1TWCI

Rna polymerase ii complexed with gtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI02
1USPA 1DL6A 3S1QI 4BY1I 4A3KI 3M3YI 3H3VJ 3HOYI 1TWGI 3HOUI 3M4OI 5CM2M 2JNYA 4Y7NI 1L1OC 4A3BI 3GTPI 2NVTI 3GKQA 3GTMS 2F4MA 3U50C 3GTKI 4BBRI 3D6WA 1X3ZA 1NUIA 2RBLA 1YUAA 2E2HI 2JA6I 3ESWA 3S1NI 1ZB8A 3S1MI 2HF1A 1WCMI 1LQLA 3S2HI 5C44I 1TWCI 1X3WA 2P3YA 1Y1WI 4A3JI 4NBEA 2E2II 4XX2A 2AKLA 1TWFI 4NBDA 2JA7I 3PO3S 4NBCA 4A3EI 1R9TI 4A3CI 2DE7A 4NBGA 4BXXI 5IP7I 2NVYI 1PFTA 5FLMI 4NBBA 1TWHI 1ZB9A 1N2FA 3I4MI 2DE6A 2K5RA 3S1RI 4A93I 4NB9A 3PO3I 3VB9A 4A3FI 3GTOI 1RLYA 4NB8A 3S14I 4NBAA 3VMGA 4A3MI 3GTMI 3GTGI 1VLAA 3H0GI 2JA5I 1USPB 2JS4A 4MH4A 3GTJI 1I6HI 1QYPA 2JR6A 4NOZA 3PO2I 4NBFA 3HOZI 5C4XI 2R7ZI 4BBSI 3LUSA 2R92I 1RO4A 1SFOI 1Y1VS 2F4OA 1I3QI 2NVXI 4A3GI 1TWAI 4A3DI 3S15I 3I4NI 4A3LI 1TFIA 2B63I 3I07A 3K7AI 1K83I 4NBHA 3S16I 2PK7A 2KPIA 4BY7I 5IP9I 2R93I 4Y52I 2E2JI 2DE5A 3HOWI 2VUMI 1Y1VI 3HOVI 2YU9I 2NVQI 3GTLI 3Q87A 3CQZI 4QTUA 4X6AI 3S2DI 1WW9A 4QTTA 3HOXI 4A3II 3FKII 3VMIA 1I50I 2J6AA 3EERA 3VMHA 3S17I 2BJOA 3GCFA 3RZDI 3RZOI 5C4JI 1ML8A 5C3EI 3GTQI 2JA8I
chains in the Genus database with same CATH superfamily
2E9HA 3G4SZ 4E31A 3J7A4 2JNYA 4MD8A 5T6BA 1YJWZ 4A3BI 3GKQA 3GTKI 2WB1A 4BBRI 3D6WA 1X3ZA 1VQ41 2Q4ZA 3ESWA 1VQ71 1WCMI 5D1OB 1VQ61 5C44I 1X3WA 1YIT1 1VQ4Z 2VPXA 4E2WA 2E2II 2VUGA 1VQL1 1RQFA 1VQ7Z 2YADA 1YI21 1VQ6Z 1VQM1 1QVGZ 1YITZ 3BG1B 3CCU1 4A3EI 1VQLZ 4NBGA 3J81b 2V8JA 1YI2Z 2RHBA 4E2ZA 3J80b 4MXUA 3FQQA 1ZB9A 2K5RA 3CCUZ 2PM9A 1RO0A 2JMOA 4A93I 1YJN1 3GTOI 1W2BZ 2NAPA 2K3RA 3H0GI 5FLXb 5A2Qb 4HGZA 1USPB 2QEX1 1YJNZ 4MH4A 3GTJI 1K9M2 5IT9f 2EGTA 5C4XI 2V8KA 5D1OA 2R6MA 2RT9A 2QEXZ 1SFOI 4AYBA 2F4OA 1I3QI 1TWAI 3NDJA 2B63I 4RVGA 1K83I 2QREB 2OOXB 1VQP1 3T4NB 1Y1VI 1ZH1A 1Q821 1M1K1 2JUBA 1Q812 1VQPZ 1KC82 4QTTA 3VMIA 2J6AA 2O53A 3CXCZ 1KQSY 3S17I 2BJOA 5C4JI 1ML8A 1RNIA 1USPA 3TDHB 2RIQA 4RVDA 3H3VJ 2OTL1 3HOYI 2ZAEB 1KQSZ 3KIHA 4Y7NI 1L1OC 2VF1A 2WAQA 2GU2A 3F3FC 2OTLZ 2JIQA 3S1MI 1LQLA 1TWCI 1Y1WI 3NDIA 3BG0B 2OTJ1 4XX2A 1JWHC 2QRCB 2GTHA 3CCSZ 2JA7I 1SIWA 4NBCA 3CC71 1P9NA 2OTJZ 3EEDA 4A3CI 4BXXI 1TWHI 2JIOA 2GTIA 4RS4A 