4CL1A

The crystal structure of ns5a domain 1 from genotype 1a reveals new clues to the mechanism of action for dimeric hcv inhibitors
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
155
Chain Sequence
PFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREVSFRVHEYPVGSQLPCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 5A
publication title The Crystal Structure of Ns5A Domain 1 from Genotype 1A Reveals New Clues to the Mechanism of Action for Dimeric Hcv Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus (isolate h77)
molecule tags Viral protein
total genus 25
structure length 155
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A02
4CL1A 3FQQA 3FQMA 1ZH1A
chains in the Genus database with same CATH superfamily
2R7ZI 4TNUA 4A3FI 1VQM1 1YI2Z 2Y0SA 2PK7A 3IF8A 3CCMZ 3JAMb 4E30A 2HF1A 2OTJZ 1K732 3KIFA 5C44I 1N8R2 4QTUA 2JS4A 4Y7NI 1VQO1 3RZOI 3G6EZ 1YJNZ 1P9NA 3G4SZ 2AYDA 3HOVI 1TWFI 4A3II 1RO2A 4E2WA 2RBLA 1NP6A 2NVQI 3HOWI 1QVGY 2QLVB 3TDHB 1Y8CA 4E32A 2F4MA 5T67A 4MXUA 1Q16A 2OOYB 4NBCA 5T6BA 1VQ91 1SFOI 3T4NB 2JMOA 3JAMf 3M3YI 3NH8A 3P5JB 5C4XI 3GTMI 2K5RA 4BXXI 2JIPA 3EERA 1ML8A 3CC71 2H85A 2AKLA 2LEXA 1USPB 4E31A 2QRDB 3CMEZ 3CCQ1 3MONA 1KRLA 4DQYB 3CMA1 1VQ5Z 1AA6A 5IP7I 3PO3I 1YIT1 5FLMI 4NFRA 1JJ2Y 1LQLA 5D1PA 3CCSZ 1Z03A 3EEDA 1VQKZ 4RV9A 1QVFZ 3CPWY 1VQ6Z 5C4JI 1Q7Y2 4RVGA 3GTQI 1TWCI 3OW2Z 2GU2A 1KD11 1DL6A 2YADA 1Z01A 1Q822 2OZKA 1I50I 1YJW1 1VQPZ 4MD8A 1VQ4Z 2YU9I 1Q861 1I6HI 1QXFA 3GTLI 3VMGA 2VUGA 4NB9A 3OW2Y 1KC82 4A3MI 3S16I 1W2BZ 2GTHA 3CC41 2V8KA 2E2II 4RVFA 1VQ81 4NBHA 1M901 3PO2I 2VPWA 2JNYA 1M1K1 1RQFA 1VQ41 2NAPA 2VPXA 2M6NA 3CCL1 1WW9A 3CCR1 2IZ3A 2JUBA 2F4OA 4QTTA 4A3GI 2RT9A 1Q812 2QR1B 3TE5B 3G711 3CCU1 3BG1B 1K9M1 3CC2Z 2ZAEB 2B63I 1VQNZ 1K9M2 3IR7A 1K731 4A3KI 1N8R1 1QVGZ 4X6AI 1Y1VI 1RO0A 4E33A 1NJI2 2QA4Z 2R92I 3I55Z 3CD6Z 1ZH1A 3GCFA 4NOZA 1WZNA 3CXCY 4MH4A 4NB8A 3F3FC 