4CL1A

The crystal structure of ns5a domain 1 from genotype 1a reveals new clues to the mechanism of action for dimeric hcv inhibitors
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
155
Chain Sequence
PFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREVSFRVHEYPVGSQLPCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 5A
publication title The Crystal Structure of Ns5A Domain 1 from Genotype 1A Reveals New Clues to the Mechanism of Action for Dimeric Hcv Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus (isolate h77)
molecule tags Viral protein
total genus 25
structure length 155
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4cl1A02
3FQMA 3FQQA 1ZH1A 4CL1A
chains in the Genus database with same CATH superfamily
3FQQA 1TWGI 3NFZA 3H3VJ 5LL6f 2VUMI 4A3KI 2PK7A 4RV9A 1ZH1A 4NB9A 2YU9I 1TWFI 2AYDA 3F3PC 2Q4ZA 3I561 5FLMI 3CCJZ 4DQYB 3S15I 3CCJ1 5D1OB 4A3FI 4NBDA 1TFIA 1WCMI 2VPWA 1TWAI 4E33A 2DE6A 4NBHA 1ML8A 2OTL1 2Q51A 1VQPZ 3GTPI 4Y7NI 3OW2Z 3GTGI 3JAMf 1S72Z 1S721 2JA7I 2HF1A 4NBCA 3D6WA 1RO4A 3P5JB 3S1NI 1YUAA 1KC81 1K732 3CC2Z 1QVFZ 3CC21 3S2HI 3RZDI 2JA8I 1W2BY 1K9M1 1JJ2Y 3HOUI 3T4NB 2O53A 1USPB 3FQMA 2WB1A 2E2HI 1RNIA 2DE5A 5IP7I 1FDIA 4A3MI 3J81f 1KRLA 5AN9F 1VQKZ 2K3RA 3D9XA 3HOVI 3I4NI 1Z01A 2K5RA 3S14I 4DK1A 3HOWI 3S16I 1VLAA 2I3CA 3F3FC 1YI2Z 3KIHA 1YI21 2JIPA 2QREB 1YITZ 3J81b 3I07A 4BBRI 1YIT1 3G71Z 1NP6A 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 1WJ2A 1KC82 4RVGA 3EEDA 3CXCY 3PO2I 3CCMZ 2P3YA 1FDOA 3CCM1 1Q821 3CCS1 1Q811 1K9M2 5C4XI 3S2DI 1QVGZ 3CMEZ 1Q861 1YUKA 3CME1 2VF1A 3G6E1 1NUIA 5CM2M 4E32A 1VQ9Z 2IZ3A 1VQ91 1AA6A 2QR1B 2JA6I 2V8JA 2NVXI 2W04A 1QXFA 1VQMZ 3EERA 1M901 1VQM1 3NH8A 4A3CI 3HKZA 3KIFA 2E7ZA 3GTMI 2JIRA 4MD7A 1X0TA 1RO2A 1WZNA 2RIQA 3M4OI 3M3YI 2VPXA 4A3BI 2M6NA 4MXUA 3MZLB 3I56Z 2KPIA 3J7A4 3K7AI 5T67A 1VQ4Z 3GTLI 1VQ41 4E2ZA 1Q7Y2 4NH1C 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 3CCVZ 1M1K1 3CCV1 2DE7A 1YJ9Z 2LEXA 1YJ91 1DL6A 3NDJA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 3J80f 3CMA1 2OTJ1 1Q812 4E31A 3OW2Y 1Q862 2QEX1 2E2JI 5IP9I 2JR6A 2JMOA 3D2LA 3S1MI 1RQFA 4A3DI 2GTIA 1Y8CA 4A3JI 2RPRA 3HOZI 1Y1VS 2QLVB 4HH4A 3Q87A 2JIOA 3NDIA 1SIWA 5T64A 3PO3I 1M902 4BXXI 2M48A 2RBLA 1L1OC 3U50C 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1N8R1 1QVFY 2O4HA 2VPZA 4NBEA 1X3ZA 4HGZA 5T6BA 1ZB9A 1SFOI 3GTJI 4E2YA 1YJWZ 2IZ4A 1YJW1 2JUBA 5C4JI 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2KI7B 2R92I 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 