2NVQI

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvqI02
4BY7I 1VLAA 3GTOI 1USPB 3GCFA 2F4MA 1TWFI 4Y52I 1TWGI 4NBCA 2E2JI 1Y1VI 3RZOI 4A3EI 2R92I 4BBRI 3U50C 3GTMS 3VMIA 3I4MI 3HOWI 3S2DI 4NBFA 2VUMI 4NBHA 1TWHI 5CM2M 4Y7NI 1TWAI 1TWCI 2JA6I 2B63I 2BJOA 4BBSI 2JA5I 5C3EI 4QTTA 3GTLI 2NVTI 1WCMI 3M3YI 1I50I 2E2HI 4NBBA 3PO3I 2PK7A 4A3JI 2JA7I 2P3YA 3H3VJ 4A3BI 2F4OA 3GTKI 3LUSA 2JNYA 2RBLA 3CQZI 1L1OC 4A3FI 3S1RI 3VMHA 4BY1I 1QYPA 3GTJI 2NVQI 1LQLA 4NBGA 3VMGA 3HOZI 3EERA 1RO4A 3Q87A 3GTQI 3S15I 3HOXI 2JA8I 3I4NI 2K5RA 1DL6A 2E2II 3I07A 1Y1VS 4NBDA 1TFIA 3RZDI 4A3GI 1X3ZA 1RLYA 3S1MI 4A3LI 1WW9A 3S1QI 3M4OI 4BXXI 2KPIA 1I6HI 4A93I 3GTGI 3PO2I 2HF1A 2NVYI 2JR6A 1SFOI 2DE6A 4A3MI 4QTUA 5C44I 4NBEA 1K83I 4X6AI 4MH4A 3VB9A 2DE7A 5IP7I 3GTMI 3PO3S 3HOYI 1N2FA 1PFTA 3HOVI 1ML8A 3S1NI 1R9TI 1NUIA 4XX2A 3S14I 3FKII 5IP9I 1USPA 3D6WA 4A3II 2NVXI 2R93I 2J6AA 3GKQA 4A3KI 2AKLA 4NB8A 4NB9A 1ZB9A 1YUAA 3HOUI 3GTPI 3ESWA 2JS4A 1ZB8A 3K7AI 1Y1WI 3H0GI 5FLMI 5C4XI 1X3WA 1I3QI 4A3CI 4A3DI 3S17I 2YU9I 3S2HI 2R7ZI 2DE5A 5C4JI 3S16I 4NBAA 4NOZA
chains in the Genus database with same CATH superfamily
1YJNZ 4NH1C 3CME1 3GCFA 3J80f 4Y52I 4MXUA 2H85A 4NBCA 2E2JI 1Y1VI 3JAMb 2OOYB 1S7MA 3BG1B 5A2Qb 1RNIA 3HOWI 2O53A 4NBFA 3D2LA 2VUMI 1TWHI 5CM2M 2IZ3A 4NFRA 3CCR1 2LIYA 3TDHB 4BBSI 3CCS1 3J81b 5C3EI 4E33A 2ZAEB 3PO3I 2PK7A 2JA7I 2OTJ1 3CQZI 1FDIA 1YITZ 3CCU1 2RHBA 2G2KA 5FLXb 4E2XA 1LQLA 1VQN1 3CMEZ 3VMGA 1QVFY 3HOZI 3EERA 1RO4A 2QLVB 3Q87A 2OZKA 2PM9A 3J7A4 1YIJ1 2K5RA 3CCQ1 5IT9f 2V45A 4NBDA 1TFIA 3RZDI 4RVHA 2E7ZA 1YJW1 1VQP1 1YUKA 2RPRA 1WW9A 3CCRZ 1ZH1A 3CCSZ 3GTGI 3PO2I 2DE6A 4E2YA 1Z03A 1YHQ1 2R6MA 2RIQA 2VPYA 4MH4A 1KD12 2VPWA 1KQSZ 1VQ81 4MD9A 2OTJZ 1Q16A 3S1NI 1WZNA 3S14I 1K732 3CCUZ 3D6WA 2R93I 3GKQA 1Z01A 4E31A 3CC21 1VQNZ 2AKLA 1ZB9A 1Y8CA 1VQ41 1W2BZ 3CMA1 3ESWA 1Y1WI 3H0GI 1VQ91 3CCQZ 5C4XI 3S17I 2AYDA 3S2HI 2GTIA 1YJWZ 2W03A 1VQPZ 1S721 3EEDA 2IV2X 3GTOI 1USPB 1TWFI 1NJI1 1VQL1 2JIQA 3D9XA 1YHQZ 1X0TA 3F3FC 4RS4A 2WB1A 3VMIA 1VQ8Z 2JIPA 1N8R1 2Q4ZA 4MD8A 3CCV1 2OTL1 2VPXA 3CC2Z 3GTLI 1VQ4Z 3MZLB 1M1K1 4NBBA 3CMAZ 1VQ9Z 3I551 3H3VJ 3LUSA 2JNYA 