2NVQI

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI02
1TWHI 4A3EI 2P3YA 1Y1VS 4BXXI 2JR6A 3HOZI 2VUMI 3CQZI 1I3QI 3U50C 1SFOI 2K5RA 2JS4A 3VMHA 2AKLA 2J6AA 4NOZA 5C4JI 2NVTI 5IP9I 4NBFA 4A3DI 3RZDI 1TWCI 2NVQI 3S15I 4A3LI 3PO3S 1TWGI 1NUIA 1ML8A 2E2II 3S14I 3VMGA 4A3BI 1Y1WI 2R92I 2PK7A 5CM2M 3FKII 3S16I 2NVYI 3GTJI 1ZB9A 3S1RI 3GTPI 3HOUI 3S17I 2E2HI 3ESWA 4NBEA 3S1MI 2BJOA 1I50I 3K7AI 3H0GI 4NBHA 3PO2I 1I6HI 3GTGI 3S1QI 2B63I 1WCMI 3LUSA 4NBAA 3S2HI 1YUAA 3GTKI 4A3JI 1Y1VI 4NBGA 4BY1I 3S2DI 4A3CI 1K83I 4MH4A 2DE5A 3HOXI 3GTMS 3GKQA 2JNYA 2R7ZI 2YU9I 4BBRI 2R93I 2DE6A 1USPA 3I4NI 3D6WA 1ZB8A 3HOYI 2E2JI 3H3VJ 4A93I 3PO3I 2F4OA 5C4XI 2KPIA 3M3YI 4BY7I 4NBBA 1VLAA 2NVXI 2JA8I 4A3GI 3Q87A 4NB8A 4X6AI 3S1NI 1X3WA 4NBDA 3GTQI 1TFIA 3VB9A 2DE7A 1DL6A 4A3FI 4Y52I 1X3ZA 1WW9A 3VMIA 1N2FA 3GTMI 3I4MI 4Y7NI 1LQLA 5C44I 4NB9A 4A3KI 2JA7I 3GTLI 3I07A 3GTOI 5IP7I 4QTUA 1USPB 2RBLA 3HOWI 2JA6I 1RLYA 1RO4A 3GCFA 3RZOI 5C3EI 4A3MI 1QYPA 5FLMI 3M4OI 1PFTA 4QTTA 1TWFI 4NBCA 4A3II 2JA5I 2HF1A 1TWAI 4XX2A 3HOVI 4BBSI 1R9TI 2F4MA 3EERA 1L1OC
chains in the Genus database with same CATH superfamily
3CCJZ 1KC82 1Y1VS 2LFUA 2JR6A 5IT9f 3I56Z 1SFOI 2JS4A 2OZKA 4NOZA 3CC2Z 2JIMA 1VQ41 4NBFA 1VQK1 1ZH1A 3PO3S 1WJ2A 3VMGA 2JIOA 2R92I 2YADA 1N8R1 3S16I 2NVYI 2ZAEB 2JIQA 3S1RI 4HGZA 3MONA 3GTPI 1VQP1 2E2HI 3S1MI 1WZNA 4HGYA 1I50I 4NBHA 3G4SZ 1I6HI 3GTGI 3S1QI 3QWUA 1QF8A 2LIYA 4NBGA 1KD12 1VQLZ 1K83I 3I551 4MH4A 3HOXI 3GTMS 1Z03A 2Y0SA 2NAPA 1YHQZ 2JMOA 1P9NA 2VPXA 1JWHC 4A93I 1K731 2F4OA 2VUGA 2IV2X 5C4XI 1QVGY 2G2KA 2IZ4A 2JA8I 3CXCY 1VQO1 1NP6A 2WB1A 4NB8A 1X3WA 4NBDA 1RNIA 3NH4A 3VB9A 3IX0A 1KQSY 2GU2A 4E33A 4A3FI 4Y52I 1WW9A 2RT9A 2Q51A 4NFRA 3BG1B 4Y7NI 3F3FC 3G6EZ 3CPWZ 1Z01A 5C44I 1Q821 1Z02A 4NB9A 4A3KI 2JA7I 5IP7I 1USPB 1Q16A 1RLYA 2RPRA 4MXUA 5C3EI 4A3MI 3NH8A 3CD6Z 5A2Qf 2O53A 2HF1A 2WAQA 3IFUA 4RVDA 1YJNZ 4AYBA 2QKDA 1VQ9Z 3EERA 2VPWA 1TWHI 2VPYA 3T4NB 3CCQ1 3HOZI 2VUMI 1I3QI 2K5RA 1K732 2J6AA 3FQMA 4DQYB 3CCVZ 2PMZA 1YI21 1QVFZ 3CCU1 2M48A 3CCR1 5T64A 1FDOA 1TWGI 2OTLZ 3CC41 2IZ3A 3JAMb 3NDJA 1YIJ1 1YJWZ 3OW2Z 3CC71 5D1PA 1K8A2 3CCSZ 3ESWA 2QREB 