3CC7Z 3CD61 3S1RI 4NFRA 2V8IA 1VQO1 2QA41 3KIFA 4NBAA 2Q51A 4A3MI 3CME1 1NJI1 3CD6Z 2JS4A 2LEXA 4TNUA 1K731 1I6HI 1VQOZ 2QA4Z 4NBFA 2R7ZI 1YJ91 4MD9A 3CMEZ 4BBSI 2R92I 1Y1VS 1VQMZ 3NH4A 1K8A1 2W03A 1VQ81 4DGLA 1Z03A 1YJ9Z 3I07A 3G6E1 2OZKA 4Y52I 3J80f 1VQ8Z 4HGYA 3HOVI 3G6EZ 3MZLB 2YU9I 3GTLI 3NH8A 1WJ2A 4QTUA 2M48A 3S2DI 1WW9A 3VTNA 3MONA 5IT9b 3CCJ1 3EERA 4HH4A 5FLXf 5A2Qf 1S7MA 3GTQI 2JA8I 4DK1A 1DL6A 3S1QI 1NP6A 1N8R1 4BY1I 4A3KI 3M3YI 2E7ZA 4MRIA 1TWGI 3M4OI 1K9M1 3D9XA 3JAMf 1Q822 2F4MA 1M1K2 2Y0SA 1NUIA 3IF8A 2RBLA 3G711 4E30A 2E2HI 3S1NI 1ZB8A 2HF1A 2QKDA 3CC41 3G71Z 3OW2Y 2AKLA 2QLVB 2HU9A 1Q861 2O4HA 3OW2Z 1R9TI 1KD11 2DE7A 2H85A 5IP7I 1QVFY 3CCR1 5FLMI 3CCQ1 4NBBA 3MZKB 1N2FA 3I4MI 1FDOA 1Z02A 2JIPA 3FQMA 3NH5A 1Q7Y1 3CCE1 1S721 3PO3I 1KRLA 3CCRZ 1QVFZ 1M901 3CCQZ 1VQ91 3HKZA 3GTGI 1VLAA 3CC21 3CCEZ 1S72Z 3NFZA 2G2KA 2V3VA 1VQ9Z 3PO2I 2LIYA 2V45A 3CC2Z 3IX0A 3LUSA 4E32A 3CMA1 2NVXI 3S15I 2VPWA 1TFIA 3IR7A 1Y8CA 4E33A 3CMAZ 4NBHA 3S16I 5LL6f 1NJI2 3P5JB 2KPIA 4MD7A 1K732 4E2XA 4CL1A 2NVQI 1Z01A 3Q87A 4X6AI 3HOXI 4RV9A 1I50I 1K8A2 1VQ51 3VMHA 1QVGY 3GCFA 2RPRA 3RZOI 5T67A 4EWCA 3I551 2KI7B 4S1TA 1VQ5Z 3I561 4DQYB 3HOUI 5CM2M 3J81f 2VPYA 3GTPI 2NVTI 3GTMS 3U50C 4E2YA 2VPZA 3I55Z 3I56Z 2AYDA 1W2BY 1YUAA 2JA6I 3QWUA 1RO2A 4MONA 3CCL1 1Q16A 3S2HI 2P3YA 5T64A 4A3JI 2PMZA 4NBEA 1N8R2 1WIIA 1QF8A 3CCJZ 3CCLZ 2JIRA 4RVFA 1TWFI 4NBDA 3PO3S 2W04A 4RVHA 5AN9F 2QR1B 2NVYI 1PFTA 3JAMb 1WZNA 2DE6A 4NB9A 2IZ3A 1VQK1 3VB9A 4A3FI 5D1PA 1RLYA 4NB8A 3S14I 3VMGA 3GTMI 3CCV1 2LFUA 2JA5I 3CC4Z 2JIMA 1VQKZ 1Q862 1QYPA 2JR6A 4NOZA 3TE5B 3F3PC 3CXCY 1KD12 1YIJ1 3CCVZ 3HOZI 1AA6A 1YUKA 3D2LA 1Q811 1KC81 1RO4A 1VQN1 4NH1C 1Q7Y2 4A3GI 1YIJZ 4A3DI 3I4NI 4A3LI 1FDIA 3CPWY 1M902 3CCM1 1X0TA 3K7AI 1VQNZ 2PK7A 2IV2X 1JJ2Y 2IZ4A 4BY7I 5IP9I 2R93I 2E2JI 3CPWZ 2DE5A 3HOWI 2VUMI 3CCMZ 1QXFA 2QRDB 1YHQ1 2P28A 1JJ2Z 3CQZI 2OOYB 4A3II 2I3CA 3FKII 3G4S1 3CCS1 3RZDI 3IFUA 1YHQZ 5C3EI 1YJW1 2M6NA
chains in the Genus database with same CATH topology