3I07A 2DE6A 3CCEZ 1YJ91 1TWGI 3D2LA 4NBEA 3VB9A 2NVTI 4XX2A 1YI21 4NBDA 3CCM1 4A3LI 3D6WA 2OTJ1 1RLYA 1YUKA 1Z02A 3I56Z 4DK1A 3S1QI 1JJ2Z 3G6E1 1YJN1 2JA6I 3G4S1 1L1OC 3CCJZ 3J81b 2WB1A 2P3YA 3S2HI 4A3DI 3CPWZ 3K7AI 3H0GI 3NDIA 1TWAI 2RIQA 1YHQZ 1WIIA 4S1TA 2V8JA 1YIJZ 1S7MA 2O4HA 3VTNA 2K3RA 5D1OA 4A3JI 1Q7Y1 1FDIA 1R9TI 4A3CI 3HOXI 2JA5I 4Y52I 3S1RI 1FDOA 2QREB 3D9XA 4E2YA 3J81f 1Q821 3Q87A 3CME1 1WJ2A 2KI7B 1VQ51 1RNIA 2E9HA 1KQSY 2LIYA 3NDJA 2OTLZ 4RVHA 3NFZA 1QYPA 3CCS1 3HOZI 3MZLB 1KC81 2QEXZ 3H3VJ 1VQK1 1VQ61 3FQQA 3S1MI 5LL6f 1YUAA 2P28A 2VPYA 1ZB8A 2V3VA 3MZKB 2JA8I 3GTKI 2VPZA 5CM2M 1TFIA 1VQP1 4RS4A 2JIOA 4MRIA 1Q811 1I3QI 2Q4ZA 3RZDI 2O53A 3CCVZ 1QF8A 3GTMS 1X3ZA 3F3PC 2QRCB 2GTIA 4NBAA 1S72Z 3S15I 3S2DI 4RVDA 3CXCZ 1VQLZ 3J7A4 3PO3S 1X3WA 2R6MA 3U50C 2KPIA 1NJI1 2M48A 4EWCA 5IT9b 1VQMZ 2JR6A 2W04A 3S17I 2WAQA 2R93I 2EGTA 3IX0A 3GTOI 1VQOZ 5T64A 3CC21 4E2ZA 2NVXI 2PMZA 4BBSI 4NH1C 1X0TA 2DE5A 1VQN1 1ZB9A 1K8A2 1Y1WI 5IT9f 2VF1A 2JIMA 2I3CA 1VQ9Z 5FLXb 2NVYI 2QA41 1N2FA 2J6AA 3S1NI 3I551 3CD61 3GTGI 4BBRI 3CC7Z 4HGYA 3CCE1 4DGLA 3CCQZ 3IFUA 3CMAZ 3GKQA 5D1OB 1YITZ 5FLXf 2E2JI 4MD9A 3I561 3I4NI 2RPRA 1KQSZ 1WCMI 2IZ4A 1RO4A 3CCJ1 2IV2X 3M4OI 1JWHC 2RHBA 3NH5A 1USPA 1YHQ1 3GTJI 3QWUA 1YIJ1 1Y1VS 4AYBA 3LUSA 1VQ7Z 1YJWZ 4HGZA 3HOUI 3HOYI 3ESWA 3FKII 2JA7I 5C3EI 2OOXB 2HU9A 4MD7A 4A93I 3VMHA 2E7ZA 3CC4Z 3GTPI 1VQ8Z 3J80b 3HKZA 2JIRA 5IP9I 2BJOA 2OTL1 1VQ71 3FQMA 1KD12 3S14I 4NBFA 1QVFY 3CCLZ 4HH4A 2QEX1 3CCRZ 3I4MI 4NBGA 3CQZI 2G2KA 1Q862 3KIHA 2E2HI 4CL1A 3G71Z 3NH4A 2V8IA 3CCUZ 5A2Qb 4BY7I 4MONA 2QKDA 1K83I 2Q51A 3J80f 4NBBA 2LFUA 3CCV1 3VMIA 1M902 4BY1I 1M1K2 2VUMI 2DE7A 4A3BI 1TWHI 1SIWA 1W2BY 4A3EI 1PFTA 2JIQA 2PM9A 2W03A 3BG0B 1S721 1VLAA 2V45A 1NUIA 1K8A1 5A2Qf 1VQL1 1YJ9Z 4E2XA 5AN9F
chains in the Genus database with same CATH topology