2BJOA 1Q7Y2 1KRLA 1VQ81 2OTJZ 3CMA1 3LUSA 1Q822 4NBAA 5D1OB 2RIQA 1JJ2Z 2AYDA 3D2LA 3GKQA 2R7ZI 2YU9I 2DE6A 1USPA 3I4NI 3CME1 4BY7I 1VLAA 2NVXI 3TDHB 2V8IA 3CCE1 4EWCA 3Q87A 1VQ7Z 2QEX1 1VQNZ 3S1NI 4RVHA 3J80b 1VQ5Z 3KIFA 2E9HA 3GTQI 1S721 1DL6A 3CCV1 3EEDA 5FLXb 3CXCZ 2JUBA 1VQM1 1X0TA 1Q861 5LL6f 3G711 4QTUA 3CCMZ 3HOWI 3CCJ1 3CCS1 3GCFA 3RZOI 1QYPA 4E2WA 2VPZA 3I561 2OTJ1 3NFZA 2M6NA 1PFTA 4QTTA 3CC21 4HH4A 2W03A 5D1OA 3HOVI 4BBSI 1YJ9Z 1K8A1 2F4MA 3BG0B 1Q7Y1 4A3EI 2P3YA 4BXXI 1W2BZ 1YITZ 2I3CA 3VMHA 2QA4Z 2O4HA 5C4JI 5IP9I 4RVGA 2V8JA 4A3DI 1TWCI 2NVQI 1M901 3G4S1 1Q811 3GTJI 1VQL1 1VQ4Z 2PM9A 4E2XA 3J81b 2W04A 3CCLZ 1M1K1 1VQKZ 3S17I 1YHQ1 3CPWY 2E7ZA 3PO2I 4E32A 3S2HI 1YUAA 1Q862 3GTKI 3S2DI 2DE5A 1VQ6Z 2JIPA 1VQPZ 2R93I 3D6WA 2OOYB 2E2JI 3H3VJ 3F3PC 5AN9F 2KPIA 4NH1C 4NBBA 5T67A 3I55Z 1S7MA 2OOXB 2QRDB 4X6AI 3G6E1 3JAMf 2V45A 2DE7A 1RO0A 1QVFY 1NJI2 4S1TA 4CL1A 1X3ZA 1VQOZ 2RHBA 1M902 3HKZA 2QR1B 1Q812 1FDIA 1LQLA 3CD61 4RVFA 2HU9A 3OW2Y 2KI7B 1YJN1 1VQ91 2VF1A 1M1K2 5T6BA 3CCL1 1RO2A 4RV9A 5FLMI 3M4OI 1JJ2Y 1TWFI 4NBCA 1SIWA 1QVGZ 1TWAI 1R9TI 3J80f 3KIHA 1VQ61 4RS4A 2OTL1 4MD9A 3CQZI 3U50C 2AKLA 4TNUA 2NVTI 2V8KA 5FLXf 1YJW1 1KQSZ 3RZDI 4E2YA 2JIRA 3S15I 4A3LI 1NUIA 2P28A 1ML8A 2E2II 3S14I 3CCQZ 4A3BI 1Y1WI 2PK7A 5CM2M 3FKII 4MONA 1ZB9A 2H85A 3D9XA 1YI2Z 3HOUI 3CCUZ 3CCRZ 2K3RA 4NBEA 4DGLA 3K7AI 3H0GI 3J7A4 2B63I 1WCMI 3CC4Z 4A3CI 4A3JI 1Y1VI 1NJI1 4BY1I 1YIJZ 1K9M1 3CC7Z 2JNYA 1VQ71 4BBRI 1QXFA 2V3VA 1VQN1 1ZB8A 3IF8A 3HOYI 1VQ51 1WIIA 1KC81 3TE5B 1VQ8Z 4MD8A 3P5JB 3CMAZ 3PO3I 4MD7A 3M3YI 1N8R2 2Q4ZA 5A2Qb 4A3GI 2R6MA 4E31A 1W2BY 3IR7A 3CMEZ 1TFIA 1YUKA 2QLVB 3NH5A 3J81f 4MRIA 3MZLB 3CCM1 3CCEZ 2QRCB 2QEXZ 3VMIA 4E2ZA 3NDIA 1N2FA 3GTMI 3I4MI 3FQQA 1S72Z 1AA6A 1Y8CA 3GTLI 1KD11 3I07A 3GTOI 1YJ91 2LEXA 3VTNA 2RBLA 2JA6I 2GTHA 4DK1A 1RO4A 1VQMZ 1YIT1 2EGTA 4E30A 2QA41 5IT9b 1RQFA 4A3II 2JA5I 4XX2A 1K9M2 3G71Z 3MZKB 2GTIA 1L1OC
chains in the Genus database with same CATH topology