2E9HA 3G4SZ 4E31A 3J7A4 2JNYA 4MD8A 5T6BA 1YJWZ 4A3BI 3GKQA 3GTKI 2WB1A 4BBRI 3D6WA 1X3ZA 1VQ41 2Q4ZA 3ESWA 1VQ71 1WCMI 5D1OB 1VQ61 5C44I 1X3WA 1YIT1 1VQ4Z 4E2WA 2E2II 2VUGA 1VQL1 1RQFA 1VQ7Z 2YADA 1YI21 1VQ6Z 1VQM1 1QVGZ 1YITZ 3BG1B 3CCU1 4A3EI 1VQLZ 4NBGA 3J81b 2V8JA 1YI2Z 2RHBA 4E2ZA 3J80b 4MXUA 3FQQA 1ZB9A 2K5RA 3CCUZ 2PM9A 1RO0A 2JMOA 4A93I 1YJN1 3GTOI 1W2BZ 2K3RA 3H0GI 5FLXb 5A2Qb 4HGZA 1USPB 2QEX1 1YJNZ 4MH4A 3GTJI 1K9M2 5IT9f 2EGTA 5C4XI 2V8KA 5D1OA 2R6MA 2RT9A 2QEXZ 1SFOI 4AYBA 2F4OA 1I3QI 1TWAI 3NDJA 2B63I 4RVGA 1K83I 2QREB 2OOXB 1VQP1 3T4NB 1Y1VI 1ZH1A 1Q821 1M1K1 2JUBA 1Q812 1VQPZ 1KC82 4QTTA 3VMIA 2J6AA 2O53A 3CXCZ 1KQSY 3S17I 2BJOA 5C4JI 1ML8A 1RNIA 1USPA 3TDHB 2RIQA 4RVDA 3H3VJ 2OTL1 3HOYI 2ZAEB 1KQSZ 3KIHA 4Y7NI 1L1OC 2VF1A 2WAQA 2GU2A 3F3FC 2OTLZ 3S1MI 1LQLA 1TWCI 1Y1WI 3NDIA 3BG0B 2OTJ1 4XX2A 1JWHC 2QRCB 2GTHA 3CCSZ 2JA7I 4NBCA 3CC71 1P9NA 2OTJZ 3EEDA 4A3CI 4BXXI 1TWHI 2GTIA 4RS4A 3CC7Z 3CD61 3S1RI 4NFRA 2V8IA 1VQO1 2QA41 3KIFA 4NBAA 2Q51A 4A3MI 3CME1 1NJI1 3CD6Z 2JS4A 4TNUA 1K731 1I6HI 1VQOZ 2QA4Z 4NBFA 2R7ZI 1YJ91 4MD9A 3CMEZ 4BBSI 2R92I 1Y1VS 1VQMZ 3NH4A 1K8A1 2W03A 1VQ81 4DGLA 1Z03A 1YJ9Z 3I07A 3G6E1 2OZKA 4Y52I 3J80f 1VQ8Z 4HGYA 3HOVI 3G6EZ 3MZLB 2YU9I 3GTLI 3NH8A 4QTUA 2M48A 3S2DI 1WW9A 3VTNA 3MONA 5IT9b 3CCJ1 3EERA 4HH4A 5FLXf 5A2Qf 1S7MA 3GTQI 2JA8I 4DK1A 1DL6A 3S1QI 1NP6A 1N8R1 4BY1I 4A3KI 3M3YI 4MRIA 1TWGI 3M4OI 1K9M1 3D9XA 3JAMf 1Q822 2F4MA 1M1K2 2Y0SA 1NUIA 3IF8A 2RBLA 3G711 4E30A 2E2HI 3S1NI 1ZB8A 2HF1A 2QKDA 3CC41 3G71Z 3OW2Y 2AKLA 2QLVB 2HU9A 1Q861 2O4HA 3OW2Z 1R9TI 1KD11 2DE7A 2H85A 5IP7I 1QVFY 3CCR1 5FLMI 3CCQ1 4NBBA 3MZKB 1N2FA 3I4MI 1Z02A 3FQMA 3NH5A 1Q7Y1 3CCE1 1S721 3PO3I 1KRLA 3CCRZ 1QVFZ 1M901 3CCQZ 1VQ91 3HKZA 3GTGI 1VLAA 3CC21 3CCEZ 1S72Z 3NFZA 2G2KA 1VQ9Z 3PO2I 2LIYA 3CC2Z 3IX0A 3LUSA 4E32A 3CMA1 2NVXI 3S15I 1TFIA 4E33A 3CMAZ 4NBHA 3S16I 5LL6f 1NJI2 3P5JB 2KPIA 4MD7A 1K732 4E2XA 4CL1A 2NVQI 1Z01A 3Q87A 4X6AI 3HOXI 4RV9A 1I50I 1K8A2 1VQ51 3VMHA 1QVGY 3GCFA 2RPRA 3RZOI 5T67A 4EWCA 3I551 2KI7B 4S1TA 1VQ5Z 3I561 4DQYB 3HOUI 5CM2M 3J81f 3GTPI 2NVTI 3GTMS 3U50C 4E2YA 3I55Z 3I56Z 1W2BY 1YUAA 2JA6I 3QWUA 1RO2A 4MONA 3CCL1 3S2HI 2P3YA 5T64A 4A3JI 2PMZA 4NBEA 1N8R2 1WIIA 1QF8A 3CCJZ 3CCLZ 4RVFA 1TWFI 4NBDA 3PO3S 2W04A 4RVHA 5AN9F 2QR1B 2NVYI 