2R7ZI 4TNUA 4A3FI 1VQM1 1YI2Z 2Y0SA 2PK7A 3IF8A 3CCMZ 3JAMb 4E30A 2HF1A 2OTJZ 1K732 3KIFA 5C44I 1N8R2 4QTUA 2JS4A 4Y7NI 1VQO1 3RZOI 3G6EZ 1YJNZ 1P9NA 3G4SZ 3HOVI 1TWFI 4A3II 1RO2A 4E2WA 2RBLA 1NP6A 2NVQI 3HOWI 1QVGY 2QLVB 3TDHB 4E32A 2F4MA 5T67A 4MXUA 2OOYB 4NBCA 5T6BA 1VQ91 1SFOI 3T4NB 2JMOA 3JAMf 3M3YI 3NH8A 3P5JB 5C4XI 3GTMI 2K5RA 4BXXI 3EERA 1ML8A 3CC71 2H85A 2AKLA 1USPB 4E31A 2QRDB 3CMEZ 3CCQ1 3MONA 1KRLA 4DQYB 3CMA1 1VQ5Z 5IP7I 3PO3I 1YIT1 5FLMI 4NFRA 1JJ2Y 1LQLA 5D1PA 3CCSZ 1Z03A 3EEDA 1VQKZ 4RV9A 1QVFZ 3CPWY 1VQ6Z 5C4JI 1Q7Y2 4RVGA 3GTQI 1TWCI 3OW2Z 2GU2A 1KD11 1DL6A 2YADA 1Z01A 1Q822 2OZKA 1I50I 1YJW1 1VQPZ 4MD8A 1VQ4Z 2YU9I 1Q861 1I6HI 3GTLI 3VMGA 2VUGA 4NB9A 3OW2Y 1KC82 4A3MI 3S16I 1W2BZ 2GTHA 3CC41 2V8KA 2E2II 4RVFA 1VQ81 4NBHA 1M901 3PO2I 2JNYA 1M1K1 1RQFA 1VQ41 2M6NA 3CCL1 1WW9A 3CCR1 2IZ3A 2JUBA 2F4OA 4QTTA 4A3GI 2RT9A 1Q812 2QR1B 3TE5B 3G711 3CCU1 3BG1B 1K9M1 3CC2Z 2ZAEB 2B63I 1VQNZ 1K9M2 1K731 4A3KI 1N8R1 1QVGZ 4X6AI 1Y1VI 1RO0A 4E33A 1NJI2 2QA4Z 2R92I 3I55Z 3CD6Z 1ZH1A 3GCFA 4NOZA 3CXCY 4MH4A 4NB8A 3F3FC 3I07A 2DE6A 3CCEZ 1YJ91 1TWGI 4NBEA 3VB9A 2NVTI 4XX2A 1YI21 4NBDA 3CCM1 4A3LI 3D6WA 2OTJ1 1RLYA 1YUKA 1Z02A 3I56Z 4DK1A 3S1QI 1JJ2Z 3G6E1 1YJN1 2JA6I 3G4S1 1L1OC 3CCJZ 3J81b 2WB1A 2P3YA 3S2HI 4A3DI 3CPWZ 3K7AI 3H0GI 3NDIA 1TWAI 2RIQA 1YHQZ 1WIIA 4S1TA 2V8JA 1YIJZ 1S7MA 2O4HA 3VTNA 2K3RA 5D1OA 4A3JI 1Q7Y1 1R9TI 4A3CI 3HOXI 2JA5I 4Y52I 3S1RI 2QREB 3D9XA 4E2YA 3J81f 1Q821 3Q87A 3CME1 2KI7B 1VQ51 1RNIA 2E9HA 1KQSY 2LIYA 3NDJA 2OTLZ 4RVHA 3NFZA 1QYPA 3CCS1 3HOZI 3MZLB 1KC81 2QEXZ 3H3VJ 1VQK1 1VQ61 3FQQA 3S1MI 5LL6f 1YUAA 2P28A 1ZB8A 3MZKB 2JA8I 3GTKI 5CM2M 1TFIA 1VQP1 4RS4A 4MRIA 1Q811 1I3QI 2Q4ZA 3RZDI 2O53A 3CCVZ 1QF8A 3GTMS 1X3ZA 3F3PC 2QRCB 2GTIA 4NBAA 1S72Z 3S15I 3S2DI 4RVDA 3CXCZ 1VQLZ 3J7A4 3PO3S 1X3WA 2R6MA 3U50C 2KPIA 1NJI1 2M48A 4EWCA 5IT9b 1VQMZ 2JR6A 2W04A 3S17I 2WAQA 2R93I 2EGTA 3IX0A 3GTOI 1VQOZ 5T64A 3CC21 4E2ZA 2NVXI 2PMZA 4BBSI 4NH1C 1X0TA 2DE5A 1VQN1 1ZB9A 1K8A2 