4CL1A

The crystal structure of ns5a domain 1 from genotype 1a reveals new clues to the mechanism of action for dimeric hcv inhibitors
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
155
Chain Sequence
PFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREVSFRVHEYPVGSQLPCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NON-STRUCTURAL PROTEIN 5A
publication title The Crystal Structure of Ns5A Domain 1 from Genotype 1A Reveals New Clues to the Mechanism of Action for Dimeric Hcv Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus (isolate h77)
total genus 25
structure length 155
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A02
3FQMA 4CL1A 1ZH1A 3FQQA
chains in the Genus database with same CATH superfamily
3CCMZ 2VPWA 3CCSZ 1QVFY 4NBFA 1PFTA 4RVFA 3S17I 4MONA 3G6E1 2JIQA 2VPXA 1M1K2 4E33A 2HU9A 1QF8A 1VQ81 2W03A 1Y1WI 1K731 2Q4ZA 1N2FA 3MONA 1Y1VS 2Q51A 2RHBA 1YJN1 5IT9f 2R7ZI 3MZKB 2R6MA 1WJ2A 2O4HA 3CCQ1 1WZNA 4RVGA 4A3JI 3NH5A 3CCJZ 1TWHI 1VQ51 4DQYB 2VPYA 4XX2A 4NBEA 2YU9I 1Y1VI 4NBGA 4TNUA 4NBDA 3G4S1 3I55Z 4E30A 1VQMZ 4NBHA 2QEXZ 2OTLZ 2VPZA 2JUBA 2VF1A 3K7AI 2GTIA 3IR7A 3CCU1 1M901 3NFZA 2LIYA 3CXCZ 1YIJZ 1JJ2Z 2F4MA 3OW2Z 4BBRI 1M1K1 1VQ61 3GTQI 3NDIA 3BG1B 3CCR1 1VQKZ 5A2Qf 4A3GI 3LUSA 3CCVZ 1VQLZ 4QTUA 3S1NI 1VQ9Z 3H3VJ 2JIPA 3J81b 3HOUI 2JA7I 3GTGI 4NBBA 2O53A 4NBAA 2NVQI 2J6AA 3QWUA 1TWAI 1VQ41 4Y52I 3CC2Z 2QRDB 2JNYA 2GTHA 3I4MI 2AKLA 2VUGA 1S72Z 1YJ91 3HOWI 3S1MI 3D2LA 3VTNA 2DE6A 3CCEZ 2QR1B 3NH4A 3BG0B 4DK1A 3CC7Z 1TFIA 2GU2A 4MD8A 1N8R1 3GTPI 5D1OA 5FLMI 1YHQZ 1JWHC 3J7A4 1RLYA 1L1OC 1WW9A 1R9TI 3NDJA 3KIFA 5CM2M 3PO2I 3CME1 3EEDA 2G2KA 2Y0SA 3CMA1 3VMGA 4BY1I 3EERA 1VQ71 4HGZA 4S1TA 2JIRA 2OOYB 3CCLZ 2QKDA 1S7MA 1M902 4RVHA 3TE5B 5D1OB 4MXUA 3FQMA 5IT9b 1YUAA 3S2DI 1W2BZ 1WCMI 3J80b 3RZOI 1QVGZ 3CCM1 1YI2Z 3CCS1 3G71Z 5C4XI 2EGTA 2ZAEB 1VQ8Z 4A3MI 1VQPZ 2V8KA 1YJNZ 3F3PC 3GTMS 2JA5I 