1PFTA 3JAMb 2DE6A 4NB9A 2IZ3A 1VQK1 3VB9A 4A3FI 5D1PA 1RLYA 4NB8A 3S14I 3VMGA 3GTMI 3CCV1 2LFUA 2JA5I 3CC4Z 1VQKZ 1Q862 1QYPA 2JR6A 4NOZA 3TE5B 3F3PC 3CXCY 1KD12 1YIJ1 3CCVZ 3HOZI 1YUKA 1Q811 1KC81 1RO4A 1VQN1 4NH1C 1Q7Y2 4A3GI 1YIJZ 4A3DI 3I4NI 4A3LI 3CPWY 1M902 3CCM1 1X0TA 3K7AI 1VQNZ 2PK7A 1JJ2Y 2IZ4A 4BY7I 5IP9I 2R93I 2E2JI 3CPWZ 2DE5A 3HOWI 2VUMI 3CCMZ 2QRDB 1YHQ1 2P28A 1JJ2Z 3CQZI 2OOYB 4A3II 2I3CA 3FKII 3G4S1 3CCS1 3RZDI 3IFUA 1YHQZ 5C3EI 1YJW1 2M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  1DL6 A;  3S1Q I;  4BY1 I;  4A3K I;  3M3Y I;  3H3V J;  3HOY I;  1TWG I;  3HOU I;  3M4O I;  5CM2 M;  2JNY A;  4Y7N I;  1L1O C;  4A3B I;  3GTP I;  2NVT I;  3GKQ A;  3GTM S;  2F4M A;  3U50 C;  3GTK I;  4BBR I;  3D6W A;  1X3Z A;  1NUI A;  2RBL A;  1YUA A;  2E2H I;  2JA6 I;  3ESW A;  3S1N I;  1ZB8 A;  3S1M I;  2HF1 A;  1WCM I;  1LQL A;  3S2H I;  5C44 I;  1TWC I;  1X3W A;  2P3Y A;  1Y1W I;  4A3J I;  4NBE A;  2E2I I;  4XX2 A;  2AKL A;  1TWF I;  4NBD A;  2JA7 I;  3PO3 S;  4NBC A;  4A3E I;  1R9T I;  4A3C I;  2DE7 A;  4NBG A;  4BXX I;  5IP7 I;  2NVY I;  1PFT A;  5FLM I;  4NBB A;  1TWH I;  1ZB9 A;  1N2F A;  3I4M I;  2DE6 A;  2K5R A;  3S1R I;  4A93 I;  4NB9 A;  3PO3 I;  3VB9 A;  4A3F I;  3GTO I;  1RLY A;  4NB8 A;  3S14 I;  4NBA A;  3VMG A;  4A3M I;  3GTM I;  3GTG I;  1VLA A;  3H0G I;  2JA5 I;  1USP B;  2JS4 A;  4MH4 A;  3GTJ I;  1I6H I;  1QYP A;  2JR6 A;  4NOZ A;  3PO2 I;  4NBF A;  3HOZ I;  5C4X I;  2R7Z I;  4BBS I;  3LUS A;  2R92 I;  1RO4 A;  1SFO I;  1Y1V S;  2F4O A;  1I3Q I;  2NVX I;  4A3G I;  1TWA I;  4A3D I;  3S15 I;  3I4N I;  4A3L I;  1TFI A;  2B63 I;  3I07 A;  3K7A I;  1K83 I;  4NBH A;  3S16 I;  2PK7 A;  2KPI A;  4BY7 I;  5IP9 I;  2R93 I;  4Y52 I;  2E2J I;  2DE5 A;  3HOW I;  2VUM I;  1Y1V I;  3HOV I;  2YU9 I;  2NVQ I;  3GTL I;  3Q87 A;  3CQZ I;  4QTU A;  4X6A I;  3S2D I;  1WW9 A;  4QTT A;  3HOX I;  4A3I I;  3FKI I;  3VMI A;  1I50 I;  2J6A A;  3EER A;  3VMH A;  3S17 I;  2BJO A;  3GCF A;  3RZD I;  3RZO I;  5C4J I;  1ML8 A;  5C3E I;  3GTQ I;  2JA8 I; 
#chains in the Genus database with same CATH topology