3CC4Z 1S7MA 3CC41 2QA4Z 1Y1WI 2QA41 3HOXI 4MRIA 3VTNA 1K8A1 1YHQZ 3S1QI 3NH4A 1YJNZ 1YJN1 4EWCA 2IV2X 1RLYA 3GTOI 2F4OA 4A3LI 4X6AI 2R7ZI 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 3MZKB 1JWHC 1KD11 4A3GI 1N8R2 2V45A 2G2KA 4S1TA 3G6EZ 3CCE1 4E30A 4MD8A 1QVGY 2V8IA 1QF8A 4NBFA 2RHBA 2NVQI 2NAPA 4MH4A 4QTTA 2J6AA 5C3EI 4NBAA 2AKLA 3NH5A 1X3WA 1K8A2 2BJOA 1VQ5Z 1Z02A 3LUSA 2B63I 4NBGA 3IF8A 2JIMA 3CD6Z 1KD12 3CD61 2OOYB 5C44I 1NJI1 2QEXZ 4Y52I 2VPYA 4XX2A 1KQSY 3TE5B 1TWHI 2OOXB 3VB9A 4A3EI 2P28A 4RVHA 2JNYA 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 5D1OA 2QKDA 3GTKI 2NVYI 2V8KA 1VQP1 3IR7A 1WIIA 2W03A 3ESWA 1VQ7Z 1VQ71 3J80b 4NBBA 1Q16A 1K83I 3GTQI 3CPWY 1W2BZ 1JJ2Z 2E2II 3GCFA 4BBSI 4A3II 1P9NA 3QWUA 2F4MA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 5IT9b 4A93I 5D1PA 3GTMS 4RVFA 2LIYA 1VQK1 2JIQA 1R9TI 1USPA 3FKII 1YIJZ 1YIJ1 1NJI2 3CQZI 3IX0A 2PM9A 2LFUA 1LQLA 2VUGA 1VQOZ 3VMHA 5FLXb 2OZKA 2V3VA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1Y1VI 3CCEZ 1VQ81 3I4MI 1QYPA 2R6MA 1RO0A 1VQ6Z 3CCRZ 1VQ61 3CCR1 3I55Z 1TWCI 3RZOI 2RT9A 3I551 2WAQA 4HGYA 5A2Qb 4AYBA 3PO3S 4MD9A 3VMIA 3CCUZ 3CCU1 2E9HA 2QRDB 4E2WA 3S17I 2JA5I 3CC7Z 2NVTI 3CC71 1VQLZ 4DGLA 1K731 1WW9A 1VQL1 4RVDA
chains in the Genus database with same CATH topology
3FQQA 1TWGI 3NFZA 3H3VJ 5LL6f 2VUMI 4A3KI 2PK7A 4RV9A 1ZH1A 4NB9A 2YU9I 1TWFI 3F3PC 2Q4ZA 3I561 5FLMI 3CCJZ 4DQYB 3S15I 3CCJ1 5D1OB 4A3FI 4NBDA 1TFIA 1WCMI 1TWAI 4E33A 2DE6A 4NBHA 1ML8A 2OTL1 2Q51A 1VQPZ 3GTPI 4Y7NI 3OW2Z 3GTGI 3JAMf 1S72Z 1S721 2JA7I 2HF1A 4NBCA 3D6WA 1RO4A 3P5JB 3S1NI 1YUAA 1KC81 1K732 3CC2Z 1QVFZ 3CC21 3S2HI 3RZDI 2JA8I 1W2BY 1K9M1 1JJ2Y 3HOUI 3T4NB 2O53A 1USPB 3FQMA 2WB1A 2E2HI 1RNIA 2DE5A 5IP7I 4A3MI 3J81f 1KRLA 5AN9F 1VQKZ 2K3RA 3D9XA 3HOVI 3I4NI 1Z01A 2K5RA 3S14I 4DK1A 3HOWI 3S16I 1VLAA 2I3CA 3F3FC 1YI2Z 3KIHA 1YI21 2QREB 1YITZ 3J81b 3I07A 4BBRI 1YIT1 3G71Z 1NP6A 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 1KC82 4RVGA 3EEDA 3CXCY 3PO2I 3CCMZ 2P3YA 3CCM1 1Q821 3CCS1 1Q811 1K9M2 5C4XI 3S2DI 1QVGZ 3CMEZ 1Q861 1YUKA 3CME1 2VF1A 3G6E1 1NUIA 5CM2M 4E32A 1VQ9Z 2IZ3A 1VQ91 2QR1B 2JA6I 2V8JA 2NVXI 2W04A 1VQMZ 3EERA 1M901 1VQM1 3NH8A 4A3CI 3HKZA 3KIFA 3GTMI 4MD7A 1X0TA 1RO2A 2RIQA 3M4OI 3M3YI 4A3BI 2M6NA 4MXUA 3MZLB 3I56Z 2KPIA 3J7A4 3K7AI 5T67A 1VQ4Z 3GTLI 1VQ41 4E2ZA 1Q7Y2 4NH1C 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 3CCVZ 1M1K1 3CCV1 2DE7A 1YJ9Z 1YJ91 1DL6A 3NDJA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 3J80f 