5C3EI 1K9M2 1VQOZ 5AN9F 4MH4A 3NH8A 3CXCY 1JJ2Y 2IZ3A 2M6NA 3CCJ1 3OW2Y 3I07A 3S14I 5T64A 1DL6A 3G4SZ 4A3FI 4E2WA 5IP9I 1K8A2 2NVXI 3I56Z 3GTMI 3PO3S 3I551 1N8R2 4NH1C 1TWCI 2QEX1 1VQM1 3HOZI 1KC82 1VQNZ 3CCUZ 4X6AI 1YITZ 2RT9A 5FLXb 3JAMb 1YIJ1 4E2YA 5LL6f 4A3CI 3GKQA 1VQ6Z 3PO3I 3CCRZ 1ZH1A 3VMIA 1VQL1 1P9NA 4MD7A 3IF8A 1KD12 2PK7A 4EWCA 3CPWZ 1K9M1 3HKZA 2QA41 2H85A 1VQ91 3CQZI 4A93I 4CL1A 1I6HI 2OTJZ 2VUMI 3CD61 1YJWZ 3CC21 2QRCB 2P28A 4A3EI 1K8A1 1S721 1FDIA 3J81f 4NFRA 3IFUA 1KC81 3CCE1 4QTTA 4A3BI 3CC71 5T67A 3GTOI 2OZKA 1W2BY 3CC41 1RO0A 2V3VA 2F4OA 1ZB8A 2QLVB 1YHQ1 1QYPA 2NVYI 2NAPA 3CMEZ 2E9HA 1Q822 2NVTI 1VQ7Z 1NP6A 1KQSZ 4A3LI 4MD9A 1KD11 4Y7NI 3CCL1 4BBSI 1RO4A 1SIWA 2LFUA 3G6EZ 2DE7A 1I50I 1Z03A 2JS4A 1Q861 3GTLI 2JIOA 2P3YA 2LEXA 2B63I 4RV9A 1YI21 3TDHB 5C4JI 3G711 4HGYA 1Q16A 2R93I 2PM9A 4A3KI 3MZLB 1X0TA 1X3ZA 3CCQZ 2V8JA 3KIHA 1VQP1 3U50C 1VQ5Z 1Q7Y1 2JA6I 3D9XA 1SFOI 1QVFZ 2R92I 1ML8A 3Q87A 3J80f 2WB1A 1AA6A 1X3WA 2JA8I 1VQO1 4AYBA 4BY7I 2OOXB 1TWFI 4E32A 2E2HI 4NB9A 1QXFA 2V8IA 2IV2X 5A2Qb 3RZDI 1Q821 4A3DI 3S16I 3VMHA 2OTL1 1RNIA 1Q812 2WAQA 4BXXI 3I561 1RO2A 4RVDA 1VLAA 3CPWY 4HH4A 4NOZA 1WIIA 1VQN1 4A3II 1YIT1 3S2HI 1K83I 3FQQA 1VQK1 3VB9A 2JR6A 3GTKI 4E2XA 3T4NB 1FDOA 3CCV1 1YUKA 5C44I 3HOVI 3S15I 1LQLA 2E2JI 2K3RA 1NJI2 3H0GI 2RIQA 1VQ4Z 1Q862 2QREB 5FLXf 3ESWA 2QA4Z 3FKII 3JAMf 2BJOA 2KI7B 1Z01A 1Z02A 2RBLA 4NB8A 4NBCA 3IX0A 1USPA 1YJ9Z 3CD6Z 3F3FC 2PMZA 4E31A 2AYDA 2KPIA 2K5RA 2OTJ1 1K732 1KRLA 1YJW1 2JMOA 2V45A 4DGLA 3GTJI 1Q7Y2 1TWGI 1RQFA 1Q811 5IP7I 1KQSY 4MRIA 1QVGY 3HOYI 2E7ZA 2I3CA 4E2ZA 1USPB 3P5JB 2W04A 3CC4Z 3D6WA 2E2II 3CMAZ 3I4NI 2RPRA 5D1PA 3GCFA 3HOXI 3S1QI 1NUIA 3S1RI 1I3QI 2DE5A 5T6BA 1ZB9A 2M48A 2JIMA 2HF1A 3M3YI 4RS4A 1NJI1 2YADA 2IZ4A 3M4OI 1Y8CA
chains in the Genus database with same CATH topology