 2E9H A;  3G4S Z;  4E31 A;  3J7A 4;  2JNY A;  4MD8 A;  5T6B A;  1YJW Z;  4A3B I;  3GKQ A;  3GTK I;  2WB1 A;  4BBR I;  3D6W A;  1X3Z A;  1VQ4 1;  2Q4Z A;  3ESW A;  1VQ7 1;  1WCM I;  5D1O B;  1VQ6 1;  5C44 I;  1X3W A;  1YIT 1;  1VQ4 Z;  2VPX A;  4E2W A;  2E2I I;  2VUG A;  1VQL 1;  1RQF A;  1VQ7 Z;  2YAD A;  1YI2 1;  1VQ6 Z;  1VQM 1;  1QVG Z;  1YIT Z;  3BG1 B;  3CCU 1;  4A3E I;  1VQL Z;  4NBG A;  3J81 b;  2V8J A;  1YI2 Z;  2RHB A;  4E2Z A;  3J80 b;  4MXU A;  3FQQ A;  1ZB9 A;  2K5R A;  3CCU Z;  2PM9 A;  1RO0 A;  2JMO A;  4A93 I;  1YJN 1;  3GTO I;  1W2B Z;  2NAP A;  2K3R A;  3H0G I;  5FLX b;  5A2Q b;  4HGZ A;  1USP B;  2QEX 1;  1YJN Z;  4MH4 A;  3GTJ I;  1K9M 2;  5IT9 f;  2EGT A;  5C4X I;  2V8K A;  5D1O A;  2R6M A;  2RT9 A;  2QEX Z;  1SFO I;  4AYB A;  2F4O A;  1I3Q I;  1TWA I;  3NDJ A;  2B63 I;  4RVG A;  1K83 I;  2QRE B;  2OOX B;  1VQP 1;  3T4N B;  1Y1V I;  1ZH1 A;  1Q82 1;  1M1K 1;  2JUB A;  1Q81 2;  1VQP Z;  1KC8 2;  4QTT A;  3VMI A;  2J6A A;  2O53 A;  3CXC Z;  1KQS Y;  3S17 I;  2BJO A;  5C4J I;  1ML8 A;  1RNI A;  1USP A;  3TDH B;  2RIQ A;  4RVD A;  3H3V J;  2OTL 1;  3HOY I;  2ZAE B;  1KQS Z;  3KIH A;  4Y7N I;  1L1O C;  2VF1 A;  2WAQ A;  2GU2 A;  3F3F C;  2OTL Z;  2JIQ A;  3S1M I;  1LQL A;  1TWC I;  1Y1W I;  3NDI A;  3BG0 B;  2OTJ 1;  4XX2 A;  1JWH C;  2QRC B;  2GTH A;  3CCS Z;  2JA7 I;  1SIW A;  4NBC A;  3CC7 1;  1P9N A;  2OTJ Z;  3EED A;  4A3C I;  4BXX I;  1TWH I;  2JIO A;  2GTI A;  4RS4 A;  3CC7 Z;  3CD6 1;  3S1R I;  4NFR A;  2V8I A;  1VQO 1;  2QA4 1;  3KIF A;  4NBA A;  2Q51 A;  4A3M I;  3CME 1;  1NJI 1;  3CD6 Z;  2JS4 A;  2LEX A;  4TNU A;  1K73 1;  1I6H I;  1VQO Z;  2QA4 Z;  4NBF A;  2R7Z I;  1YJ9 1;  4MD9 A;  3CME Z;  4BBS I;  2R92 I;  1Y1V S;  1VQM Z;  3NH4 A;  1K8A 1;  2W03 A;  1VQ8 1;  4DGL A;  1Z03 A;  1YJ9 Z;  3I07 A;  3G6E 1;  2OZK A;  4Y52 I;  3J80 f;  1VQ8 Z;  4HGY A;  3HOV I;  3G6E Z;  3MZL B;  2YU9 I;  3GTL I;  3NH8 A;  1WJ2 A;  4QTU A;  2M48 A;  3S2D I;  1WW9 A;  3VTN A;  3MON A;  5IT9 b;  3CCJ 1;  3EER A;  4HH4 A;  5FLX f;  5A2Q f;  1S7M A;  3GTQ I;  2JA8 I;  4DK1 A;  1DL6 A;  3S1Q I;  1NP6 A;  1N8R 1;  4BY1 I;  4A3K I;  3M3Y I;  2E7Z A;  4MRI A;  1TWG I;  3M4O I;  1K9M 1;  3D9X