4S1TA 3VMHA 1S72Z 4AYBA 3NDJA 1YI21 2QRCB 2KI7B 4DK1A 1Q7Y1 4RVFA 1VQLZ 3HOXI 2QEX1 2JA8I 3IR7A 1DL6A 5D1OA 4A3GI 1X3ZA 1JWHC 3S1MI 3S1QI 3CCVZ 4BXXI 2KPIA 2OTLZ 5A2Qf 4A3MI 3CD61 1KC81 1NP6A 3VB9A 3T4NB 3I55Z 1N2FA 2QR1B 2VPZA 1PFTA 2RT9A 3J81f 3CC71 1ML8A 4XX2A 1P9NA 2EGTA 3FKII 1QVFZ 1YI2Z 2NVXI 2J6AA 4RVGA 2Q51A 4A3KI 1VQ71 2QKDA 2M6NA 1YUAA 3HOUI 3GTPI 2QEXZ 1ZB8A 1VQ6Z 5FLMI 1KRLA 1X3WA 1I3QI 5FLXf 1NJI2 3G6E1 2JMOA 2DE5A 5C4JI 4NBAA 4NOZA 3NFZA 1N8R2 4BY7I 1K9M2 2F4MA 2QA41 3CPWY 3CD6Z 2QREB 3RZOI 5AN9F 3P5JB 2OOXB 3U50C 4BBRI 1M1K2 5D1PA 2O4HA 3I4MI 3CXCY 3CPWZ 1TWAI 1M901 3CC7Z 2I3CA 1VQO1 2BJOA 1VQ7Z 4QTTA 2NVTI 1WCMI 1I50I 2V3VA 3NH4A 3MONA 1Q7Y2 2V8IA 5T64A 2F4OA 3G6EZ 3GTKI 2RBLA 2Y0SA 1L1OC 4BY1I 1QYPA 3GTJI 1K9M1 1FDOA 3GTQI 3S15I 2QA4Z 2P28A 1VQK1 3I4NI 3CCJ1 4E2ZA 2E2II 2JIMA 4MD7A 3J80b 1RLYA 1RQFA 1KC82 4A3LI 1QXFA 1VQOZ 1YJ91 3QWUA 1JJ2Y 2LEXA 3M4OI 3NH5A 1I6HI 2HF1A 2JR6A 1SFOI 4QTUA 1Q861 3HKZA 2VF1A 1WJ2A 2NAPA 3CCE1 1SIWA 3G4SZ 3KIFA 1VQ61 3FQMA 4E32A 4HH4A 1NUIA 1Q811 3KIHA 1USPA 4HGYA 1VQ51 3OW2Y 2V8JA 4NB8A 4NB9A 2V8KA 3IFUA 1K8A1 3JAMf 3I561 1Q821 1VQKZ 3OW2Z 3CCJZ 3TE5B 2K3RA 3G711 4A3CI 4A3DI 2YU9I 3CCL1 5IT9b 4MRIA 1YJ9Z 3S16I 5T67A 1VLAA 4DGLA 1M902 2YADA 2WAQA 2JIRA 4EWCA 1TWGI 1AA6A 1Z02A 4CL1A 4A3EI 5LL6f 3CCEZ 2R92I 3GTMS 3S2DI 4NBHA 4Y7NI 1TWCI 3CC41 2JA6I 3IX0A 3FQQA 2GU2A 1VQ5Z 3F3PC 3CCM1 2B63I 2JA5I 4RVDA 3M3YI 3I56Z 2QRDB 2E2HI 2VUGA 4A3JI 2JIOA 2P3YA 3G71Z 4A3BI 1VQM1 4E30A 4HGZA 4A3FI 1KQSY 3CCLZ 3S1RI 2LFUA 2W04A 2NVQI 4NBGA 3NH8A 2JUBA 4E2WA 4RV9A 1QF8A 2E9HA 4MONA 3CXCZ 3I07A 1Y1VS 1W2BY 1Q862 1QVGY 3CC4Z 3G4S1 3VTNA 1YJN1 5T6BA 3CCMZ 4A93I 1YIJZ 3IF8A 2PMZA 2GTHA 1Q812 1RO2A 2NVYI 2IZ4A 1QVGZ 3MZKB 5C44I 4NBEA 4TNUA 1K83I 4X6AI 2DE7A 5IP7I 3GTMI 3PO3S 1K8A2 3HOYI 3NDIA 3BG0B 1VQMZ 1Q822 3HOVI 5D1OB 1R9TI 5IP9I 4A3II 1WIIA 1KD11 4DQYB 2JS4A 2M48A 3K7AI 1RO0A 1K731 1JJ2Z 2R7ZI 1YIT1 2HU9A
chains in the Genus database with same CATH topology
