 1;  1L1O C;  3TE5 B;  2Q4Z A;  3T4N B;  3CCM 1;  4DQY B;  2QLV B;  3PO3 S;  2NVQ I;  2QA4 Z;  3S1N I;  4A3G I;  3NFZ A;  5A2Q f;  1PFT A;  1P9N A;  1W2B Z;  5C4J I;  1DL6 A;  2JA5 I;  5D1O B;  1I6H I;  1I50 I;  3D6W A;  1YIT 1;  1YIJ Z;  1JJ2 Z;  3NDI A;  3VMH A;  4BY1 I;  1Q82 1;  1S72 Z;  3S1M I;  2IZ4 A;  1VQK 1;  4E2X A;  5CM2 M;  2OZK A;  3G71 1;  3FQQ A;  2PM9 A;  2OOX B;  2JMO A;  3CMA Z;  3NDJ A;  2ZAE B;  3GTJ I;  5C44 I;  3GTM I;  1WCM I;  3MZL B;  4E2Y A;  3CC4 1;  2QA4 1;  1K83 I;  1QVF Y;  3ESW A;  2O4H A;  4E2W A;  1Y1V I;  1SFO I;  1ML8 A;  1Q81 2;  1USP A;  3F3P C;  4NFR A;  1VQ9 Z;  1WII A;  5LL6 f;  1YIJ 1;  3HOW I;  1S72 1;  3S15 I;  4A3D I;  1RO2 A;  3PO2 I;  5D1O A;  1Q7Y 2;  3CMA 1;  1TWG I;  1KC8 2;  2JA7 I;  1K73 1;  2I3C A;  3GTP I;  3KIH A;  1M1K 2;  3G6E Z;  3CCJ Z;  4A3M I;  1RQF A;  1K8A 1;  1X0T A;  5IP9 I;  1Q86 2;  1RNI A;  1VQ9 1;  3HKZ A;  1TWC I;  2GU2 A;  2DE7 A;  3G4S Z;  4NBG A;  1N8R 2;  1M90 1;  2H85 A;  2VUG A;  3GCF A;  3HOU I;  4HGZ A;  1QVG Y;  4NBB A;  5IT9 b;  2PK7 A;  2J6A A;  4MD7 A;  4CL1 A;  1Z01 A;  2E2J I;  3D9X A;  3CCJ 1;  3CCU Z;  1YUA A;  2GTI A;  1Z03 A;  1RO4 A;  4BBS I;  4S1T A;  3G4S 1;  4RVH A;  4RVF A;  3MON A;  3FQM A;  4A3F I;  2QRD B;  3S2D I;  2R7Z I;  5AN9 F;  3J81 f;  3CCL Z;  3U50 C;  3S2H I;  4DGL A;  2AKL A;  1VQ6 1;  3CCU 1;  4E32 A;  1KQS Z;  3CME Z;  3BG0 B;  3GTK I;  1K9M 2;  1VQ8 Z;  2P28 A;  2W03 A;  5C4X I;  3CXC Y;  3PO3 I;  4MRI A;  4NB8 A;  4HGY A;  1YHQ Z;  2RIQ A;  1TWF I;  4NOZ A;  3J80 b;  3FKI I;  2K5R A;  3J7A 4;  3OW2 Z;  5IT9 f;  3CC2 Z;  1Q82 2;  3I56 Z;  3HOZ I;  1NP6 A;  3CME 1;  3RZO I;  1VQ8 1;  2GTH A;  4XX2 A;  1LQL A;  1W2B Y;  1Q7Y 1;  4AYB A;  4DK1 A;  3RZD I;  1KC8 1;  1NJI 1;  2VUM I;  2M6N A;  3IFU A;  2JR6 A;  2Y0S A;  2V8J A;  4MD8 A;  3I55 Z;  2LIY A;  1YJN Z;  1JJ2 Y;  4BY7 I;  2YAD A;  1VQ5 Z;  4NBA A;  3GTQ I;  2JS4 A;  1NUI A;  2DE6 A;  1TFI A;  3CC2 1;  1ZB8 A;  4NBD A;  4QTT A;  3S17 I;  3I56 1;  1YJ9 Z;  1N8R 1;  1YJW Z;  3S14 I;  2OTJ Z;  4QTU A;  4MXU A;  4A3J I;  4MD9 A;  1K73 2;  3CPW Z;  3HOY I;  5IP7 I;  4A3K I;  3CC7 Z;  3BG1 B;  2LFU A;  2E2I I;  3I55 1;  1YJN 1;  1KD1 1;  4X6A I;  3HOX I;  4A3C I;  2RHB A;  2RBL A;  3CD6 Z;  3JAM b;  3GTL I;  3G6E 1;  3H3V J;  2OTL Z;  2KI7 B;  1WW9 A;  1S7M A;  3IX0 A;  4NH1 C;  3NH5 A;  2E2H I;  2HU9 A;  3CCS Z;  1VQO Z;  3S16 I;  1VQL Z;  1YJ9 1;  1M90 2;  2RPR A;  5FLM I;  1TWA I;  4HH4 A;  3GTG I;  1VQN Z;  2RT9 A;  1N2F A;  4E33 A;  2JA8 I;  3EER A;  2JA6 I;  1I3Q I;  3CC7 1;  3GKQ A;  4A3B I;  1YIT Z;  4MH4 A;  5FLX b;  2DE5 A;  1QVF Z;  3CD6 1;  4NBH A;  1VLA A;  4RV9 A;  3CPW Y;  3CCS 1;  4NB9 A;  1X3W A;  3NH4 A;  1VQO 1;  4RVD A;  2OOY B;  2V8I A;  1QYP A;  2W04 A;  4RS4 A;  3Q87 A;  3CC4 Z;  1VQM Z;  3F3F C;  3TDH B;  3MZK B;  1VQN 1;  3GTM S;  1RLY A;  2K3R A;  2BJO A;  1Y1V S;  4E31 A;  3CCL 1;  2YU9 I;  2R92 I;  1Q81 1;  2G2K A;  2JNY A;  2V8K A;  3EED A;  2Q51 A;  2R6M A;  3M4O I;  2EGT A;  1YUK A;  3KIF A;  3CCQ Z;  3CCE Z;  2QKD A;  3VMG A;  2QR1 B;  1JWH C;  4A93 I;  1TWH I;  1KRL A;  3CCR Z;  1VQP Z;  2M48 A;  3JAM f;  4E2Z A;  2B63 I;  4NBF A;  2QEX Z;  1Y1W I;  4Y7N I;  1VQM 1;  3M3Y I;  1QVG Z;  1ZH1 A;  1M1K 1;  4MON A;  1KQS Y;  1RO0 A;  1YHQ 1;  3I07 A;  1VQ4 Z;  1Q86 1;  2NVX I;  3LUS A;  5T64 A;  3J81 b;  2HF1 A;  2PMZ A;  4A3L I;  5A2Q b;  1QF8 A;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...