3CCMZ 3CCSZ 1QVFY 4NBFA 1PFTA 4RVFA 3S17I 4MONA 3G6E1 1M1K2 4E33A 2HU9A 1QF8A 1VQ81 2W03A 1Y1WI 1K731 2Q4ZA 1N2FA 3MONA 1Y1VS 2Q51A 2RHBA 1YJN1 5IT9f 2R7ZI 3MZKB 2R6MA 2O4HA 3CCQ1 4RVGA 4A3JI 3NH5A 3CCJZ 1TWHI 1VQ51 4DQYB 4XX2A 4NBEA 2YU9I 1Y1VI 4NBGA 4TNUA 4NBDA 3G4S1 3I55Z 4E30A 1VQMZ 4NBHA 2QEXZ 2OTLZ 2JUBA 2VF1A 3K7AI 2GTIA 3CCU1 1M901 3NFZA 2LIYA 3CXCZ 1YIJZ 1JJ2Z 2F4MA 3OW2Z 4BBRI 1M1K1 1VQ61 3GTQI 3NDIA 3BG1B 3CCR1 1VQKZ 5A2Qf 4A3GI 3LUSA 3CCVZ 1VQLZ 4QTUA 3S1NI 1VQ9Z 3H3VJ 3J81b 3HOUI 2JA7I 3GTGI 4NBBA 2O53A 4NBAA 2NVQI 2J6AA 3QWUA 1TWAI 1VQ41 4Y52I 3CC2Z 2QRDB 2JNYA 2GTHA 3I4MI 2AKLA 2VUGA 1S72Z 1YJ91 3HOWI 3S1MI 3VTNA 2DE6A 3CCEZ 2QR1B 3NH4A 3BG0B 4DK1A 3CC7Z 1TFIA 2GU2A 4MD8A 1N8R1 3GTPI 5D1OA 5FLMI 1YHQZ 1JWHC 3J7A4 1RLYA 1L1OC 1WW9A 1R9TI 3NDJA 3KIFA 5CM2M 3PO2I 3CME1 3EEDA 2G2KA 2Y0SA 3CMA1 3VMGA 4BY1I 3EERA 1VQ71 4HGZA 4S1TA 2OOYB 3CCLZ 2QKDA 1S7MA 1M902 4RVHA 3TE5B 5D1OB 4MXUA 3FQMA 5IT9b 1YUAA 3S2DI 1W2BZ 1WCMI 3J80b 3RZOI 1QVGZ 3CCM1 1YI2Z 3CCS1 3G71Z 5C4XI 2EGTA 2ZAEB 1VQ8Z 4A3MI 1VQPZ 2V8KA 1YJNZ 3F3PC 3GTMS 2JA5I 5C3EI 1K9M2 1VQOZ 5AN9F 4MH4A 3NH8A 3CXCY 1JJ2Y 2IZ3A 2M6NA 3CCJ1 3OW2Y 3I07A 3S14I 5T64A 1DL6A 3G4SZ 4A3FI 4E2WA 5IP9I 1K8A2 2NVXI 3I56Z 3GTMI 3PO3S 3I551 1N8R2 4NH1C 1TWCI 2QEX1 1VQM1 3HOZI 1KC82 1VQNZ 3CCUZ 4X6AI 1YITZ 2RT9A 5FLXb 3JAMb 1YIJ1 4E2YA 5LL6f 4A3CI 3GKQA 1VQ6Z 3PO3I 3CCRZ 1ZH1A 3VMIA 1VQL1 1P9NA 4MD7A 3IF8A 1KD12 2PK7A 4EWCA 3CPWZ 1K9M1 3HKZA 2QA41 2H85A 1VQ91 3CQZI 4A93I 4CL1A 1I6HI 2OTJZ 2VUMI 3CD61 1YJWZ 3CC21 2QRCB 2P28A 4A3EI 1K8A1 1S721 3J81f 4NFRA 3IFUA 1KC81 3CCE1 4QTTA 4A3BI 3CC71 5T67A 3GTOI 2OZKA 1W2BY 3CC41 1RO0A 2F4OA 1ZB8A 2QLVB 1YHQ1 1QYPA 2NVYI 3CMEZ 2E9HA 1Q822 2NVTI 1VQ7Z 1NP6A 1KQSZ 4A3LI 4MD9A 1KD11 4Y7NI 3CCL1 4BBSI 1RO4A 2LFUA 3G6EZ 2DE7A 1I50I 1Z03A 2JS4A 1Q861 3GTLI 2P3YA 2B63I 4RV9A 1YI21 3TDHB 5C4JI 3G711 4HGYA 2R93I 2PM9A 4A3KI 3MZLB 1X0TA 1X3ZA 3CCQZ 2V8JA 3KIHA 1VQP1 3U50C 1VQ5Z 1Q7Y1 2JA6I 3D9XA 1SFOI 1QVFZ 2R92I 1ML8A 3Q87A 