1Y1WI 5IT9f 2VF1A 2I3CA 1VQ9Z 5FLXb 2NVYI 2QA41 1N2FA 2J6AA 3S1NI 3I551 3CD61 3GTGI 4BBRI 3CC7Z 4HGYA 3CCE1 4DGLA 3CCQZ 3IFUA 3CMAZ 3GKQA 5D1OB 1YITZ 5FLXf 2E2JI 4MD9A 3I561 3I4NI 2RPRA 1KQSZ 1WCMI 2IZ4A 1RO4A 3CCJ1 3M4OI 1JWHC 2RHBA 3NH5A 1USPA 1YHQ1 3GTJI 3QWUA 1YIJ1 1Y1VS 4AYBA 3LUSA 1VQ7Z 1YJWZ 4HGZA 3HOUI 3HOYI 3ESWA 3FKII 2JA7I 5C3EI 2OOXB 2HU9A 4MD7A 4A93I 3VMHA 3CC4Z 3GTPI 1VQ8Z 3J80b 3HKZA 5IP9I 2BJOA 2OTL1 1VQ71 3FQMA 1KD12 3S14I 4NBFA 1QVFY 3CCLZ 4HH4A 2QEX1 3CCRZ 3I4MI 4NBGA 3CQZI 2G2KA 1Q862 3KIHA 2E2HI 4CL1A 3G71Z 3NH4A 2V8IA 3CCUZ 5A2Qb 4BY7I 4MONA 2QKDA 1K83I 2Q51A 3J80f 4NBBA 2LFUA 3CCV1 3VMIA 1M902 4BY1I 1M1K2 2VUMI 2DE7A 4A3BI 1TWHI 1W2BY 4A3EI 1PFTA 2W03A 2PM9A 3BG0B 1S721 1VLAA 1NUIA 1K8A1 5A2Qf 1VQL1 1YJ9Z 4E2XA 5AN9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CL1 A;  3FQQ A;  3FQM A;  1ZH1 A; 
#chains in the Genus database with same CATH topology
 2R7Z I;  4TNU A;  4A3F I;  1VQM 1;  1YI2 Z;  2Y0S A;  2PK7 A;  3IF8 A;  3CCM Z;  3JAM b;  4E30 A;  2HF1 A;  2OTJ Z;  1K73 2;  3KIF A;  5C44 I;  1N8R 2;  4QTU A;  2JS4 A;  4Y7N I;  1VQO 1;  3RZO I;  3G6E Z;  1YJN Z;  1P9N A;  3G4S Z;  2AYD A;  3HOV I;  1TWF I;  4A3I I;  1RO2 A;  4E2W A;  2RBL A;  1NP6 A;  2NVQ I;  3HOW I;  1QVG Y;  2QLV B;  3TDH B;  1Y8C A;  4E32 A;  2F4M A;  5T67 A;  4MXU A;  1Q16 A;  2OOY B;  4NBC A;  5T6B A;  1VQ9 1;  1SFO I;  3T4N B;  2JMO A;  3JAM f;  3M3Y I;  3NH8 A;  3P5J B;  5C4X I;  3GTM I;  2K5R A;  4BXX I;  2JIP A;  3EER A;  1ML8 A;  3CC7 1;  2H85 A;  2AKL A;  2LEX A;  1USP B;  4E31 A;  2QRD B;  3CME Z;  3CCQ 1;  3MON A;  1KRL A;  4DQY B;  3CMA 1;  1VQ5 Z;  1AA6 A;  5IP7 I;  3PO3 I;  1YIT 1;  5FLM I;  4NFR A;  1JJ2 Y;  1LQL A;  5D1P A;  3CCS Z;  1Z03 A;  3EED A;  1VQK Z;  4RV9 A;  1QVF Z;  3CPW Y;  1VQ6 Z;  5C4J I;  1Q7Y 2;  4RVG A;  3GTQ I;  1TWC I;  3OW2 Z;  2GU2 A;  1KD1 1;  1DL6 A;  2YAD A;  1Z01 A;  1Q82 2;  2OZK A;  