3CCJZ 1KC82 1Y1VS 2LFUA 2JR6A 5IT9f 3I56Z 1SFOI 2JS4A 2OZKA 4NOZA 3CC2Z 1VQ41 4NBFA 1VQK1 1ZH1A 3PO3S 3VMGA 2R92I 2YADA 1N8R1 3S16I 2NVYI 2ZAEB 3S1RI 4HGZA 3MONA 3GTPI 1VQP1 2E2HI 3S1MI 4HGYA 1I50I 4NBHA 3G4SZ 1I6HI 3GTGI 3S1QI 3QWUA 1QF8A 2LIYA 4NBGA 1KD12 1VQLZ 1K83I 3I551 4MH4A 3HOXI 3GTMS 1Z03A 2Y0SA 1YHQZ 2JMOA 1P9NA 1JWHC 4A93I 1K731 2F4OA 2VUGA 5C4XI 1QVGY 2G2KA 2IZ4A 2JA8I 3CXCY 1VQO1 1NP6A 2WB1A 4NB8A 1X3WA 4NBDA 1RNIA 3NH4A 3VB9A 3IX0A 1KQSY 2GU2A 4E33A 4A3FI 4Y52I 1WW9A 2RT9A 2Q51A 4NFRA 3BG1B 4Y7NI 3F3FC 3G6EZ 3CPWZ 1Z01A 5C44I 1Q821 1Z02A 4NB9A 4A3KI 2JA7I 5IP7I 1USPB 1RLYA 2RPRA 4MXUA 5C3EI 4A3MI 3NH8A 3CD6Z 5A2Qf 2O53A 2HF1A 2WAQA 3IFUA 4RVDA 1YJNZ 4AYBA 1VQ9Z 2QKDA 3EERA 1TWHI 3T4NB 3CCQ1 3HOZI 2VUMI 1I3QI 2K5RA 1K732 2J6AA 3FQMA 4DQYB 3CCVZ 2PMZA 1YI21 1QVFZ 3CCU1 2M48A 3CCR1 5T64A 1TWGI 2OTLZ 3CC41 2IZ3A 3JAMb 3NDJA 1YIJ1 1YJWZ 3OW2Z 3CC71 5D1PA 1K8A2 3CCSZ 3ESWA 2QREB 2BJOA 1Q7Y2 1KRLA 1VQ81 2OTJZ 3CMA1 3LUSA 1Q822 4NBAA 5D1OB 2RIQA 1JJ2Z 3GKQA 2R7ZI 2YU9I 2DE6A 1USPA 3I4NI 3CME1 4BY7I 1VLAA 2NVXI 3TDHB 2V8IA 3CCE1 4EWCA 3Q87A 1VQ7Z 2QEX1 1VQNZ 3S1NI 4RVHA 3J80b 1VQ5Z 3KIFA 2E9HA 3GTQI 1S721 1DL6A 3CCV1 3EEDA 5FLXb 3CXCZ 2JUBA 1VQM1 1X0TA 1Q861 5LL6f 3G711 4QTUA 3CCMZ 3HOWI 3CCJ1 3CCS1 3GCFA 3RZOI 1QYPA 4E2WA 3I561 2OTJ1 3NFZA 2M6NA 1PFTA 4QTTA 3CC21 4HH4A 2W03A 5D1OA 3HOVI 4BBSI 1YJ9Z 1K8A1 2F4MA 3BG0B 1Q7Y1 4A3EI 2P3YA 4BXXI 1W2BZ 1YITZ 2I3CA 3VMHA 2QA4Z 2O4HA 5C4JI 5IP9I 4RVGA 2V8JA 4A3DI 1TWCI 2NVQI 1M901 3G4S1 1Q811 3GTJI 1VQL1 1VQ4Z 2PM9A 4E2XA 3J81b 2W04A 3CCLZ 1M1K1 1VQKZ 3S17I 1YHQ1 3CPWY 3PO2I 4E32A 3S2HI 1YUAA 1Q862 3GTKI 3S2DI 2DE5A 1VQ6Z 1VQPZ 2R93I 3D6WA 2OOYB 2E2JI 3H3VJ 3F3PC 5AN9F 2KPIA 4NH1C 4NBBA 5T67A 3I55Z 1S7MA 2OOXB 2QRDB 4X6AI 3G6E1 3JAMf 2DE7A 1RO0A 1QVFY 1NJI2 4S1TA 4CL1A 1X3ZA 1VQOZ 2RHBA 1M902 3HKZA 2QR1B 1Q812 1LQLA 3CD61 4RVFA 2HU9A 3OW2Y 2KI7B 1YJN1 1VQ91 2VF1A 1M1K2 5T6BA 3CCL1 1RO2A 4RV9A 5FLMI 3M4OI 1JJ2Y 1TWFI 4NBCA 1QVGZ 1TWAI 1R9TI 3J80f 3KIHA 1VQ61 4RS4A 2OTL1 4MD9A 3CQZI 3U50C 2AKLA 4TNUA 2NVTI 2V8KA 5FLXf 1YJW1 1KQSZ 3RZDI 4E2YA 3S15I 4A3LI 1NUIA 2P28A 1ML8A 2E2II 3S14I 3CCQZ 4A3BI 1Y1WI 2PK7A 5CM2M 3FKII 4MONA 1ZB9A 2H85A 3D9XA 1YI2Z 3HOUI 3CCUZ 3CCRZ 2K3RA 4NBEA 4DGLA 3K7AI 3H0GI 3J7A4 2B63I 1WCMI 3CC4Z 4A3CI 4A3JI 1Y1VI 1NJI1 4BY1I 1YIJZ 