3CMA1 2OTJ1 1Q812 4E31A 3OW2Y 1Q862 2QEX1 2E2JI 5IP9I 2JR6A 2JMOA 3S1MI 1RQFA 4A3DI 2GTIA 4A3JI 3HOZI 2RPRA 1Y1VS 2QLVB 4HH4A 3Q87A 3NDIA 5T64A 3PO3I 1M902 4BXXI 2M48A 2RBLA 1L1OC 3U50C 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1N8R1 1QVFY 2O4HA 4NBEA 1X3ZA 4HGZA 5T6BA 1ZB9A 1SFOI 3GTJI 4E2YA 1YJWZ 2IZ4A 1YJW1 2JUBA 5C4JI 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2KI7B 2R92I 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 3CC4Z 1S7MA 3CC41 2QA4Z 1Y1WI 2QA41 3HOXI 4MRIA 3VTNA 1K8A1 1YHQZ 3S1QI 3NH4A 1YJNZ 1YJN1 4EWCA 1RLYA 3GTOI 2F4OA 4A3LI 4X6AI 2R7ZI 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 3MZKB 1JWHC 1KD11 4A3GI 1N8R2 2G2KA 4S1TA 3G6EZ 3CCE1 4E30A 4MD8A 1QVGY 2V8IA 1QF8A 4NBFA 2RHBA 2NVQI 4MH4A 4QTTA 2J6AA 5C3EI 4NBAA 2AKLA 3NH5A 1X3WA 1K8A2 2BJOA 1VQ5Z 1Z02A 3LUSA 2B63I 4NBGA 3IF8A 3CD6Z 1KD12 3CD61 2OOYB 5C44I 1NJI1 2QEXZ 4Y52I 4XX2A 1KQSY 3TE5B 1TWHI 2OOXB 3VB9A 4A3EI 2P28A 4RVHA 2JNYA 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 5D1OA 2QKDA 3GTKI 2NVYI 2V8KA 1VQP1 1WIIA 2W03A 3ESWA 1VQ7Z 1VQ71 3J80b 4NBBA 1K83I 3GTQI 3CPWY 1W2BZ 1JJ2Z 2E2II 3GCFA 4BBSI 4A3II 1P9NA 3QWUA 2F4MA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 5IT9b 4A93I 5D1PA 3GTMS 4RVFA 2LIYA 1VQK1 1R9TI 1USPA 3FKII 1YIJZ 1YIJ1 1NJI2 3CQZI 3IX0A 2PM9A 2LFUA 1LQLA 2VUGA 1VQOZ 3VMHA 5FLXb 2OZKA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1Y1VI 3CCEZ 1VQ81 3I4MI 1QYPA 2R6MA 1RO0A 1VQ6Z 3CCRZ 1VQ61 3CCR1 3I55Z 1TWCI 3RZOI 2RT9A 3I551 2WAQA 4HGYA 5A2Qb 4AYBA 3PO3S 4MD9A 3VMIA 3CCUZ 3CCU1 2E9HA 2QRDB 4E2WA 3S17I 2JA5I 3CC7Z 2NVTI 3CC71 1VQLZ 4DGLA 1K731 1WW9A 1VQL1 4RVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FQM A;  3FQQ A;  1ZH1 A;  4CL1 A; 
#chains in the Genus database with same CATH topology
 3FQQ A;  1TWG I;  3NFZ A;  3H3V J;  5LL6 f;  2VUM I;  4A3K I;  2PK7 A;  4RV9 A;  1ZH1 A;  4NB9 A;  2YU9 I;  1TWF I;  2AYD A;  3F3P C;  2Q4Z A;  3I56 1;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1TFI A;  1WCM I;  2VPW A;  1TWA I;  4E33 A;  2DE6 A;  4NBH A;  1ML8 A;  2OTL 1;  2Q51 A;  1VQP Z;  3GTP I;  4Y7N I;  3OW2 Z;  3GTG I;  3JAM f;  1S72 Z;  1S72 1;  2JA7 I;  2HF1 A;  4NBC A;  3D6W A;  1RO4 A;  3P5J B;  3S1N I;  1YUA A;  1KC8 1;  1K73 2;  3CC2 Z;  1QVF Z;  3CC2 1;  3S2H I;  3RZD I;  2JA8 I;  1W2B Y;  1K9M 1;  1JJ2 Y;  3HOU I;  3T4N B;  2O53 A;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  1RNI A;  2DE5 A;  5IP7 I;  1FDI A;  4A3M I;  3J81 f;  1KRL A;  5AN9 F;  1VQK Z;  2K3R A;  3D9X