1I50 I;  1YJW 1;  1VQP Z;  4MD8 A;  1VQ4 Z;  2YU9 I;  1Q86 1;  1I6H I;  1QXF A;  3GTL I;  3VMG A;  2VUG A;  4NB9 A;  3OW2 Y;  1KC8 2;  4A3M I;  3S16 I;  1W2B Z;  2GTH A;  3CC4 1;  2V8K A;  2E2I I;  4RVF A;  1VQ8 1;  4NBH A;  1M90 1;  3PO2 I;  2VPW A;  2JNY A;  1M1K 1;  1RQF A;  1VQ4 1;  2NAP A;  2VPX A;  2M6N A;  3CCL 1;  1WW9 A;  3CCR 1;  2IZ3 A;  2JUB A;  2F4O A;  4QTT A;  4A3G I;  2RT9 A;  1Q81 2;  2QR1 B;  3TE5 B;  3G71 1;  3CCU 1;  3BG1 B;  1K9M 1;  3CC2 Z;  2ZAE B;  2B63 I;  1VQN Z;  1K9M 2;  3IR7 A;  1K73 1;  4A3K I;  1N8R 1;  1QVG Z;  4X6A I;  1Y1V I;  1RO0 A;  4E33 A;  1NJI 2;  2QA4 Z;  2R92 I;  3I55 Z;  3CD6 Z;  1ZH1 A;  3GCF A;  4NOZ A;  1WZN A;  3CXC Y;  4MH4 A;  4NB8 A;  3F3F C;  3I07 A;  2DE6 A;  3CCE Z;  1YJ9 1;  1TWG I;  3D2L A;  4NBE A;  3VB9 A;  2NVT I;  4XX2 A;  1YI2 1;  4NBD A;  3CCM 1;  4A3L I;  3D6W A;  2OTJ 1;  1RLY A;  1YUK A;  1Z02 A;  3I56 Z;  4DK1 A;  3S1Q I;  1JJ2 Z;  3G6E 1;  1YJN 1;  2JA6 I;  3G4S 1;  1L1O C;  3CCJ Z;  3J81 b;  2WB1 A;  2P3Y A;  3S2H I;  4A3D I;  3CPW Z;  3K7A I;  3H0G I;  3NDI A;  1TWA I;  2RIQ A;  1YHQ Z;  1WII A;  4S1T A;  2V8J A;  1YIJ Z;  1S7M A;  2O4H A;  3VTN A;  2K3R A;  5D1O A;  4A3J I;  1Q7Y 1;  1FDI A;  1R9T I;  4A3C I;  3HOX I;  2JA5 I;  4Y52 I;  3S1R I;  1FDO A;  2QRE B;  3D9X A;  4E2Y A;  3J81 f;  1Q82 1;  3Q87 A;  3CME 1;  1WJ2 A;  2KI7 B;  1VQ5 1;  1RNI A;  2E9H A;  1KQS Y;  2LIY A;  3NDJ A;  2OTL Z;  4RVH A;  3NFZ A;  1QYP A;  3CCS 1;  3HOZ I;  3MZL B;  1KC8 1;  2QEX Z;  3H3V J;  1VQK 1;  1VQ6 1;  3FQQ A;  3S1M I;  5LL6 f;  1YUA A;  2P28 A;  2VPY A;  1ZB8 A;  2V3V A;  3MZK B;  2JA8 I;  3GTK I;  2VPZ A;  5CM2 M;  1TFI A;  1VQP 1;  4RS4 A;  2JIO A;  4MRI A;  1Q81 1;  1I3Q I;  2Q4Z A;  3RZD I;  2O53 A;  3CCV Z;  1QF8 A;  3GTM S;  1X3Z A;  3F3P C;  2QRC B;  2GTI A;  4NBA A;  1S72 Z;  3S15 I;  3S2D I;  4RVD A;  3CXC Z;  1VQL Z;  3J7A 4;  3PO3 S;  1X3W A;  2R6M A;  