1YJNZ 4NH1C 3CME1 3GCFA 3J80f 4Y52I 4MXUA 2H85A 4NBCA 2E2JI 1Y1VI 3JAMb 2OOYB 1S7MA 3BG1B 5A2Qb 1RNIA 3HOWI 2O53A 4NBFA 2VUMI 1TWHI 5CM2M 2IZ3A 4NFRA 3CCR1 2LIYA 3TDHB 4BBSI 3CCS1 3J81b 5C3EI 4E33A 2ZAEB 3PO3I 2PK7A 2JA7I 2OTJ1 3CQZI 1YITZ 3CCU1 2RHBA 2G2KA 5FLXb 4E2XA 1LQLA 1VQN1 3CMEZ 3VMGA 1QVFY 3HOZI 3EERA 1RO4A 2QLVB 3Q87A 2OZKA 2PM9A 3J7A4 1YIJ1 2K5RA 3CCQ1 5IT9f 4NBDA 1TFIA 3RZDI 4RVHA 1YJW1 1VQP1 1YUKA 2RPRA 1WW9A 3CCRZ 1ZH1A 3CCSZ 3GTGI 3PO2I 2DE6A 4E2YA 1Z03A 1YHQ1 2R6MA 2RIQA 4MH4A 1KD12 1KQSZ 1VQ81 4MD9A 2OTJZ 3S1NI 3S14I 1K732 3CCUZ 3D6WA 2R93I 3GKQA 1Z01A 4E31A 3CC21 1VQNZ 2AKLA 1ZB9A 1VQ41 1W2BZ 3CMA1 3ESWA 1Y1WI 3H0GI 1VQ91 3CCQZ 5C4XI 3S17I 3S2HI 2GTIA 1YJWZ 2W03A 1VQPZ 1S721 3EEDA 3GTOI 1USPB 1TWFI 1NJI1 1VQL1 3D9XA 1YHQZ 1X0TA 3F3FC 4RS4A 2WB1A 3VMIA 1VQ8Z 1N8R1 2Q4ZA 4MD8A 3CCV1 2OTL1 3CC2Z 3GTLI 1VQ4Z 3MZLB 1M1K1 4NBBA 3CMAZ 1VQ9Z 3I551 3H3VJ 3LUSA 2JNYA 4S1TA 3VMHA 1S72Z 4AYBA 3NDJA 1YI21 2QRCB 2KI7B 4DK1A 1Q7Y1 4RVFA 1VQLZ 3HOXI 2QEX1 2JA8I 1DL6A 5D1OA 4A3GI 1X3ZA 1JWHC 3S1MI 3S1QI 3CCVZ 4BXXI 2KPIA 2OTLZ 5A2Qf 4A3MI 3CD61 1KC81 1NP6A 3VB9A 3T4NB 3I55Z 1N2FA 2QR1B 1PFTA 2RT9A 3J81f 3CC71 1ML8A 4XX2A 1P9NA 2EGTA 3FKII 1QVFZ 1YI2Z 2NVXI 2J6AA 4RVGA 2Q51A 4A3KI 1VQ71 2QKDA 2M6NA 1YUAA 3HOUI 3GTPI 2QEXZ 1ZB8A 1VQ6Z 5FLMI 1KRLA 1X3WA 1I3QI 5FLXf 1NJI2 3G6E1 2JMOA 2DE5A 5C4JI 4NBAA 4NOZA 3NFZA 1N8R2 4BY7I 1K9M2 2F4MA 2QA41 3CPWY 3CD6Z 2QREB 3RZOI 5AN9F 3P5JB 2OOXB 3U50C 4BBRI 1M1K2 5D1PA 2O4HA 3I4MI 3CXCY 3CPWZ 1TWAI 1M901 3CC7Z 2I3CA 1VQO1 2BJOA 1VQ7Z 4QTTA 2NVTI 1WCMI 1I50I 3NH4A 3MONA 1Q7Y2 2V8IA 5T64A 2F4OA 3G6EZ 3GTKI 2RBLA 2Y0SA 1L1OC 4BY1I 1QYPA 3GTJI 1K9M1 3GTQI 3S15I 2QA4Z 2P28A 1VQK1 3I4NI 3CCJ1 4E2ZA 2E2II 4MD7A 3J80b 1RLYA 1RQFA 1KC82 4A3LI 1VQOZ 1YJ91 3QWUA 1JJ2Y 3M4OI 3NH5A 1I6HI 2HF1A 2JR6A 1SFOI 4QTUA 1Q861 3HKZA 2VF1A 3CCE1 3G4SZ 3KIFA 1VQ61 3FQMA 4E32A 4HH4A 1NUIA 1Q811 3KIHA 1USPA 4HGYA 1VQ51 3OW2Y 2V8JA 4NB8A 4NB9A 2V8KA 3IFUA 1K8A1 3JAMf 3I561 1Q821 1VQKZ 3OW2Z 3CCJZ 3TE5B 2K3RA 3G711 4A3CI 4A3DI 2YU9I 3CCL1 5IT9b 4MRIA 1YJ9Z 3S16I 5T67A 1VLAA 4DGLA 1M902 2YADA 2WAQA 4EWCA 1TWGI 1Z02A 4CL1A 4A3EI 5LL6f 3CCEZ 2R92I 3GTMS 3S2DI 4NBHA 4Y7NI 1TWCI 3CC41 2JA6I 3IX0A 3FQQA 2GU2A 1VQ5Z 3F3PC 3CCM1 2B63I 2JA5I 4RVDA 3M3YI 3I56Z 2QRDB 2E2HI 2VUGA 4A3JI 2P3YA 3G71Z 