A;  3HOV I;  3I4N I;  1Z01 A;  2K5R A;  3S14 I;  4DK1 A;  3HOW I;  3S16 I;  1VLA A;  2I3C A;  3F3F C;  1YI2 Z;  3KIH A;  1YI2 1;  2JIP A;  2QRE B;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  1YIT 1;  3G71 Z;  1NP6 A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  1WJ2 A;  1KC8 2;  4RVG A;  3EED A;  3CXC Y;  3PO2 I;  3CCM Z;  2P3Y A;  1FDO A;  3CCM 1;  1Q82 1;  3CCS 1;  1Q81 1;  1K9M 2;  5C4X I;  3S2D I;  1QVG Z;  3CME Z;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  3G6E 1;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  2IZ3 A;  1VQ9 1;  1AA6 A;  2QR1 B;  2JA6 I;  2V8J A;  2NVX I;  2W04 A;  1QXF A;  1VQM Z;  3EER A;  1M90 1;  1VQM 1;  3NH8 A;  4A3C I;  3HKZ A;  3KIF A;  2E7Z A;  3GTM I;  2JIR A;  4MD7 A;  1X0T A;  1RO2 A;  1WZN A;  2RIQ A;  3M4O I;  3M3Y I;  2VPX A;  4A3B I;  2M6N A;  4MXU A;  3MZL B;  3I56 Z;  2KPI A;  3J7A 4;  3K7A I;  5T67 A;  1VQ4 Z;  3GTL I;  1VQ4 1;  4E2Z A;  1Q7Y 2;  4NH1 C;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  3CCV Z;  1M1K 1;  3CCV 1;  2DE7 A;  1YJ9 Z;  2LEX A;  1YJ9 1;  1DL6 A;  3NDJ A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  4E31 A;  3OW2 Y;  1Q86 2;  2QEX 1;  2E2J I;  5IP9 I;  2JR6 A;  2JMO A;  3D2L A;  3S1M I;  1RQF A;  4A3D I;  2GTI A;  1Y8C A;  4A3J I;  2RPR A;  3HOZ I;  1Y1V S;  2QLV B;  4HH4 A;  3Q87 A;  2JIO A;  3NDI A;  1SIW A;  5T64 A;  3PO3 I;  1M90 2;  4BXX I;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1N8R 1;  1QVF Y;  2O4H A;  2VPZ A;  4NBE A;  1X3Z A;  4HGZ A;  5T6B A;  1ZB9 A;  1SFO I;  3GTJ I;  4E2Y A;  1YJW Z;  2IZ4 A;  1YJW 1;  2JUB A;  5C4J I;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2KI7 B;  2R92 I;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  3CC4 Z;  1S7M A;  3CC4 1;  2QA4 Z;  1Y1W I;  2QA4 1;  3HOX I;  4MRI A;  3VTN A;  1K8A 1;  1YHQ Z;  3S1Q I;  3NH4 A;  1YJN Z;  1YJN 1;  4EWC A;  2IV2 X;  1RLY A;  3GTO I;  2F4O A;  4A3L I;  4X6A I;  2R7Z I;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  3MZK B;  1JWH C;  1KD1 1;  4A3G I;  1N8R 2;  2V45 A;  2G2K A;  4S1T A;  3G6E Z;  3CCE 1;  4E30 A;  4MD8 A;  1QVG Y;  2V8I A;  1QF8 A;  4NBF A;  2RHB A;  2NVQ I;  2NAP A;  4MH4 A;  4QTT A;  2J6A A;  5C3E I;  4NBA A;  2AKL A;  3NH5 A;  1X3W A;  1K8A 2;  2BJO A;  1VQ5 Z;  1Z02 A;  3LUS A;  2B63 I;  4NBG A;  3IF8 A;  2JIM A;  3CD6 Z;  1KD1 2;  3CD6 1;  2OOY B;  5C44 I;  1NJI 1;  2QEX Z;  4Y52 I;  2VPY A;  4XX2 A;  1KQS Y;  3TE5 B;  1TWH I;  2OOX B;  3VB9 A;  4A3E I;  2P28 A;  4RVH A;  2JNY A;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  2V8K A;  1VQP 1;  3IR7 A;  1WII A;  2W03 A;  3ESW A;  1VQ7 Z;  1VQ7 1;  3J80 b;  4NBB A;  1Q16 A;  1K83 I;  3GTQ I;  3CPW Y;  1W2B Z;  1JJ2 Z;  2E2I I;  3GCF A;  4BBS I;  4A3I I;  1P9N A;  3QWU A;  2F4M A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  5IT9 b;  4A93 I;  5D1P A;  3GTM S;  4RVF A;  2LIY A;  1VQK 1;  2JIQ A;  1R9T I;  1USP A;  3FKI I;  1YIJ Z;  1YIJ 1;  1NJI 2;  3CQZ I;  3IX0 A;  2PM9 A;  2LFU A;  1LQL A;  2VUG A;  1VQO Z;  3VMH A;  5FLX b;  2OZK A;  2V3V A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1Y1V I;  3CCE Z;  1VQ8 1;  3I4M I;  1QYP A;  2R6M A;  1RO0 A;  1VQ6 Z;  3CCR Z;  1VQ6 1;  3CCR 1;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  2WAQ A;  4HGY A;  5A2Q b;  4AYB A;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  3CCU 1;  2E9H A;  2QRD B;  4E2W A;  3S17 I;  2JA5 I;  3CC7 Z;  2NVT I;  3CC7 1;  1VQL Z;  4DGL A;  1K73 1;  1WW9 A;  1VQL 1;  4RVD A; 
#chains in the Genus database with same CATH homology
 3FQQ A;  1TWG I;  3NFZ A;  3H3V J;  5LL6 f;  2VUM I;  4A3K I;  2PK7 A;  4RV9 A;  1ZH1 A;  4NB9 A;  2YU9 I;  1TWF I;  3F3P C;  2Q4Z A;  3I56 1;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1TFI A;  1WCM I;  1TWA I;  4E33 A;  2DE6 A;  4NBH A;  1ML8 A;  2OTL 1;  2Q51 A;  1VQP Z;  3GTP I;  4Y7N I;  3OW2 Z;  3GTG I;  3JAM f;  1S72 Z;  1S72 1;  2JA7 I;  2HF1 A;  4NBC A;  3D6W A;  1RO4 A;  3P5J B;  3S1N I;  1YUA A;  1KC8 1;  1K73 2;  3CC2 Z;  1QVF Z;  3CC2 1;  3S2H I;  3RZD I;  2JA8 I;  1W2B Y;  1K9M 1;  1JJ2 Y;  3HOU I;  3T4N B;  2O53 A;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  1RNI A;  2DE5 A;  5IP7 I;  4A3M I;  3J81 f;  1KRL A;  5AN9 F;  1VQK Z;  2K3R A;  3D9X A;  3HOV I;  3I4N I;  1Z01 A;  2K5R A;  3S14 I;  4DK1 A;  3HOW I;  3S16 I;  1VLA A;  2I3C A;  3F3F C;  1YI2 Z;  3KIH A;  1YI2 1;  2QRE B;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  1YIT 1;  3G71 Z;  1NP6 A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  1KC8 2;  4RVG A;  3EED A;  3CXC Y;  3PO2 I;  3CCM Z;  2P3Y A;  3CCM 1;  1Q82 1;  3CCS 1;  1Q81 1;  1K9M 2;  5C4X I;  3S2D I;  1QVG Z;  3CME Z;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  3G6E 1;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  2IZ3 A;  1VQ9 1;  2QR1 B;  2JA6 I;  2V8J A;  2NVX I;  2W04 A;  1VQM Z;  3EER A;  1M90 1;  1VQM 1;  3NH8 A;  4A3C I;  3HKZ A;  3KIF A;  3GTM I;  4MD7 A;  1X0T A;  1RO2 A;  2RIQ A;  3M4O I;  3M3Y I;  4A3B I;  2M6N A;  4MXU A;  3MZL B;  3I56 Z;  2KPI A;  