1K9M1 3CC7Z 2JNYA 1VQ71 4BBRI 1VQN1 1ZB8A 3IF8A 3HOYI 1VQ51 1WIIA 1KC81 3TE5B 1VQ8Z 4MD8A 3P5JB 3CMAZ 3PO3I 4MD7A 3M3YI 1N8R2 2Q4ZA 5A2Qb 4A3GI 2R6MA 4E31A 1W2BY 3CMEZ 1TFIA 1YUKA 2QLVB 3NH5A 3J81f 4MRIA 3MZLB 3CCM1 3CCEZ 2QRCB 2QEXZ 3VMIA 4E2ZA 3NDIA 1N2FA 3GTMI 3I4MI 3FQQA 1S72Z 3GTLI 1KD11 3I07A 3GTOI 1YJ91 3VTNA 2RBLA 2JA6I 2GTHA 4DK1A 1RO4A 1VQMZ 1YIT1 2EGTA 4E30A 2QA41 5IT9b 1RQFA 4A3II 2JA5I 4XX2A 1K9M2 3G71Z 3MZKB 2GTIA 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH I;  4A3E I;  2P3Y A;  1Y1V S;  4BXX I;  2JR6 A;  3HOZ I;  2VUM I;  3CQZ I;  1I3Q I;  3U50 C;  1SFO I;  2K5R A;  2JS4 A;  3VMH A;  2AKL A;  2J6A A;  4NOZ A;  5C4J I;  2NVT I;  5IP9 I;  4NBF A;  4A3D I;  3RZD I;  1TWC I;  2NVQ I;  3S15 I;  4A3L I;  3PO3 S;  1TWG I;  1NUI A;  1ML8 A;  2E2I I;  3S14 I;  3VMG A;  4A3B I;  1Y1W I;  2R92 I;  2PK7 A;  5CM2 M;  3FKI I;  3S16 I;  2NVY I;  3GTJ I;  1ZB9 A;  3S1R I;  3GTP I;  3HOU I;  3S17 I;  2E2H I;  3ESW A;  4NBE A;  3S1M I;  2BJO A;  1I50 I;  3K7A I;  3H0G I;  4NBH A;  3PO2 I;  1I6H I;  3GTG I;  3S1Q I;  2B63 I;  1WCM I;  3LUS A;  4NBA A;  3S2H I;  1YUA A;  3GTK I;  4A3J I;  1Y1V I;  4NBG A;  4BY1 I;  3S2D I;  4A3C I;  1K83 I;  4MH4 A;  2DE5 A;  3HOX I;  3GTM S;  3GKQ A;  2JNY A;  2R7Z I;  2YU9 I;  4BBR I;  2R93 I;  2DE6 A;  1USP A;  3I4N I;  3D6W A;  1ZB8 A;  3HOY I;  2E2J I;  3H3V J;  4A93 I;  3PO3 I;  2F4O A;  5C4X I;  2KPI A;  3M3Y I;  4BY7 I;  4NBB A;  1VLA A;  2NVX I;  2JA8 I;  4A3G I;  3Q87 A;  4NB8 A;  4X6A I;  3S1N I;  1X3W A;  4NBD A;  3GTQ I;  1TFI A;  3VB9 A;  2DE7 A;  1DL6 A;  4A3F I;  4Y52 I;  1X3Z A;  1WW9 A;  3VMI A;  1N2F A;  3GTM I;  3I4M I;  4Y7N I;  1LQL A;  5C44 I;  4NB9 A;  4A3K I;  2JA7 I;  3GTL I;  3I07 A;  3GTO I;  5IP7 I;  4QTU A;  1USP B;  2RBL A;  3HOW I;  2JA6 I;  1RLY A;  1RO4 A;  3GCF A;  3RZO I;  5C3E I;  4A3M I;  1QYP A;  5FLM I;  3M4O I;  1PFT A;  4QTT A;  1TWF I;  4NBC A;  4A3I I;  2JA5 I;  2HF1 A;  1TWA I;  4XX2 A;  3HOV I;  4BBS I;  1R9T I;  2F4M A;  3EER A;  1L1O C; 
#chains in the Genus database with same CATH topology