3U50 C;  2KPI A;  1NJI 1;  2M48 A;  4EWC A;  5IT9 b;  1VQM Z;  2JR6 A;  2W04 A;  3S17 I;  2WAQ A;  2R93 I;  2EGT A;  3IX0 A;  3GTO I;  1VQO Z;  5T64 A;  3CC2 1;  4E2Z A;  2NVX I;  2PMZ A;  4BBS I;  4NH1 C;  1X0T A;  2DE5 A;  1VQN 1;  1ZB9 A;  1K8A 2;  1Y1W I;  5IT9 f;  2VF1 A;  2JIM A;  2I3C A;  1VQ9 Z;  5FLX b;  2NVY I;  2QA4 1;  1N2F A;  2J6A A;  3S1N I;  3I55 1;  3CD6 1;  3GTG I;  4BBR I;  3CC7 Z;  4HGY A;  3CCE 1;  4DGL A;  3CCQ Z;  3IFU A;  3CMA Z;  3GKQ A;  5D1O B;  1YIT Z;  5FLX f;  2E2J I;  4MD9 A;  3I56 1;  3I4N I;  2RPR A;  1KQS Z;  1WCM I;  2IZ4 A;  1RO4 A;  3CCJ 1;  2IV2 X;  3M4O I;  1JWH C;  2RHB A;  3NH5 A;  1USP A;  1YHQ 1;  3GTJ I;  3QWU A;  1YIJ 1;  1Y1V S;  4AYB A;  3LUS A;  1VQ7 Z;  1YJW Z;  4HGZ A;  3HOU I;  3HOY I;  3ESW A;  3FKI I;  2JA7 I;  5C3E I;  2OOX B;  2HU9 A;  4MD7 A;  4A93 I;  3VMH A;  2E7Z A;  3CC4 Z;  3GTP I;  1VQ8 Z;  3J80 b;  3HKZ A;  2JIR A;  5IP9 I;  2BJO A;  2OTL 1;  1VQ7 1;  3FQM A;  1KD1 2;  3S14 I;  4NBF A;  1QVF Y;  3CCL Z;  4HH4 A;  2QEX 1;  3CCR Z;  3I4M I;  4NBG A;  3CQZ I;  2G2K A;  1Q86 2;  3KIH A;  2E2H I;  4CL1 A;  3G71 Z;  3NH4 A;  2V8I A;  3CCU Z;  5A2Q b;  4BY7 I;  4MON A;  2QKD A;  1K83 I;  2Q51 A;  3J80 f;  4NBB A;  2LFU A;  3CCV 1;  3VMI A;  1M90 2;  4BY1 I;  1M1K 2;  2VUM I;  2DE7 A;  4A3B I;  1TWH I;  1SIW A;  1W2B Y;  4A3E I;  1PFT A;  2JIQ A;  2PM9 A;  2W03 A;  3BG0 B;  1S72 1;  1VLA A;  2V45 A;  1NUI A;  1K8A 1;  5A2Q f;  1VQL 1;  1YJ9 Z;  4E2X A;  5AN9 F; 
#chains in the Genus database with same CATH homology
 2R7Z I;  4TNU A;  4A3F I;  1VQM 1;  1YI2 Z;  2Y0S A;  2PK7 A;  3IF8 A;  3CCM Z;  3JAM b;  4E30 A;  2HF1 A;  2OTJ Z;  1K73 2;  3KIF A;  5C44 I;  1N8R 2;  4QTU A;  2JS4 A;  4Y7N I;  1VQO 1;  3RZO I;  3G6E Z;  1YJN Z;  1P9N A;  3G4S Z;  3HOV I;  1TWF I;  4A3I I;  1RO2 A;  4E2W A;  2RBL A;  1NP6 A;  2NVQ I;  3HOW I;  1QVG Y;  2QLV B;  3TDH B;  4E32 A;  2F4M