3J7A 4;  3K7A I;  5T67 A;  1VQ4 Z;  3GTL I;  1VQ4 1;  4E2Z A;  1Q7Y 2;  4NH1 C;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  3CCV Z;  1M1K 1;  3CCV 1;  2DE7 A;  1YJ9 Z;  1YJ9 1;  1DL6 A;  3NDJ A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  4E31 A;  3OW2 Y;  1Q86 2;  2QEX 1;  2E2J I;  5IP9 I;  2JR6 A;  2JMO A;  3S1M I;  1RQF A;  4A3D I;  2GTI A;  4A3J I;  3HOZ I;  2RPR A;  1Y1V S;  2QLV B;  4HH4 A;  3Q87 A;  3NDI A;  5T64 A;  3PO3 I;  1M90 2;  4BXX I;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1N8R 1;  1QVF Y;  2O4H A;  4NBE A;  1X3Z A;  4HGZ A;  5T6B A;  1ZB9 A;  1SFO I;  3GTJ I;  4E2Y A;  1YJW Z;  2IZ4 A;  1YJW 1;  2JUB A;  5C4J I;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2KI7 B;  2R92 I;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  3CC4 Z;  1S7M A;  3CC4 1;  2QA4 Z;  1Y1W I;  2QA4 1;  3HOX I;  4MRI A;  3VTN A;  1K8A 1;  1YHQ Z;  3S1Q I;  3NH4 A;  1YJN Z;  1YJN 1;  4EWC A;  1RLY A;  3GTO I;  2F4O A;  4A3L I;  4X6A I;  2R7Z I;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  3MZK B;  1JWH C;  1KD1 1;  4A3G I;  1N8R 2;  2G2K A;  4S1T A;  3G6E Z;  3CCE 1;  4E30 A;  4MD8 A;  1QVG Y;  2V8I A;  1QF8 A;  4NBF A;  2RHB A;  2NVQ I;  4MH4 A;  4QTT A;  2J6A A;  5C3E I;  4NBA A;  2AKL A;  3NH5 A;  1X3W A;  1K8A 2;  2BJO A;  1VQ5 Z;  1Z02 A;  3LUS A;  2B63 I;  4NBG A;  3IF8 A;  3CD6 Z;  1KD1 2;  3CD6 1;  2OOY B;  5C44 I;  1NJI 1;  2QEX Z;  4Y52 I;  4XX2 A;  1KQS Y;  3TE5 B;  1TWH I;  2OOX B;  3VB9 A;  4A3E I;  2P28 A;  4RVH A;  2JNY A;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  2V8K A;  1VQP 1;  1WII A;  2W03 A;  3ESW A;  1VQ7 Z;  1VQ7 1;  3J80 b;  4NBB A;  1K83 I;  3GTQ I;  3CPW Y;  1W2B Z;  1JJ2 Z;  2E2I I;  3GCF A;  4BBS I;  4A3I I;  1P9N A;  3QWU A;  2F4M A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  5IT9 b;  4A93 I;  5D1P A;  3GTM S;  4RVF A;  2LIY A;  1VQK 1;  1R9T I;  1USP A;  3FKI I;  1YIJ Z;  1YIJ 1;  1NJI 2;  3CQZ I;  3IX0 A;  2PM9 A;  2LFU A;  1LQL A;  2VUG A;  1VQO Z;  3VMH A;  5FLX b;  2OZK A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1Y1V I;  3CCE Z;  1VQ8 1;  3I4M I;  1QYP A;  2R6M A;  1RO0 A;  1VQ6 Z;  3CCR Z;  1VQ6 1;  3CCR 1;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  2WAQ A;  4HGY A;  5A2Q b;  4AYB A;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  3CCU 1;  2E9H A;  2QRD B;  4E2W A;  3S17 I;  2JA5 I;  3CC7 Z;  2NVT I;  3CC7 1;  1VQL Z;  4DGL A;  1K73 1;  1WW9 A;  1VQL 1;  4RVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...