3J80f 2WB1A 1X3WA 2JA8I 1VQO1 4AYBA 4BY7I 2OOXB 1TWFI 4E32A 2E2HI 4NB9A 2V8IA 5A2Qb 1Q821 3RZDI 4A3DI 3S16I 3VMHA 2OTL1 1RNIA 1Q812 2WAQA 4BXXI 3I561 1RO2A 4RVDA 1VLAA 3CPWY 4HH4A 4NOZA 1WIIA 1VQN1 4A3II 1YIT1 3S2HI 1K83I 3FQQA 1VQK1 3VB9A 2JR6A 3GTKI 4E2XA 3T4NB 3CCV1 1YUKA 5C44I 3HOVI 3S15I 1LQLA 2E2JI 2K3RA 1NJI2 3H0GI 2RIQA 1VQ4Z 1Q862 2QREB 5FLXf 3ESWA 2QA4Z 3FKII 3JAMf 2BJOA 2KI7B 1Z01A 1Z02A 2RBLA 4NB8A 4NBCA 3IX0A 1USPA 1YJ9Z 3CD6Z 3F3FC 2PMZA 4E31A 2KPIA 2K5RA 2OTJ1 1K732 1KRLA 1YJW1 2JMOA 4DGLA 3GTJI 1Q7Y2 1TWGI 1RQFA 1Q811 5IP7I 1KQSY 4MRIA 1QVGY 3HOYI 2I3CA 4E2ZA 1USPB 3P5JB 2W04A 3CC4Z 3D6WA 2E2II 3CMAZ 3I4NI 2RPRA 5D1PA 3GCFA 3HOXI 3S1QI 1NUIA 3S1RI 1I3QI 2DE5A 5T6BA 1ZB9A 2M48A 2HF1A 3M3YI 4RS4A 1NJI1 2YADA 2IZ4A 3M4OI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FQM A;  4CL1 A;  1ZH1 A;  3FQQ A; 
#chains in the Genus database with same CATH topology
 3CCM Z;  2VPW A;  3CCS Z;  1QVF Y;  4NBF A;  1PFT A;  4RVF A;  3S17 I;  4MON A;  3G6E 1;  2JIQ A;  2VPX A;  1M1K 2;  4E33 A;  2HU9 A;  1QF8 A;  1VQ8 1;  2W03 A;  1Y1W I;  1K73 1;  2Q4Z A;  1N2F A;  3MON A;  1Y1V S;  2Q51 A;  2RHB A;  1YJN 1;  5IT9 f;  2R7Z I;  3MZK B;  2R6M A;  1WJ2 A;  2O4H A;  3CCQ 1;  1WZN A;  4RVG A;  4A3J I;  3NH5 A;  3CCJ Z;  1TWH I;  1VQ5 1;  4DQY B;  2VPY A;  4XX2 A;  4NBE A;  2YU9 I;  1Y1V I;  4NBG A;  4TNU A;  4NBD A;  3G4S 1;  3I55 Z;  4E30 A;  1VQM Z;  4NBH A;  2QEX Z;  2OTL Z;  2VPZ A;  2JUB A;  2VF1 A;  3K7A I;  2GTI A;  3IR7 A;  3CCU 1;  1M90 1;  3NFZ A;  2LIY A;  3CXC Z;  1YIJ Z;  1JJ2 Z;  2F4M A;  3OW2 Z;  4BBR I;  1M1K 1;  1VQ6 1;  3GTQ I;  3NDI A;  3BG1 B;  3CCR 1;  1VQK Z;  5A2Q f;  4A3G I;  3LUS A;  3CCV Z;  1VQL Z;  4QTU A;  3S1N I;  1VQ9 Z;  3H3V J;  2JIP A;  3J81 b;  3HOU I;  2JA7 I;  3GTG I;  4NBB A;  2O53 A;  4NBA A;  2NVQ I;  2J6A A;  3QWU A;  1TWA I;  1VQ4 1;  4Y52 I;  3CC2 Z;  2QRD B;  2JNY A;  2GTH A;  3I4M