A;  3JAM f;  1Q82 2;  2F4M A;  1M1K 2;  2Y0S A;  1NUI A;  3IF8 A;  2RBL A;  3G71 1;  4E30 A;  2E2H I;  3S1N I;  1ZB8 A;  2HF1 A;  2QKD A;  3CC4 1;  3G71 Z;  3OW2 Y;  2AKL A;  2QLV B;  2HU9 A;  1Q86 1;  2O4H A;  3OW2 Z;  1R9T I;  1KD1 1;  2DE7 A;  2H85 A;  5IP7 I;  1QVF Y;  3CCR 1;  5FLM I;  3CCQ 1;  4NBB A;  3MZK B;  1N2F A;  3I4M I;  1FDO A;  1Z02 A;  2JIP A;  3FQM A;  3NH5 A;  1Q7Y 1;  3CCE 1;  1S72 1;  3PO3 I;  1KRL A;  3CCR Z;  1QVF Z;  1M90 1;  3CCQ Z;  1VQ9 1;  3HKZ A;  3GTG I;  1VLA A;  3CC2 1;  3CCE Z;  1S72 Z;  3NFZ A;  2G2K A;  2V3V A;  1VQ9 Z;  3PO2 I;  2LIY A;  2V45 A;  3CC2 Z;  3IX0 A;  3LUS A;  4E32 A;  3CMA 1;  2NVX I;  3S15 I;  2VPW A;  1TFI A;  3IR7 A;  1Y8C A;  4E33 A;  3CMA Z;  4NBH A;  3S16 I;  5LL6 f;  1NJI 2;  3P5J B;  2KPI A;  4MD7 A;  1K73 2;  4E2X A;  4CL1 A;  2NVQ I;  1Z01 A;  3Q87 A;  4X6A I;  3HOX I;  4RV9 A;  1I50 I;  1K8A 2;  1VQ5 1;  3VMH A;  1QVG Y;  3GCF A;  2RPR A;  3RZO I;  5T67 A;  4EWC A;  3I55 1;  2KI7 B;  4S1T A;  1VQ5 Z;  3I56 1;  4DQY B;  3HOU I;  5CM2 M;  3J81 f;  2VPY A;  3GTP I;  2NVT I;  3GTM S;  3U50 C;  4E2Y A;  2VPZ A;  3I55 Z;  3I56 Z;  2AYD A;  1W2B Y;  1YUA A;  2JA6 I;  3QWU A;  1RO2 A;  4MON A;  3CCL 1;  1Q16 A;  3S2H I;  2P3Y A;  5T64 A;  4A3J I;  2PMZ A;  4NBE A;  1N8R 2;  1WII A;  1QF8 A;  3CCJ Z;  3CCL Z;  2JIR A;  4RVF A;  1TWF I;  4NBD A;  3PO3 S;  2W04 A;  4RVH A;  5AN9 F;  2QR1 B;  2NVY I;  1PFT A;  3JAM b;  1WZN A;  2DE6 A;  4NB9 A;  2IZ3 A;  1VQK 1;  3VB9 A;  4A3F I;  5D1P A;  1RLY A;  4NB8 A;  3S14 I;  3VMG A;  3GTM I;  3CCV 1;  2LFU A;  2JA5 I;  3CC4 Z;  2JIM A;  1VQK Z;  1Q86 2;  1QYP A;  2JR6 A;  4NOZ A;  3TE5 B;  3F3P C;  3CXC Y;  1KD1 2;  1YIJ 1;  3CCV Z;  3HOZ I;  1AA6 A;  1YUK A;  3D2L A;  1Q81 1;  1KC8 1;  1RO4 A;  1VQN 1;  4NH1 C;  1Q7Y 2;  4A3G I;  1YIJ Z;  4A3D I;  3I4N I;  4A3L I;  1FDI A;  3CPW Y;  1M90 2;  3CCM 1;  1X0T A;  3K7A I;  1VQN Z;  2PK7 A;  2IV2 X;  1JJ2 Y;  2IZ4 A;  4BY7 I;  5IP9 I;  2R93 I;  2E2J I;  3CPW Z;  2DE5 A;  3HOW I;  2VUM I;  3CCM Z;  1QXF A;  2QRD B;  1YHQ 1;  2P28 A;  1JJ2 Z;  3CQZ I;  2OOY B;  4A3I I;  2I3C A;  3FKI I;  3G4S 1;  3CCS 1;  3RZD I;  3IFU A;  1YHQ Z;  5C3E I;  1YJW 1;  2M6N A; 