4A3BI 1VQM1 4E30A 4HGZA 4A3FI 1KQSY 3CCLZ 3S1RI 2LFUA 2W04A 2NVQI 4NBGA 3NH8A 2JUBA 4E2WA 4RV9A 1QF8A 2E9HA 4MONA 3CXCZ 3I07A 1Y1VS 1W2BY 1Q862 1QVGY 3CC4Z 3G4S1 3VTNA 1YJN1 5T6BA 3CCMZ 4A93I 1YIJZ 3IF8A 2PMZA 2GTHA 1Q812 1RO2A 2NVYI 2IZ4A 1QVGZ 3MZKB 5C44I 4NBEA 4TNUA 1K83I 4X6AI 2DE7A 5IP7I 3GTMI 3PO3S 1K8A2 3HOYI 3NDIA 3BG0B 1VQMZ 1Q822 3HOVI 5D1OB 1R9TI 5IP9I 4A3II 1WIIA 1KD11 4DQYB 2JS4A 2M48A 3K7AI 1RO0A 1K731 1JJ2Z 2R7ZI 1YIT1 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 I;  1VLA A;  3GTO I;  1USP B;  3GCF A;  2F4M A;  1TWF I;  4Y52 I;  1TWG I;  4NBC A;  2E2J I;  1Y1V I;  3RZO I;  4A3E I;  2R92 I;  4BBR I;  3U50 C;  3GTM S;  3VMI A;  3I4M I;  3HOW I;  3S2D I;  4NBF A;  2VUM I;  4NBH A;  1TWH I;  5CM2 M;  4Y7N I;  1TWA I;  1TWC I;  2JA6 I;  2B63 I;  2BJO A;  4BBS I;  2JA5 I;  5C3E I;  4QTT A;  3GTL I;  2NVT I;  1WCM I;  3M3Y I;  1I50 I;  2E2H I;  4NBB A;  3PO3 I;  2PK7 A;  4A3J I;  2JA7 I;  2P3Y A;  3H3V J;  4A3B I;  2F4O A;  3GTK I;  3LUS A;  2JNY A;  2RBL A;  3CQZ I;  1L1O C;  4A3F I;  3S1R I;  3VMH A;  4BY1 I;  1QYP A;  3GTJ I;  2NVQ I;  1LQL A;  4NBG A;  3VMG A;  3HOZ I;  3EER A;  1RO4 A;  3Q87 A;  3GTQ I;  3S15 I;  3HOX I;  2JA8 I;  3I4N I;  2K5R A;  1DL6 A;  2E2I I;  3I07 A;  1Y1V S;  4NBD A;  1TFI A;  3RZD I;  4A3G I;  1X3Z A;  1RLY A;  3S1M I;  4A3L I;  1WW9 A;  3S1Q I;  3M4O I;  4BXX I;  2KPI A;  1I6H I;  4A93 I;  3GTG I;  3PO2 I;  2HF1 A;  2NVY I;  2JR6 A;  1SFO I;  2DE6 A;  4A3M I;  4QTU A;  5C44 I;  4NBE A;  1K83 I;  4X6A I;  4MH4 A;  3VB9 A;  2DE7 A;  5IP7 I;  3GTM I;  3PO3 S;  3HOY I;  1N2F A;  1PFT A;  3HOV I;  1ML8 A;  3S1N I;  1R9T I;  1NUI A;  4XX2 A;  3S14 I;  3FKI I;  5IP9 I;  1USP A;  3D6W A;  4A3I I;  2NVX I;  2R93 I;  2J6A A;  3GKQ A;  4A3K I;  2AKL A;  4NB8 A;  4NB9 A;  1ZB9 A;  1YUA A;  3HOU I;  3GTP I;  3ESW A;  2JS4 A;  1ZB8 A;  3K7A I;  1Y1W I;  3H0G I;  5FLM I;  5C4X I;  1X3W A;  1I3Q I;  4A3C I;  4A3D I;  3S17 I;  2YU9 I;  3S2H I;  2R7Z I;  2DE5 A;  5C4J I;  3S16 I;  4NBA A;  4NOZ A; 
#chains in the Genus database with same CATH topology