 3CCJ Z;  1KC8 2;  1Y1V S;  2LFU A;  2JR6 A;  5IT9 f;  3I56 Z;  1SFO I;  2JS4 A;  2OZK A;  4NOZ A;  3CC2 Z;  2JIM A;  1VQ4 1;  4NBF A;  1VQK 1;  1ZH1 A;  3PO3 S;  1WJ2 A;  3VMG A;  2JIO A;  2R92 I;  2YAD A;  1N8R 1;  3S16 I;  2NVY I;  2ZAE B;  2JIQ A;  3S1R I;  4HGZ A;  3MON A;  3GTP I;  1VQP 1;  2E2H I;  3S1M I;  1WZN A;  4HGY A;  1I50 I;  4NBH A;  3G4S Z;  1I6H I;  3GTG I;  3S1Q I;  3QWU A;  1QF8 A;  2LIY A;  4NBG A;  1KD1 2;  1VQL Z;  1K83 I;  3I55 1;  4MH4 A;  3HOX I;  3GTM S;  1Z03 A;  2Y0S A;  2NAP A;  1YHQ Z;  2JMO A;  1P9N A;  2VPX A;  1JWH C;  4A93 I;  1K73 1;  2F4O A;  2VUG A;  2IV2 X;  5C4X I;  1QVG Y;  2G2K A;  2IZ4 A;  2JA8 I;  3CXC Y;  1VQO 1;  1NP6 A;  2WB1 A;  4NB8 A;  1X3W A;  4NBD A;  1RNI A;  3NH4 A;  3VB9 A;  3IX0 A;  1KQS Y;  2GU2 A;  4E33 A;  4A3F I;  4Y52 I;  1WW9 A;  2RT9 A;  2Q51 A;  4NFR A;  3BG1 B;  4Y7N I;  3F3F C;  3G6E Z;  3CPW Z;  1Z01 A;  5C44 I;  1Q82 1;  1Z02 A;  4NB9 A;  4A3K I;  2JA7 I;  5IP7 I;  1USP B;  1Q16 A;  1RLY A;  2RPR A;  4MXU A;  5C3E I;  4A3M I;  3NH8 A;  3CD6 Z;  5A2Q f;  2O53 A;  2HF1 A;  2WAQ A;  3IFU A;  4RVD A;  1YJN Z;  4AYB A;  2QKD A;  1VQ9 Z;  3EER A;  2VPW A;  1TWH I;  2VPY A;  3T4N B;  3CCQ 1;  3HOZ I;  2VUM I;  1I3Q I;  2K5R A;  1K73 2;  2J6A A;  3FQM A;  4DQY B;  3CCV Z;  2PMZ A;  1YI2 1;  1QVF Z;  3CCU 1;  2M48 A;  3CCR 1;  5T64 A;  1FDO A;  1TWG I;  2OTL Z;  3CC4 1;  2IZ3 A;  3JAM b;  3NDJ A;  1YIJ 1;  1YJW Z;  3OW2 Z;  3CC7 1;  5D1P A;  1K8A 2;  3CCS Z;  3ESW A;  2QRE B;  2BJO A;  1Q7Y 2;  1KRL A;  1VQ8 1;  2OTJ Z;  3CMA 1;  3LUS A;  1Q82 2;  4NBA A;  5D1O B;  2RIQ A;  1JJ2 Z;  2AYD A;  3D2L A;  3GKQ A;  2R7Z I;  2YU9 I;  2DE6 A;  1USP A;  3I4N I;  3CME 1;  4BY7 I;  1VLA A;  2NVX I;  3TDH B;  2V8I A;  3CCE 1;  4EWC A;  3Q87 A;  1VQ7 Z;  2QEX 1;  1VQN Z;  3S1N I;  4RVH A;  3J80 b;  1VQ5 Z;  3KIF A;  2E9H A;  3GTQ I;  1S72 1;  1DL6 A;  3CCV 1;  3EED A;  5FLX b;  3CXC Z;  2JUB A;  1VQM 1;  1X0T A;  1Q86 1;  5LL6 f;  3G71 1;  4QTU A;  3CCM Z;  3HOW I;  3CCJ 1;  3CCS 1;  3GCF A;  3RZO I;  1QYP A;  4E2W A;  2VPZ A;  3I56 1;  2OTJ 1;  3NFZ A;  2M6N A;  1PFT A;  4QTT A;  3CC2 1;  4HH4 A;  2W03 A;  5D1O A;  3HOV I;  4BBS I;  1YJ9 Z;  1K8A 1;  2F4M