A;  5T67 A;  4MXU A;  2OOY B;  4NBC A;  5T6B A;  1VQ9 1;  1SFO I;  3T4N B;  2JMO A;  3JAM f;  3M3Y I;  3NH8 A;  3P5J B;  5C4X I;  3GTM I;  2K5R A;  4BXX I;  3EER A;  1ML8 A;  3CC7 1;  2H85 A;  2AKL A;  1USP B;  4E31 A;  2QRD B;  3CME Z;  3CCQ 1;  3MON A;  1KRL A;  4DQY B;  3CMA 1;  1VQ5 Z;  5IP7 I;  3PO3 I;  1YIT 1;  5FLM I;  4NFR A;  1JJ2 Y;  1LQL A;  5D1P A;  3CCS Z;  1Z03 A;  3EED A;  1VQK Z;  4RV9 A;  1QVF Z;  3CPW Y;  1VQ6 Z;  5C4J I;  1Q7Y 2;  4RVG A;  3GTQ I;  1TWC I;  3OW2 Z;  2GU2 A;  1KD1 1;  1DL6 A;  2YAD A;  1Z01 A;  1Q82 2;  2OZK A;  1I50 I;  1YJW 1;  1VQP Z;  4MD8 A;  1VQ4 Z;  2YU9 I;  1Q86 1;  1I6H I;  3GTL I;  3VMG A;  2VUG A;  4NB9 A;  3OW2 Y;  1KC8 2;  4A3M I;  3S16 I;  1W2B Z;  2GTH A;  3CC4 1;  2V8K A;  2E2I I;  4RVF A;  1VQ8 1;  4NBH A;  1M90 1;  3PO2 I;  2JNY A;  1M1K 1;  1RQF A;  1VQ4 1;  2M6N A;  3CCL 1;  1WW9 A;  3CCR 1;  2IZ3 A;  2JUB A;  2F4O A;  4QTT A;  4A3G I;  2RT9 A;  1Q81 2;  2QR1 B;  3TE5 B;  3G71 1;  3CCU 1;  3BG1 B;  1K9M 1;  3CC2 Z;  2ZAE B;  2B63 I;  1VQN Z;  1K9M 2;  1K73 1;  4A3K I;  1N8R 1;  1QVG Z;  4X6A I;  1Y1V I;  1RO0 A;  4E33 A;  1NJI 2;  2QA4 Z;  2R92 I;  3I55 Z;  3CD6 Z;  1ZH1 A;  3GCF A;  4NOZ A;  3CXC Y;  4MH4 A;  4NB8 A;  3F3F C;  3I07 A;  2DE6 A;  3CCE Z;  1YJ9 1;  1TWG I;  4NBE A;  3VB9 A;  2NVT I;  4XX2 A;  1YI2 1;  4NBD A;  3CCM 1;  4A3L I;  3D6W A;  2OTJ 1;  1RLY A;  1YUK A;  1Z02 A;  3I56 Z;  4DK1 A;  3S1Q I;  1JJ2 Z;  3G6E 1;  1YJN 1;  2JA6 I;  3G4S 1;  1L1O C;  3CCJ Z;  3J81 b;  2WB1 A;  2P3Y A;  3S2H I;  4A3D I;  3CPW Z;  3K7A I;  3H0G I;  3NDI A;  1TWA I;  2RIQ A;  1YHQ Z;  1WII A;  4S1T A;  2V8J A;  1YIJ Z;  1S7M A;  2O4H A;  3VTN A;  2K3R A;  5D1O A;  4A3J I;  1Q7Y 1;  1R9T I;  4A3C I;  3HOX I;  2JA5 I;  4Y52 I;  3S1R I;  2QRE B;  3D9X A;  4E2Y A;  3J81 f;  1Q82 1;  3Q87 A;  3CME 1;  2KI7 B;  1VQ5 1;  1RNI A;  2E9H A;  1KQS Y;  2LIY A;  3NDJ A;  2OTL Z;  4RVH