 1YJN Z;  4NH1 C;  3CME 1;  3GCF A;  3J80 f;  4Y52 I;  4MXU A;  2H85 A;  4NBC A;  2E2J I;  1Y1V I;  3JAM b;  2OOY B;  1S7M A;  3BG1 B;  5A2Q b;  1RNI A;  3HOW I;  2O53 A;  4NBF A;  3D2L A;  2VUM I;  1TWH I;  5CM2 M;  2IZ3 A;  4NFR A;  3CCR 1;  2LIY A;  3TDH B;  4BBS I;  3CCS 1;  3J81 b;  5C3E I;  4E33 A;  2ZAE B;  3PO3 I;  2PK7 A;  2JA7 I;  2OTJ 1;  3CQZ I;  1FDI A;  1YIT Z;  3CCU 1;  2RHB A;  2G2K A;  5FLX b;  4E2X A;  1LQL A;  1VQN 1;  3CME Z;  3VMG A;  1QVF Y;  3HOZ I;  3EER A;  1RO4 A;  2QLV B;  3Q87 A;  2OZK A;  2PM9 A;  3J7A 4;  1YIJ 1;  2K5R A;  3CCQ 1;  5IT9 f;  2V45 A;  4NBD A;  1TFI A;  3RZD I;  4RVH A;  2E7Z A;  1YJW 1;  1VQP 1;  1YUK A;  2RPR A;  1WW9 A;  3CCR Z;  1ZH1 A;  3CCS Z;  3GTG I;  3PO2 I;  2DE6 A;  4E2Y A;  1Z03 A;  1YHQ 1;  2R6M A;  2RIQ A;  2VPY A;  4MH4 A;  1KD1 2;  2VPW A;  1KQS Z;  1VQ8 1;  4MD9 A;  2OTJ Z;  1Q16 A;  3S1N I;  1WZN A;  3S14 I;  1K73 2;  3CCU Z;  3D6W A;  2R93 I;  3GKQ A;  1Z01 A;  4E31 A;  3CC2 1;  1VQN Z;  2AKL A;  1ZB9 A;  1Y8C A;  1VQ4 1;  1W2B Z;  3CMA 1;  3ESW A;  1Y1W I;  3H0G I;  1VQ9 1;  3CCQ Z;  5C4X I;  3S17 I;  2AYD A;  3S2H I;  2GTI A;  1YJW Z;  2W03 A;  1VQP Z;  1S72 1;  3EED A;  2IV2 X;  3GTO I;  1USP B;  1TWF I;  1NJI 1;  1VQL 1;  2JIQ A;  3D9X A;  1YHQ Z;  1X0T A;  3F3F C;  4RS4 A;  2WB1 A;  3VMI A;  1VQ8 Z;  2JIP A;  1N8R 1;  2Q4Z A;  4MD8 A;  3CCV 1;  2OTL 1;  2VPX A;  3CC2 Z;  3GTL I;  1VQ4 Z;  3MZL B;  1M1K 1;  4NBB A;  3CMA Z;  1VQ9 Z;  3I55 1;  3H3V J;  3LUS A;  2JNY A;  4S1T A;  3VMH A;  1S72 Z;  4AYB A;  3NDJ A;  1YI2 1;  2QRC B;  2KI7 B;  4DK1 A;  1Q7Y 1;  4RVF A;  1VQL Z;  3HOX I;  2QEX 1;  2JA8 I;  3IR7 A;  1DL6 A;  5D1O A;  4A3G I;  1X3Z A;  1JWH C;  3S1M I;  3S1Q I;  3CCV Z;  4BXX I;  2KPI A;  2OTL Z;  5A2Q f;  4A3M I;  3CD6 1;  1KC8 1;  1NP6 A;  3VB9 A;  3T4N B;  3I55 Z;  1N2F A;  2QR1 B;  2VPZ A;  1PFT A;  2RT9 A;  3J81 f;  3CC7 1;  1ML8 A;  4XX2 A;  1P9N A;  2EGT A;  3FKI I;  1QVF Z;  1YI2 Z;  2NVX I;  2J6A A;  4RVG A;  2Q51 A;  4A3K I;  1VQ7 1;  2QKD A;  2M6N A;  1YUA A;  3HOU I;  3GTP I;  2QEX Z;  1ZB8 A;  1VQ6 Z;  5FLM I;  1KRL A;  1X3W A;  1I3Q I;  5FLX f;  1NJI 2;  3G6E 1;  2JMO A;  2DE5 A;  5C4J I;  4NBA A;  4NOZ A;  3NFZ A;  1N8R 2;  4BY7 I;  1K9M 2;  2F4M A;  2QA4 1;  3CPW Y;  3CD6 Z;  2QRE B;  3RZO I;  5AN9 F;  3P5J B;  2OOX B;  3U50 C;  4BBR I;  1M1K 2;  5D1P A;  2O4H A;  3I4M I;  3CXC Y;  3CPW Z;  1TWA I;  1M90 1;  3CC7 Z;  2I3C A;  1VQO 1;  2BJO A;  1VQ7 Z;  4QTT A;  2NVT I;  1WCM I;  1I50 I;  2V3V A;  3NH4 A;  3MON A;  1Q7Y 2;  2V8I A;  5T64 A;  2F4O A;  3G6E Z;  3GTK I;  2RBL A;  2Y0S A;  1L1O C;  4BY1 I;  1QYP A;  3GTJ I;  1K9M 1;  1FDO A;  3GTQ I;  3S15 I;  2QA4 Z;  2P28 A;  1VQK 1;  3I4N I;  3CCJ 1;  4E2Z A;  2E2I I;  2JIM A;  4MD7 A;  3J80 b;  1RLY A;  1RQF A;  1KC8 2;  4A3L I;  1QXF A;  1VQO Z;  1YJ9 1;  3QWU A;  1JJ2 Y;  2LEX A;  3M4O I;  3NH5 A;  1I6H I;  2HF1 A;  2JR6 A;  1SFO I;  4QTU A;  1Q86 1;  3HKZ A;  2VF1 A;  1WJ2 A;  2NAP A;  3CCE 1;  1SIW A;  3G4S Z;  3KIF A;  1VQ6 1;  3FQM A;  4E32 A;  4HH4 A;  1NUI A;  1Q81 1;  3KIH A;  1USP A;  4HGY A;  1VQ5 1;  3OW2 Y;  2V8J A;  4NB8 A;  4NB9 A;  2V8K A;  3IFU A;  1K8A 1;  3JAM f;  3I56 1;  1Q82 1;  1VQK Z;  3OW2 Z;  3CCJ Z;  3TE5 B;  2K3R A;  3G71 1;  4A3C I;  4A3D I;  2YU9 I;  3CCL 1;  5IT9 b;  4MRI A;  1YJ9 Z;  3S16 I;  5T67 A;  1VLA A;  4DGL A;  1M90 2;  2YAD A;  2WAQ A;  2JIR A;  4EWC A;  1TWG I;  1AA6 A;  1Z02 A;  4CL1 A;  4A3E I;  5LL6 f;  3CCE Z;  2R92 I;  3GTM S;  3S2D I;  4NBH A;  4Y7N I;  1TWC I;  3CC4 1;  2JA6 I;  3IX0 A;  3FQQ A;  2GU2 A;  1VQ5 Z;  3F3P C;  3CCM 1;  2B63 I;  2JA5 I;  4RVD A;  3M3Y I;  3I56 Z;  2QRD B;  2E2H I;  2VUG A;  4A3J I;  2JIO A;  2P3Y A;  3G71 Z;  4A3B I;  1VQM 1;  4E30 A;  4HGZ A;  4A3F I;  1KQS Y;  3CCL Z;  3S1R I;  2LFU A;  2W04 A;  2NVQ I;  4NBG A;  3NH8 A;  2JUB A;  4E2W A;  4RV9 A;  1QF8 A;  2E9H A;  4MON A;  3CXC Z;  3I07 A;  1Y1V S;  1W2B Y;  1Q86 2;  1QVG Y;  3CC4 Z;  3G4S 1;  3VTN A;  1YJN 1;  5T6B A;  3CCM Z;  4A93 I;  1YIJ Z;  3IF8 A;  2PMZ A;  2GTH A;  1Q81 2;  1RO2 A;  2NVY I;  2IZ4 A;  1QVG Z;  3MZK B;  5C44 I;  4NBE A;  4TNU A;  1K83 I;  4X6A I;  2DE7 A;  5IP7 I;  3GTM I;  3PO3 S;  1K8A 2;  3HOY I;  3NDI A;  3BG0 B;  1VQM Z;  1Q82 2;  3HOV I;  5D1O B;  1R9T I;  5IP9 I;  4A3I I;  1WII A;  1KD1 1;  4DQY B;  2JS4 A;  2M48 A;  3K7A I;  1RO0 A;  1K73 1;  1JJ2 Z;  2R7Z I;  1YIT 1;  2HU9 A; 