A;  3BG0 B;  1Q7Y 1;  4A3E I;  2P3Y A;  4BXX I;  1W2B Z;  1YIT Z;  2I3C A;  3VMH A;  2QA4 Z;  2O4H A;  5C4J I;  5IP9 I;  4RVG A;  2V8J A;  4A3D I;  1TWC I;  2NVQ I;  1M90 1;  3G4S 1;  1Q81 1;  3GTJ I;  1VQL 1;  1VQ4 Z;  2PM9 A;  4E2X A;  3J81 b;  2W04 A;  3CCL Z;  1M1K 1;  1VQK Z;  3S17 I;  1YHQ 1;  3CPW Y;  2E7Z A;  3PO2 I;  4E32 A;  3S2H I;  1YUA A;  1Q86 2;  3GTK I;  3S2D I;  2DE5 A;  1VQ6 Z;  2JIP A;  1VQP Z;  2R93 I;  3D6W A;  2OOY B;  2E2J I;  3H3V J;  3F3P C;  5AN9 F;  2KPI A;  4NH1 C;  4NBB A;  5T67 A;  3I55 Z;  1S7M A;  2OOX B;  2QRD B;  4X6A I;  3G6E 1;  3JAM f;  2V45 A;  2DE7 A;  1RO0 A;  1QVF Y;  1NJI 2;  4S1T A;  4CL1 A;  1X3Z A;  1VQO Z;  2RHB A;  1M90 2;  3HKZ A;  2QR1 B;  1Q81 2;  1FDI A;  1LQL A;  3CD6 1;  4RVF A;  2HU9 A;  3OW2 Y;  2KI7 B;  1YJN 1;  1VQ9 1;  2VF1 A;  1M1K 2;  5T6B A;  3CCL 1;  1RO2 A;  4RV9 A;  5FLM I;  3M4O I;  1JJ2 Y;  1TWF I;  4NBC A;  1SIW A;  1QVG Z;  1TWA I;  1R9T I;  3J80 f;  3KIH A;  1VQ6 1;  4RS4 A;  2OTL 1;  4MD9 A;  3CQZ I;  3U50 C;  2AKL A;  4TNU A;  2NVT I;  2V8K A;  5FLX f;  1YJW 1;  1KQS Z;  3RZD I;  4E2Y A;  2JIR A;  3S15 I;  4A3L I;  1NUI A;  2P28 A;  1ML8 A;  2E2I I;  3S14 I;  3CCQ Z;  4A3B I;  1Y1W I;  2PK7 A;  5CM2 M;  3FKI I;  4MON A;  1ZB9 A;  2H85 A;  3D9X A;  1YI2 Z;  3HOU I;  3CCU Z;  3CCR Z;  2K3R A;  4NBE A;  4DGL A;  3K7A I;  3H0G I;  3J7A 4;  2B63 I;  1WCM I;  3CC4 Z;  4A3C I;  4A3J I;  1Y1V I;  1NJI 1;  4BY1 I;  1YIJ Z;  1K9M 1;  3CC7 Z;  2JNY A;  1VQ7 1;  4BBR I;  1QXF A;  2V3V A;  1VQN 1;  1ZB8 A;  3IF8 A;  3HOY I;  1VQ5 1;  1WII A;  1KC8 1;  3TE5 B;  1VQ8 Z;  4MD8 A;  3P5J B;  3CMA Z;  3PO3 I;  4MD7 A;  3M3Y I;  1N8R 2;  2Q4Z A;  5A2Q b;  4A3G I;  2R6M A;  4E31 A;  1W2B Y;  3IR7 A;  3CME Z;  1TFI A;  1YUK A;  2QLV B;  3NH5 A;  3J81 f;  4MRI A;  3MZL B;  3CCM 1;  3CCE Z;  2QRC B;  2QEX Z;  3VMI A;  4E2Z A;  3NDI A;  1N2F A;  3GTM I;  3I4M I;  3FQQ A;  1S72 Z;  1AA6 A;  1Y8C A;  3GTL I;  1KD1 1;  3I07 A;  3GTO I;  1YJ9 1;  2LEX A;  3VTN A;  2RBL A;  2JA6 I;  2GTH A;  4DK1 A;  1RO4 A;  1VQM Z;  1YIT 1;  2EGT A;  4E30 A;  2QA4 1;  5IT9 b;  1RQF A;  4A3I I;  2JA5 I;  4XX2 A;  1K9M 2;  3G71 Z;  3MZK B;  2GTI A;  1L1O C; 