#chains in the Genus database with same CATH homology
 2E9H A;  3G4S Z;  4E31 A;  3J7A 4;  2JNY A;  4MD8 A;  5T6B A;  1YJW Z;  4A3B I;  3GKQ A;  3GTK I;  2WB1 A;  4BBR I;  3D6W A;  1X3Z A;  1VQ4 1;  2Q4Z A;  3ESW A;  1VQ7 1;  1WCM I;  5D1O B;  1VQ6 1;  5C44 I;  1X3W A;  1YIT 1;  1VQ4 Z;  4E2W A;  2E2I I;  2VUG A;  1VQL 1;  1RQF A;  1VQ7 Z;  2YAD A;  1YI2 1;  1VQ6 Z;  1VQM 1;  1QVG Z;  1YIT Z;  3BG1 B;  3CCU 1;  4A3E I;  1VQL Z;  4NBG A;  3J81 b;  2V8J A;  1YI2 Z;  2RHB A;  4E2Z A;  3J80 b;  4MXU A;  3FQQ A;  1ZB9 A;  2K5R A;  3CCU Z;  2PM9 A;  1RO0 A;  2JMO A;  4A93 I;  1YJN 1;  3GTO I;  1W2B Z;  2K3R A;  3H0G I;  5FLX b;  5A2Q b;  4HGZ A;  1USP B;  2QEX 1;  1YJN Z;  4MH4 A;  3GTJ I;  1K9M 2;  5IT9 f;  2EGT A;  5C4X I;  2V8K A;  5D1O A;  2R6M A;  2RT9 A;  2QEX Z;  1SFO I;  4AYB A;  2F4O A;  1I3Q I;  1TWA I;  3NDJ A;  2B63 I;  4RVG A;  1K83 I;  2QRE B;  2OOX B;  1VQP 1;  3T4N B;  1Y1V I;  1ZH1 A;  1Q82 1;  1M1K 1;  2JUB A;  1Q81 2;  1VQP Z;  1KC8 2;  4QTT A;  3VMI A;  2J6A A;  2O53 A;  3CXC Z;  1KQS Y;  3S17 I;  2BJO A;  5C4J I;  1ML8 A;  1RNI A;  1USP A;  3TDH B;  2RIQ A;  4RVD A;  3H3V J;  2OTL 1;  3HOY I;  2ZAE B;  1KQS Z;  3KIH A;  4Y7N I;  1L1O C;  2VF1 A;  2WAQ A;  2GU2 A;  3F3F C;  2OTL Z;  3S1M I;  1LQL A;  1TWC I;  1Y1W I;  3NDI A;  3BG0 B;  2OTJ 1;  4XX2 A;  1JWH C;  2QRC B;  2GTH A;  3CCS Z;  2JA7 I;  4NBC A;  3CC7 1;  1P9N A;  2OTJ Z;  3EED A;  4A3C I;  4BXX I;  1TWH I;  2GTI A;  4RS4 A;  3CC7 Z;  3CD6 1;  3S1R I;  4NFR A;  2V8I A;  1VQO 1;  2QA4 1;  3KIF A;  4NBA A;  2Q51 A;  4A3M I;  3CME 1;  1NJI 1;  3CD6 Z;  2JS4 A;  4TNU A;  1K73 1;  1I6H I;  1VQO Z;  2QA4 Z;  4NBF A;  2R7Z I;  1YJ9 1;  4MD9 A;  3CME Z;  4BBS I;  2R92 I;  1Y1V S;  1VQM Z;  3NH4 A;  1K8A 1;  2W03 A;  1VQ8 1;  4DGL A;  1Z03 A;  1YJ9 Z;  3I07 A;  3G6E 1;  2OZK A;  4Y52 I;  3J80 f;  1VQ8 Z;  4HGY A;  3HOV I;  3G6E Z;  3MZL B;  2YU9 I;  3GTL I;  3NH8 A;  4QTU A;  2M48 A;  3S2D I;  1WW9 A;  3VTN A;  3MON A;  5IT9 b;  3CCJ 1;  3EER A;  4HH4 A;  5FLX f;  5A2Q f;  1S7M A;  3GTQ I;  2JA8 I;  4DK1 A;  1DL6 A;  3S1Q I;  1NP6 A;  