#chains in the Genus database with same CATH homology
 1YJN Z;  4NH1 C;  3CME 1;  3GCF A;  3J80 f;  4Y52 I;  4MXU A;  2H85 A;  4NBC A;  2E2J I;  1Y1V I;  3JAM b;  2OOY B;  1S7M A;  3BG1 B;  5A2Q b;  1RNI A;  3HOW I;  2O53 A;  4NBF A;  2VUM I;  1TWH I;  5CM2 M;  2IZ3 A;  4NFR A;  3CCR 1;  2LIY A;  3TDH B;  4BBS I;  3CCS 1;  3J81 b;  5C3E I;  4E33 A;  2ZAE B;  3PO3 I;  2PK7 A;  2JA7 I;  2OTJ 1;  3CQZ I;  1YIT Z;  3CCU 1;  2RHB A;  2G2K A;  5FLX b;  4E2X A;  1LQL A;  1VQN 1;  3CME Z;  3VMG A;  1QVF Y;  3HOZ I;  3EER A;  1RO4 A;  2QLV B;  3Q87 A;  2OZK A;  2PM9 A;  3J7A 4;  1YIJ 1;  2K5R A;  3CCQ 1;  5IT9 f;  4NBD A;  1TFI A;  3RZD I;  4RVH A;  1YJW 1;  1VQP 1;  1YUK A;  2RPR A;  1WW9 A;  3CCR Z;  1ZH1 A;  3CCS Z;  3GTG I;  3PO2 I;  2DE6 A;  4E2Y A;  1Z03 A;  1YHQ 1;  2R6M A;  2RIQ A;  4MH4 A;  1KD1 2;  1KQS Z;  1VQ8 1;  4MD9 A;  2OTJ Z;  3S1N I;  3S14 I;  1K73 2;  3CCU Z;  3D6W A;  2R93 I;  3GKQ A;  1Z01 A;  4E31 A;  3CC2 1;  1VQN Z;  2AKL A;  1ZB9 A;  1VQ4 1;  1W2B Z;  3CMA 1;  3ESW A;  1Y1W I;  3H0G I;  1VQ9 1;  3CCQ Z;  5C4X I;  3S17 I;  3S2H I;  2GTI A;  1YJW Z;  2W03 A;  1VQP Z;  1S72 1;  3EED A;  3GTO I;  1USP B;  1TWF I;  1NJI 1;  1VQL 1;  3D9X A;  1YHQ Z;  1X0T A;  3F3F C;  4RS4 A;  2WB1 A;  3VMI A;  1VQ8 Z;  1N8R 1;  2Q4Z A;  4MD8 A;  3CCV 1;  2OTL 1;  3CC2 Z;  3GTL I;  1VQ4 Z;  3MZL B;  1M1K 1;  4NBB A;  3CMA Z;  1VQ9 Z;  3I55 1;  3H3V J;  3LUS A;  2JNY A;  4S1T A;  3VMH A;  1S72 Z;  4AYB A;  3NDJ A;  1YI2 1;  2QRC B;  2KI7 B;  4DK1 A;  1Q7Y 1;  4RVF A;  1VQL Z;  3HOX I;  2QEX 1;  2JA8 I;  1DL6 A;  5D1O A;  4A3G I;  1X3Z A;  1JWH C;  3S1M I;  3S1Q I;  3CCV Z;  4BXX I;  2KPI A;  2OTL Z;  5A2Q f;  4A3M I;  3CD6 1;  1KC8 1;  1NP6 A;  3VB9 A;  3T4N B;  3I55 Z;  1N2F A;  2QR1 B;  1PFT A;  2RT9 A;  3J81 f;  3CC7 1;  1ML8 A;  4XX2 A;  1P9N A;  2EGT A;  3FKI I;  1QVF Z;  1YI2 Z;  2NVX I;  2J6A A;  4RVG A;  2Q51 A;  4A3K I;  1VQ7 1;  2QKD A;  2M6N A;  1YUA A;  3HOU I;  3GTP I;  2QEX Z;  1ZB8 A;  1VQ6 Z;  5FLM I;  1KRL A;  1X3W A;  1I3Q I;  5FLX f;  1NJI 2;  3G6E 1;  2JMO A;  2DE5 A;  5C4J I;  4NBA A;  