#chains in the Genus database with same CATH homology
 3CCJ Z;  1KC8 2;  1Y1V S;  2LFU A;  2JR6 A;  5IT9 f;  3I56 Z;  1SFO I;  2JS4 A;  2OZK A;  4NOZ A;  3CC2 Z;  1VQ4 1;  4NBF A;  1VQK 1;  1ZH1 A;  3PO3 S;  3VMG A;  2R92 I;  2YAD A;  1N8R 1;  3S16 I;  2NVY I;  2ZAE B;  3S1R I;  4HGZ A;  3MON A;  3GTP I;  1VQP 1;  2E2H I;  3S1M I;  4HGY A;  1I50 I;  4NBH A;  3G4S Z;  1I6H I;  3GTG I;  3S1Q I;  3QWU A;  1QF8 A;  2LIY A;  4NBG A;  1KD1 2;  1VQL Z;  1K83 I;  3I55 1;  4MH4 A;  3HOX I;  3GTM S;  1Z03 A;  2Y0S A;  1YHQ Z;  2JMO A;  1P9N A;  1JWH C;  4A93 I;  1K73 1;  2F4O A;  2VUG A;  5C4X I;  1QVG Y;  2G2K A;  2IZ4 A;  2JA8 I;  3CXC Y;  1VQO 1;  1NP6 A;  2WB1 A;  4NB8 A;  1X3W A;  4NBD A;  1RNI A;  3NH4 A;  3VB9 A;  3IX0 A;  1KQS Y;  2GU2 A;  4E33 A;  4A3F I;  4Y52 I;  1WW9 A;  2RT9 A;  2Q51 A;  4NFR A;  3BG1 B;  4Y7N I;  3F3F C;  3G6E Z;  3CPW Z;  1Z01 A;  5C44 I;  1Q82 1;  1Z02 A;  4NB9 A;  4A3K I;  2JA7 I;  5IP7 I;  1USP B;  1RLY A;  2RPR A;  4MXU A;  5C3E I;  4A3M I;  3NH8 A;  3CD6 Z;  5A2Q f;  2O53 A;  2HF1 A;  2WAQ A;  3IFU A;  4RVD A;  1YJN Z;  4AYB A;  1VQ9 Z;  2QKD A;  3EER A;  1TWH I;  3T4N B;  3CCQ 1;  3HOZ I;  2VUM I;  1I3Q I;  2K5R A;  1K73 2;  2J6A A;  3FQM A;  4DQY B;  3CCV Z;  2PMZ A;  1YI2 1;  1QVF Z;  3CCU 1;  2M48 A;  3CCR 1;  5T64 A;  1TWG I;  2OTL Z;  3CC4 1;  2IZ3 A;  3JAM b;  3NDJ A;  1YIJ 1;  1YJW Z;  3OW2 Z;  3CC7 1;  5D1P A;  1K8A 2;  3CCS Z;  3ESW A;  2QRE B;  2BJO A;  1Q7Y 2;  1KRL A;  1VQ8 1;  2OTJ Z;  3CMA 1;  3LUS A;  1Q82 2;  4NBA A;  5D1O B;  2RIQ A;  1JJ2 Z;  3GKQ A;  2R7Z I;  2YU9 I;  2DE6 A;  1USP A;  3I4N I;  3CME 1;  4BY7 I;  1VLA A;  2NVX I;  3TDH B;  2V8I A;  3CCE 1;  4EWC A;  3Q87 A;  1VQ7 Z;  2QEX 1;  1VQN Z;  3S1N I;  4RVH A;  3J80 b;  1VQ5 Z;  3KIF A;  2E9H A;  3GTQ I;  1S72 1;  1DL6 A;  3CCV 1;  3EED A;  5FLX b;  3CXC Z;  2JUB A;  1VQM 1;  1X0T A;  1Q86 1;  5LL6 f;  3G71 1;  4QTU A;  3CCM Z;  3HOW I;  3CCJ 1;  3CCS 1;  3GCF A;  3RZO I;  1QYP A;  4E2W A;  3I56 1;  2OTJ 1;  3NFZ A;  2M6N A;  1PFT A;  4QTT A;  3CC2 1;  4HH4 A;  2W03 A;  5D1O A;  3HOV I;  4BBS I;  