A;  3NFZ A;  1QYP A;  3CCS 1;  3HOZ I;  3MZL B;  1KC8 1;  2QEX Z;  3H3V J;  1VQK 1;  1VQ6 1;  3FQQ A;  3S1M I;  5LL6 f;  1YUA A;  2P28 A;  1ZB8 A;  3MZK B;  2JA8 I;  3GTK I;  5CM2 M;  1TFI A;  1VQP 1;  4RS4 A;  4MRI A;  1Q81 1;  1I3Q I;  2Q4Z A;  3RZD I;  2O53 A;  3CCV Z;  1QF8 A;  3GTM S;  1X3Z A;  3F3P C;  2QRC B;  2GTI A;  4NBA A;  1S72 Z;  3S15 I;  3S2D I;  4RVD A;  3CXC Z;  1VQL Z;  3J7A 4;  3PO3 S;  1X3W A;  2R6M A;  3U50 C;  2KPI A;  1NJI 1;  2M48 A;  4EWC A;  5IT9 b;  1VQM Z;  2JR6 A;  2W04 A;  3S17 I;  2WAQ A;  2R93 I;  2EGT A;  3IX0 A;  3GTO I;  1VQO Z;  5T64 A;  3CC2 1;  4E2Z A;  2NVX I;  2PMZ A;  4BBS I;  4NH1 C;  1X0T A;  2DE5 A;  1VQN 1;  1ZB9 A;  1K8A 2;  1Y1W I;  5IT9 f;  2VF1 A;  2I3C A;  1VQ9 Z;  5FLX b;  2NVY I;  2QA4 1;  1N2F A;  2J6A A;  3S1N I;  3I55 1;  3CD6 1;  3GTG I;  4BBR I;  3CC7 Z;  4HGY A;  3CCE 1;  4DGL A;  3CCQ Z;  3IFU A;  3CMA Z;  3GKQ A;  5D1O B;  1YIT Z;  5FLX f;  2E2J I;  4MD9 A;  3I56 1;  3I4N I;  2RPR A;  1KQS Z;  1WCM I;  2IZ4 A;  1RO4 A;  3CCJ 1;  3M4O I;  1JWH C;  2RHB A;  3NH5 A;  1USP A;  1YHQ 1;  3GTJ I;  3QWU A;  1YIJ 1;  1Y1V S;  4AYB A;  3LUS A;  1VQ7 Z;  1YJW Z;  4HGZ A;  3HOU I;  3HOY I;  3ESW A;  3FKI I;  2JA7 I;  5C3E I;  2OOX B;  2HU9 A;  4MD7 A;  4A93 I;  3VMH A;  3CC4 Z;  3GTP I;  1VQ8 Z;  3J80 b;  3HKZ A;  5IP9 I;  2BJO A;  2OTL 1;  1VQ7 1;  3FQM A;  1KD1 2;  3S14 I;  4NBF A;  1QVF Y;  3CCL Z;  4HH4 A;  2QEX 1;  3CCR Z;  3I4M I;  4NBG A;  3CQZ I;  2G2K A;  1Q86 2;  3KIH A;  2E2H I;  4CL1 A;  3G71 Z;  3NH4 A;  2V8I A;  3CCU Z;  5A2Q b;  4BY7 I;  4MON A;  2QKD A;  1K83 I;  2Q51 A;  3J80 f;  4NBB A;  2LFU A;  3CCV 1;  3VMI A;  1M90 2;  4BY1 I;  1M1K 2;  2VUM I;  2DE7 A;  4A3B I;  1TWH I;  1W2B Y;  4A3E I;  1PFT A;  2W03 A;  2PM9 A;  3BG0 B;  1S72 1;  1VLA A;  1NUI A;  1K8A 1;  5A2Q f;  1VQL 1;  1YJ9 Z;  4E2X A;  5AN9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...