4NOZ A;  3NFZ A;  1N8R 2;  4BY7 I;  1K9M 2;  2F4M A;  2QA4 1;  3CPW Y;  3CD6 Z;  2QRE B;  3RZO I;  5AN9 F;  3P5J B;  2OOX B;  3U50 C;  4BBR I;  1M1K 2;  5D1P A;  2O4H A;  3I4M I;  3CXC Y;  3CPW Z;  1TWA I;  1M90 1;  3CC7 Z;  2I3C A;  1VQO 1;  2BJO A;  1VQ7 Z;  4QTT A;  2NVT I;  1WCM I;  1I50 I;  3NH4 A;  3MON A;  1Q7Y 2;  2V8I A;  5T64 A;  2F4O A;  3G6E Z;  3GTK I;  2RBL A;  2Y0S A;  1L1O C;  4BY1 I;  1QYP A;  3GTJ I;  1K9M 1;  3GTQ I;  3S15 I;  2QA4 Z;  2P28 A;  1VQK 1;  3I4N I;  3CCJ 1;  4E2Z A;  2E2I I;  4MD7 A;  3J80 b;  1RLY A;  1RQF A;  1KC8 2;  4A3L I;  1VQO Z;  1YJ9 1;  3QWU A;  1JJ2 Y;  3M4O I;  3NH5 A;  1I6H I;  2HF1 A;  2JR6 A;  1SFO I;  4QTU A;  1Q86 1;  3HKZ A;  2VF1 A;  3CCE 1;  3G4S Z;  3KIF A;  1VQ6 1;  3FQM A;  4E32 A;  4HH4 A;  1NUI A;  1Q81 1;  3KIH A;  1USP A;  4HGY A;  1VQ5 1;  3OW2 Y;  2V8J A;  4NB8 A;  4NB9 A;  2V8K A;  3IFU A;  1K8A 1;  3JAM f;  3I56 1;  1Q82 1;  1VQK Z;  3OW2 Z;  3CCJ Z;  3TE5 B;  2K3R A;  3G71 1;  4A3C I;  4A3D I;  2YU9 I;  3CCL 1;  5IT9 b;  4MRI A;  1YJ9 Z;  3S16 I;  5T67 A;  1VLA A;  4DGL A;  1M90 2;  2YAD A;  2WAQ A;  4EWC A;  1TWG I;  1Z02 A;  4CL1 A;  4A3E I;  5LL6 f;  3CCE Z;  2R92 I;  3GTM S;  3S2D I;  4NBH A;  4Y7N I;  1TWC I;  3CC4 1;  2JA6 I;  3IX0 A;  3FQQ A;  2GU2 A;  1VQ5 Z;  3F3P C;  3CCM 1;  2B63 I;  2JA5 I;  4RVD A;  3M3Y I;  3I56 Z;  2QRD B;  2E2H I;  2VUG A;  4A3J I;  2P3Y A;  3G71 Z;  4A3B I;  1VQM 1;  4E30 A;  4HGZ A;  4A3F I;  1KQS Y;  3CCL Z;  3S1R I;  2LFU A;  2W04 A;  2NVQ I;  4NBG A;  3NH8 A;  2JUB A;  4E2W A;  4RV9 A;  1QF8 A;  2E9H A;  4MON A;  3CXC Z;  3I07 A;  1Y1V S;  1W2B Y;  1Q86 2;  1QVG Y;  3CC4 Z;  3G4S 1;  3VTN A;  1YJN 1;  5T6B A;  3CCM Z;  4A93 I;  1YIJ Z;  3IF8 A;  2PMZ A;  2GTH A;  1Q81 2;  1RO2 A;  2NVY I;  2IZ4 A;  1QVG Z;  3MZK B;  5C44 I;  4NBE A;  4TNU A;  1K83 I;  4X6A I;  2DE7 A;  5IP7 I;  3GTM I;  3PO3 S;  1K8A 2;  3HOY I;  3NDI A;  3BG0 B;  1VQM Z;  1Q82 2;  3HOV I;  5D1O B;  1R9T I;  5IP9 I;  4A3I I;  1WII A;  1KD1 1;  4DQY B;  2JS4 A;  2M48 A;  3K7A I;  1RO0 A;  1K73 1;  1JJ2 Z;  2R7Z I;  1YIT 1;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...