1YJ9 Z;  1K8A 1;  2F4M A;  3BG0 B;  1Q7Y 1;  4A3E I;  2P3Y A;  4BXX I;  1W2B Z;  1YIT Z;  2I3C A;  3VMH A;  2QA4 Z;  2O4H A;  5C4J I;  5IP9 I;  4RVG A;  2V8J A;  4A3D I;  1TWC I;  2NVQ I;  1M90 1;  3G4S 1;  1Q81 1;  3GTJ I;  1VQL 1;  1VQ4 Z;  2PM9 A;  4E2X A;  3J81 b;  2W04 A;  3CCL Z;  1M1K 1;  1VQK Z;  3S17 I;  1YHQ 1;  3CPW Y;  3PO2 I;  4E32 A;  3S2H I;  1YUA A;  1Q86 2;  3GTK I;  3S2D I;  2DE5 A;  1VQ6 Z;  1VQP Z;  2R93 I;  3D6W A;  2OOY B;  2E2J I;  3H3V J;  3F3P C;  5AN9 F;  2KPI A;  4NH1 C;  4NBB A;  5T67 A;  3I55 Z;  1S7M A;  2OOX B;  2QRD B;  4X6A I;  3G6E 1;  3JAM f;  2DE7 A;  1RO0 A;  1QVF Y;  1NJI 2;  4S1T A;  4CL1 A;  1X3Z A;  1VQO Z;  2RHB A;  1M90 2;  3HKZ A;  2QR1 B;  1Q81 2;  1LQL A;  3CD6 1;  4RVF A;  2HU9 A;  3OW2 Y;  2KI7 B;  1YJN 1;  1VQ9 1;  2VF1 A;  1M1K 2;  5T6B A;  3CCL 1;  1RO2 A;  4RV9 A;  5FLM I;  3M4O I;  1JJ2 Y;  1TWF I;  4NBC A;  1QVG Z;  1TWA I;  1R9T I;  3J80 f;  3KIH A;  1VQ6 1;  4RS4 A;  2OTL 1;  4MD9 A;  3CQZ I;  3U50 C;  2AKL A;  4TNU A;  2NVT I;  2V8K A;  5FLX f;  1YJW 1;  1KQS Z;  3RZD I;  4E2Y A;  3S15 I;  4A3L I;  1NUI A;  2P28 A;  1ML8 A;  2E2I I;  3S14 I;  3CCQ Z;  4A3B I;  1Y1W I;  2PK7 A;  5CM2 M;  3FKI I;  4MON A;  1ZB9 A;  2H85 A;  3D9X A;  1YI2 Z;  3HOU I;  3CCU Z;  3CCR Z;  2K3R A;  4NBE A;  4DGL A;  3K7A I;  3H0G I;  3J7A 4;  2B63 I;  1WCM I;  3CC4 Z;  4A3C I;  4A3J I;  1Y1V I;  1NJI 1;  4BY1 I;  1YIJ Z;  1K9M 1;  3CC7 Z;  2JNY A;  1VQ7 1;  4BBR I;  1VQN 1;  1ZB8 A;  3IF8 A;  3HOY I;  1VQ5 1;  1WII A;  1KC8 1;  3TE5 B;  1VQ8 Z;  4MD8 A;  3P5J B;  3CMA Z;  3PO3 I;  4MD7 A;  3M3Y I;  1N8R 2;  2Q4Z A;  5A2Q b;  4A3G I;  2R6M A;  4E31 A;  1W2B Y;  3CME Z;  1TFI A;  1YUK A;  2QLV B;  3NH5 A;  3J81 f;  4MRI A;  3MZL B;  3CCM 1;  3CCE Z;  2QRC B;  2QEX Z;  3VMI A;  4E2Z A;  3NDI A;  1N2F A;  3GTM I;  3I4M I;  3FQQ A;  1S72 Z;  3GTL I;  1KD1 1;  3I07 A;  3GTO I;  1YJ9 1;  3VTN A;  2RBL A;  2JA6 I;  2GTH A;  4DK1 A;  1RO4 A;  1VQM Z;  1YIT 1;  2EGT A;  4E30 A;  2QA4 1;  5IT9 b;  1RQF A;  4A3I I;  2JA5 I;  4XX2 A;  1K9M 2;  3G71 Z;  3MZK B;  2GTI A;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...