I;  2AKL A;  2VUG A;  1S72 Z;  1YJ9 1;  3HOW I;  3S1M I;  3D2L A;  3VTN A;  2DE6 A;  3CCE Z;  2QR1 B;  3NH4 A;  3BG0 B;  4DK1 A;  3CC7 Z;  1TFI A;  2GU2 A;  4MD8 A;  1N8R 1;  3GTP I;  5D1O A;  5FLM I;  1YHQ Z;  1JWH C;  3J7A 4;  1RLY A;  1L1O C;  1WW9 A;  1R9T I;  3NDJ A;  3KIF A;  5CM2 M;  3PO2 I;  3CME 1;  3EED A;  2G2K A;  2Y0S A;  3CMA 1;  3VMG A;  4BY1 I;  3EER A;  1VQ7 1;  4HGZ A;  4S1T A;  2JIR A;  2OOY B;  3CCL Z;  2QKD A;  1S7M A;  1M90 2;  4RVH A;  3TE5 B;  5D1O B;  4MXU A;  3FQM A;  5IT9 b;  1YUA A;  3S2D I;  1W2B Z;  1WCM I;  3J80 b;  3RZO I;  1QVG Z;  3CCM 1;  1YI2 Z;  3CCS 1;  3G71 Z;  5C4X I;  2EGT A;  2ZAE B;  1VQ8 Z;  4A3M I;  1VQP Z;  2V8K A;  1YJN Z;  3F3P C;  3GTM S;  2JA5 I;  5C3E I;  1K9M 2;  1VQO Z;  5AN9 F;  4MH4 A;  3NH8 A;  3CXC Y;  1JJ2 Y;  2IZ3 A;  2M6N A;  3CCJ 1;  3OW2 Y;  3I07 A;  3S14 I;  5T64 A;  1DL6 A;  3G4S Z;  4A3F I;  4E2W A;  5IP9 I;  1K8A 2;  2NVX I;  3I56 Z;  3GTM I;  3PO3 S;  3I55 1;  1N8R 2;  4NH1 C;  1TWC I;  2QEX 1;  1VQM 1;  3HOZ I;  1KC8 2;  1VQN Z;  3CCU Z;  4X6A I;  1YIT Z;  2RT9 A;  5FLX b;  3JAM b;  1YIJ 1;  4E2Y A;  5LL6 f;  4A3C I;  3GKQ A;  1VQ6 Z;  3PO3 I;  3CCR Z;  1ZH1 A;  3VMI A;  1VQL 1;  1P9N A;  4MD7 A;  3IF8 A;  1KD1 2;  2PK7 A;  4EWC A;  3CPW Z;  1K9M 1;  3HKZ A;  2QA4 1;  2H85 A;  1VQ9 1;  3CQZ I;  4A93 I;  4CL1 A;  1I6H I;  2OTJ Z;  2VUM I;  3CD6 1;  1YJW Z;  3CC2 1;  2QRC B;  2P28 A;  4A3E I;  1K8A 1;  1S72 1;  1FDI A;  3J81 f;  4NFR A;  3IFU A;  1KC8 1;  3CCE 1;  4QTT A;  4A3B I;  3CC7 1;  5T67 A;  3GTO I;  2OZK A;  1W2B Y;  3CC4 1;  1RO0 A;  2V3V A;  2F4O A;  1ZB8 A;  2QLV B;  1YHQ 1;  1QYP A;  2NVY I;  2NAP A;  3CME Z;  2E9H A;  1Q82 2;  2NVT I;  1VQ7 Z;  1NP6 A;  1KQS Z;  4A3L I;  4MD9 A;  1KD1 1;  4Y7N I;  3CCL 1;  4BBS I;  1RO4 A;  1SIW A;  2LFU A;  3G6E Z;  2DE7 A;  1I50 I;  1Z03 A;  2JS4 A;  1Q86 1;  3GTL I;  2JIO A;  2P3Y A;  2LEX A;  2B63 I;  4RV9 