1N8R 1;  4BY1 I;  4A3K I;  3M3Y I;  4MRI A;  1TWG I;  3M4O I;  1K9M 1;  3D9X A;  3JAM f;  1Q82 2;  2F4M A;  1M1K 2;  2Y0S A;  1NUI A;  3IF8 A;  2RBL A;  3G71 1;  4E30 A;  2E2H I;  3S1N I;  1ZB8 A;  2HF1 A;  2QKD A;  3CC4 1;  3G71 Z;  3OW2 Y;  2AKL A;  2QLV B;  2HU9 A;  1Q86 1;  2O4H A;  3OW2 Z;  1R9T I;  1KD1 1;  2DE7 A;  2H85 A;  5IP7 I;  1QVF Y;  3CCR 1;  5FLM I;  3CCQ 1;  4NBB A;  3MZK B;  1N2F A;  3I4M I;  1Z02 A;  3FQM A;  3NH5 A;  1Q7Y 1;  3CCE 1;  1S72 1;  3PO3 I;  1KRL A;  3CCR Z;  1QVF Z;  1M90 1;  3CCQ Z;  1VQ9 1;  3HKZ A;  3GTG I;  1VLA A;  3CC2 1;  3CCE Z;  1S72 Z;  3NFZ A;  2G2K A;  1VQ9 Z;  3PO2 I;  2LIY A;  3CC2 Z;  3IX0 A;  3LUS A;  4E32 A;  3CMA 1;  2NVX I;  3S15 I;  1TFI A;  4E33 A;  3CMA Z;  4NBH A;  3S16 I;  5LL6 f;  1NJI 2;  3P5J B;  2KPI A;  4MD7 A;  1K73 2;  4E2X A;  4CL1 A;  2NVQ I;  1Z01 A;  3Q87 A;  4X6A I;  3HOX I;  4RV9 A;  1I50 I;  1K8A 2;  1VQ5 1;  3VMH A;  1QVG Y;  3GCF A;  2RPR A;  3RZO I;  5T67 A;  4EWC A;  3I55 1;  2KI7 B;  4S1T A;  1VQ5 Z;  3I56 1;  4DQY B;  3HOU I;  5CM2 M;  3J81 f;  3GTP I;  2NVT I;  3GTM S;  3U50 C;  4E2Y A;  3I55 Z;  3I56 Z;  1W2B Y;  1YUA A;  2JA6 I;  3QWU A;  1RO2 A;  4MON A;  3CCL 1;  3S2H I;  2P3Y A;  5T64 A;  4A3J I;  2PMZ A;  4NBE A;  1N8R 2;  1WII A;  1QF8 A;  3CCJ Z;  3CCL Z;  4RVF A;  1TWF I;  4NBD A;  3PO3 S;  2W04 A;  4RVH A;  5AN9 F;  2QR1 B;  2NVY I;  1PFT A;  3JAM b;  2DE6 A;  4NB9 A;  2IZ3 A;  1VQK 1;  3VB9 A;  4A3F I;  5D1P A;  1RLY A;  4NB8 A;  3S14 I;  3VMG A;  3GTM I;  3CCV 1;  2LFU A;  2JA5 I;  3CC4 Z;  1VQK Z;  1Q86 2;  1QYP A;  2JR6 A;  4NOZ A;  3TE5 B;  3F3P C;  3CXC Y;  1KD1 2;  1YIJ 1;  3CCV Z;  3HOZ I;  1YUK A;  1Q81 1;  1KC8 1;  1RO4 A;  1VQN 1;  4NH1 C;  1Q7Y 2;  4A3G I;  1YIJ Z;  4A3D I;  3I4N I;  4A3L I;  3CPW Y;  1M90 2;  3CCM 1;  1X0T A;  3K7A I;  1VQN Z;  2PK7 A;  1JJ2 Y;  2IZ4 A;  4BY7 I;  5IP9 I;  2R93 I;  2E2J I;  3CPW Z;  2DE5 A;  3HOW I;  2VUM I;  3CCM Z;  2QRD B;  1YHQ 1;  2P28 A;  1JJ2 Z;  3CQZ I;  2OOY B;  4A3I I;  2I3C A;  3FKI I;  3G4S 1;  3CCS 1;  3RZD I;  3IFU A;  1YHQ Z;  5C3E I;  1YJW 1;  2M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...