A;  1YI2 1;  3TDH B;  5C4J I;  3G71 1;  4HGY A;  1Q16 A;  2R93 I;  2PM9 A;  4A3K I;  3MZL B;  1X0T A;  1X3Z A;  3CCQ Z;  2V8J A;  3KIH A;  1VQP 1;  3U50 C;  1VQ5 Z;  1Q7Y 1;  2JA6 I;  3D9X A;  1SFO I;  1QVF Z;  2R92 I;  1ML8 A;  3Q87 A;  3J80 f;  2WB1 A;  1AA6 A;  1X3W A;  2JA8 I;  1VQO 1;  4AYB A;  4BY7 I;  2OOX B;  1TWF I;  4E32 A;  2E2H I;  4NB9 A;  1QXF A;  2V8I A;  2IV2 X;  5A2Q b;  3RZD I;  1Q82 1;  4A3D I;  3S16 I;  3VMH A;  2OTL 1;  1RNI A;  1Q81 2;  2WAQ A;  4BXX I;  3I56 1;  1RO2 A;  4RVD A;  1VLA A;  3CPW Y;  4HH4 A;  4NOZ A;  1WII A;  1VQN 1;  4A3I I;  1YIT 1;  3S2H I;  1K83 I;  3FQQ A;  1VQK 1;  3VB9 A;  2JR6 A;  3GTK I;  4E2X A;  3T4N B;  1FDO A;  3CCV 1;  1YUK A;  5C44 I;  3HOV I;  3S15 I;  1LQL A;  2E2J I;  2K3R A;  1NJI 2;  3H0G I;  2RIQ A;  1VQ4 Z;  1Q86 2;  2QRE B;  5FLX f;  3ESW A;  2QA4 Z;  3FKI I;  3JAM f;  2BJO A;  2KI7 B;  1Z01 A;  1Z02 A;  2RBL A;  4NB8 A;  4NBC A;  3IX0 A;  1USP A;  1YJ9 Z;  3CD6 Z;  3F3F C;  2PMZ A;  4E31 A;  2AYD A;  2KPI A;  2K5R A;  2OTJ 1;  1K73 2;  1KRL A;  1YJW 1;  2JMO A;  2V45 A;  4DGL A;  3GTJ I;  1Q7Y 2;  1TWG I;  1RQF A;  1Q81 1;  5IP7 I;  1KQS Y;  4MRI A;  1QVG Y;  3HOY I;  2E7Z A;  2I3C A;  4E2Z A;  1USP B;  3P5J B;  2W04 A;  3CC4 Z;  3D6W A;  2E2I I;  3CMA Z;  3I4N I;  2RPR A;  5D1P A;  3GCF A;  3HOX I;  3S1Q I;  1NUI A;  3S1R I;  1I3Q I;  2DE5 A;  5T6B A;  1ZB9 A;  2M48 A;  2JIM A;  2HF1 A;  3M3Y I;  4RS4 A;  1NJI 1;  2YAD A;  2IZ4 A;  3M4O I;  1Y8C A; 
#chains in the Genus database with same CATH homology
 3CCM Z;  3CCS Z;  1QVF Y;  4NBF A;  1PFT A;  4RVF A;  3S17 I;  4MON A;  3G6E 1;  1M1K 2;  4E33 A;  2HU9 A;  1QF8 A;  1VQ8 1;  2W03 A;  1Y1W I;  1K73 1;  2Q4Z A;  1N2F A;  3MON A;  1Y1V S;  2Q51 A;  2RHB A;  1YJN 1;  5IT9 f;  2R7Z I;  3MZK B;  2R6M A;  2O4H A;  3CCQ 1;  4RVG A;  4A3J I;  3NH5 A;  3CCJ Z;  1TWH I;  1VQ5 1;  4DQY B;  4XX2 A;  4NBE A;  2YU9 I;  1Y1V I;  4NBG A;  4TNU A;  4NBD A;  3G4S 1;  3I55 Z;  4E30 A;  1VQM Z;  4NBH A;  2QEX Z;  2OTL Z;  2JUB A;  2VF1 A;  3K7A I;  2GTI A;  3CCU 1;  1M90 1;  3NFZ A;  2LIY A;  3CXC Z;  1YIJ Z;  1JJ2 Z;  2F4M A;  3OW2 Z;  4BBR I;  1M1K 1;  1VQ6 1;  3GTQ I;  3NDI A;  3BG1 B;  3CCR 1;  1VQK Z;  5A2Q f;  4A3G I;  3LUS A;  3CCV Z;  1VQL Z;  4QTU A;  3S1N I;  1VQ9 Z;  3H3V J;  3J81 b;  3HOU I;  2JA7 I;  3GTG I;  4NBB A;  2O53 A;  4NBA A;  2NVQ I;  2J6A A;  3QWU A;  1TWA I;  1VQ4 1;  4Y52 I;  3CC2 Z;  2QRD B;  2JNY A;  2GTH A;  3I4M I;  2AKL A;  2VUG A;  1S72 Z;  1YJ9 1;  3HOW I;  3S1M I;  3VTN A;  2DE6 A;  3CCE Z;  2QR1 B;  3NH4 A;  3BG0 B;  4DK1 A;  3CC7 Z;  1TFI A;  2GU2 A;  4MD8 A;  1N8R 1;  3GTP I;  5D1O A;  5FLM I;  1YHQ Z;  1JWH C;  3J7A 4;  1RLY A;  1L1O C;  1WW9 A;  1R9T I;  3NDJ A;  3KIF A;  5CM2 M;  3PO2 I;  3CME 1;  3EED A;  2G2K A;  2Y0S A;  3CMA 1;  3VMG A;  4BY1 I;  3EER A;  1VQ7 1;  4HGZ A;  4S1T A;  2OOY B;  3CCL Z;  2QKD A;  1S7M A;  1M90 2;  4RVH A;  3TE5 B;  5D1O B;  4MXU A;  3FQM A;  5IT9 b;  1YUA A;  3S2D I;  1W2B Z;  1WCM I;  3J80 b;  3RZO I;  1QVG Z;  3CCM 1;  1YI2 Z;  3CCS 1;  3G71 Z;  5C4X I;  2EGT A;  2ZAE B;  1VQ8 Z;  4A3M I;  1VQP Z;  2V8K A;  1YJN Z;  3F3P C;  3GTM S;  2JA5 I;  5C3E I;  1K9M 2;  1VQO Z;  5AN9 F;  4MH4 A;  3NH8 A;  3CXC Y;  1JJ2 Y;  2IZ3 A;  2M6N A;  3CCJ 1;  3OW2 Y;  3I07 A;  3S14 I;  5T64 A;  1DL6 A;  3G4S Z;  4A3F I;  4E2W A;  5IP9 I;  1K8A 2;  2NVX I;  3I56 Z;  3GTM I;  3PO3 S;  3I55 1;  1N8R 2;  4NH1 C;  1TWC I;  2QEX 1;  1VQM 1;  3HOZ I;  1KC8 2;  1VQN Z;  3CCU Z;  4X6A I;  1YIT Z;  2RT9 A;  5FLX b;  3JAM b;  1YIJ 1;  4E2Y A;  5LL6 f;  4A3C I;  3GKQ A;  1VQ6 Z;  3PO3 I;  3CCR Z;  1ZH1 A;  3VMI A;  1VQL 1;  1P9N A;  4MD7 A;  3IF8 A;  1KD1 2;  2PK7 A;  4EWC A;  3CPW Z;  1K9M 1;  3HKZ A;  2QA4 1;  2H85 A;  1VQ9 1;  3CQZ I;  4A93 I;  4CL1 A;  1I6H I;  2OTJ Z;  2VUM I;  3CD6 1;  1YJW Z;  3CC2 1;  2QRC B;  2P28 A;  4A3E I;  1K8A 1;  1S72 1;  3J81 f;  4NFR A;  3IFU A;  1KC8 1;  3CCE 1;  4QTT A;  4A3B I;  3CC7 1;  5T67 A;  3GTO I;  2OZK A;  1W2B Y;  3CC4 1;  1RO0 A;  2F4O A;  1ZB8 A;  2QLV B;  1YHQ 1;  1QYP A;  2NVY I;  3CME Z;  2E9H A;  1Q82 2;  2NVT I;  1VQ7 Z;  1NP6 A;  1KQS Z;  4A3L I;  4MD9 A;  1KD1 1;  4Y7N I;  3CCL 1;  4BBS I;  1RO4 A;  2LFU A;  3G6E Z;  2DE7 A;  1I50 I;  1Z03 A;  2JS4 A;  1Q86 1;  3GTL I;  2P3Y A;  2B63 I;  4RV9 A;  1YI2 1;  3TDH B;  5C4J I;  3G71 1;  4HGY A;  2R93 I;  2PM9 A;  4A3K I;  3MZL B;  1X0T A;  1X3Z A;  3CCQ Z;  2V8J A;  3KIH A;  1VQP 1;  3U50 C;  1VQ5 Z;  1Q7Y 1;  2JA6 I;  3D9X A;  1SFO I;  1QVF Z;  2R92 I;  1ML8 A;  3Q87 A;  3J80 f;  2WB1 A;  1X3W A;  2JA8 I;  1VQO 1;  4AYB A;  4BY7 I;  2OOX B;  1TWF I;  4E32 A;  2E2H I;  4NB9 A;  2V8I A;  5A2Q b;  1Q82 1;  3RZD I;  4A3D I;  3S16 I;  3VMH A;  2OTL 1;  1RNI A;  1Q81 2;  2WAQ A;  4BXX I;  3I56 1;  1RO2 A;  4RVD A;  1VLA A;  3CPW Y;  4HH4 A;  4NOZ A;  1WII A;  1VQN 1;  4A3I I;  1YIT 1;  3S2H I;  1K83 I;  3FQQ A;  1VQK 1;  3VB9 A;  2JR6 A;  3GTK I;  4E2X A;  3T4N B;  3CCV 1;  1YUK A;  5C44 I;  3HOV I;  3S15 I;  1LQL A;  2E2J I;  2K3R A;  1NJI 2;  3H0G I;  2RIQ A;  1VQ4 Z;  1Q86 2;  2QRE B;  5FLX f;  3ESW A;  2QA4 Z;  3FKI I;  3JAM f;  2BJO A;  2KI7 B;  1Z01 A;  1Z02 A;  2RBL A;  4NB8 A;  4NBC A;  3IX0 A;  1USP A;  1YJ9 Z;  3CD6 Z;  3F3F C;  2PMZ A;  4E31 A;  2KPI A;  2K5R A;  2OTJ 1;  1K73 2;  1KRL A;  1YJW 1;  2JMO A;  4DGL A;  3GTJ I;  1Q7Y 2;  1TWG I;  1RQF A;  1Q81 1;  5IP7 I;  1KQS Y;  4MRI A;  1QVG Y;  3HOY I;  2I3C A;  4E2Z A;  1USP B;  3P5J B;  2W04 A;  3CC4 Z;  3D6W A;  2E2I I;  3CMA Z;  3I4N I;  2RPR A;  5D1P A;  3GCF A;  3HOX I;  3S1Q I;  1NUI A;  3S1R I;  1I3Q I;  2DE5 A;  5T6B A;  1ZB9 A;  2M48 A;  2HF1 A;  3M3Y I;  4RS4 A;  1NJI 1;  2YAD A;  2IZ4 A;  3M4O I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...