1TWCI

Rna polymerase ii complexed with gtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI02
4NBFA 3S1MI 2J6AA 3S15I 2E2JI 4BBSI 4Y7NI 1RO4A 3I07A 5IP7I 1RLYA 3VMHA 3GKQA 2AKLA 3GTGI 1Y1VI 2JR6A 1N2FA 1TWCI 2HF1A 4NBCA 3S17I 1R9TI 3M4OI 3LUSA 1WW9A 4NB9A 3I4NI 3GTMS 4A3BI 3HOWI 1YUAA 3S1NI 3GTKI 3S1RI 3PO2I 5C4XI 4A3MI 2NVXI 3S2DI 4X6AI 3I4MI 1QYPA 2NVQI 4A3FI 1Y1VS 4NB8A 4A3DI 4A3LI 4A93I 1TWGI 4NBGA 1ML8A 4NBEA 1DL6A 3GTLI 2R7ZI 2JNYA 2JA7I 3VMIA 2DE5A 4XX2A 1K83I 1ZB8A 2DE6A 3HOUI 4BXXI 3H3VJ 3GTQI 3RZDI 3HOYI 3VMGA 3PO3I 4BY7I 2NVYI 4NBHA 3GTOI 2R93I 3U50C 3GTJI 3RZOI 3ESWA 3S14I 1I50I 5IP9I 3HOZI 1ZB9A 2B63I 3Q87A 3HOVI 4A3GI 1TWHI 4A3EI 2JA8I 4NBDA 1USPB 4A3CI 1TWFI 2E2II 1SFOI 2NVTI 1Y1WI 1LQLA 3VB9A 5C3EI 2PK7A 1TFIA 2KPIA 3PO3S 3S2HI 1I6HI 3M3YI 2YU9I 4Y52I 3HOXI 4MH4A 4BBRI 3GTMI 1X3ZA 1X3WA 2VUMI 3S16I 2JA6I 1TWAI 2F4MA 2F4OA 5FLMI 2P3YA 3EERA 4NBBA 3GCFA 3D6WA 1WCMI 4A3II 4QTTA 3H0GI 1USPA 4A3KI 1I3QI 4NOZA 4A3JI 2BJOA 2R92I 2E2HI 4NBAA 1PFTA 2RBLA 5CM2M 4BY1I 5C4JI 2DE7A 1NUIA 3K7AI 1VLAA 2JA5I 3GTPI 2JS4A 3FKII 2K5RA 1L1OC 5C44I 3S1QI 4QTUA 3CQZI
chains in the Genus database with same CATH superfamily
1VQO1 3S1MI 2E2JI 3CXCY 2EGTA 1YI21 4AYBA 2JR6A 1N2FA 3MZLB 4NBCA 2W03A 1YJWZ 3J80f 2PM9A 4HH4A 4NB9A 1FDIA 4A3BI 3HOWI 3S1NI 3GTKI 3NH4A 4A3MI 1VQ71 2NVXI 3CC7Z 2PMZA 4X6AI 1Y1VS 4A3LI 3VTNA 3CCR1 2QR1B 2QRCB 4NBGA 3CCVZ 2QRDB 1YHQ1 1K732 3GTLI 2JNYA 2JA7I 2DE5A 3CPWY 1K83I 3HKZA 3I55Z 3VMGA 2NVYI 1VQP1 3G711 3CCM1 3CMA1 1Q821 1RO2A 1I50I 2V8IA 2VPWA 1JWHC 3HOZI 4A3GI 3JAMb 4NBDA 4A3CI 1QF8A 2JUBA 3T4NB 4E2ZA 1Y1WI 4MXUA 1I6HI 1JJ2Z 2VPXA 4Y52I 2LEXA 1QVGY 3KIHA 3OW2Y 4DQYB 3FQMA 4E2WA 4E33A 3GCFA 3D6WA 4MONA 2JIRA 2JIMA 4QTTA 1I3QI 4NOZA 4A3JI 2BJOA 2E2HI 2O53A 5C4JI 2DE7A 1NUIA 3I56Z 1VLAA 2RT9A 1W2BY 3CCEZ 2K5RA 1Z01A 1YJ91 1VQL1 2QA41 2JMOA 4NBFA 1Q7Y2 5A2Qb 1S72Z 4E2XA 3S15I 1Q16A 1QXFA 5IP7I 1RLYA 1YIT1 3GKQA 4RVHA 2V8JA 3CD6Z 3D9XA 2HF1A 1KC81 1K8A2 1P9NA 2RIQA 5D1OA 1VQKZ 2ZAEB 3CCQZ 4DK1A 1M901 3CCLZ 3CCU1 2OTJ1 2H85A 1YUAA 3PO2I 1RQFA 5IT9b 2O4HA 2QEXZ 1X0TA 3I551 4A3FI 2GU2A 1VQN1 4HGZA 1ML8A 2QKDA 3F3FC 2VF1A 4NBEA 1K731 4XX2A 3CC2Z 2JIOA 2YADA 1RNIA 1Z02A 5FLXb 4BXXI 3GTQI 3RZDI 3IR7A 3PO3I 4BY7I 1Q812 4NBHA 2JIPA 3GTOI 4RVDA 3RZOI 3ESWA 3FQQA 1NJI1 2E9HA 2B63I 1K9M2 1QVGZ 1KD12 3J7A4 4A3EI 1S7MA 3G4S1 1SFOI 3G6E1 1LQLA 1VQ5Z 3CME1 2Y0SA 5C3EI 2QREB 1TFIA 2KPIA 4HGYA 1VQMZ 1VQ91 2YU9I 3HOXI 4NFRA 4MH4A 4BBRI 3IX0A 1ZH1A 4E31A 1X3ZA 3S16I 1W2BZ 4NBBA 2AYDA 2W04A 4A3II 1VQ4Z 2OTL1 3H0GI 2KI7B 3JAMf 3CCS1 1VQ61 3J81b 5D1OB 1VQOZ 5CM2M 2JA5I 3GTPI 2HU9A 2JS4A 3FKII 4E2YA 3CC41 1L1OC 3EEDA 5C44I 1YI2Z 2WB1A 4QTUA 2P28A 2Q4ZA 3CCL1 2J6AA 1M1K1 1RO4A 2GTIA 3I07A 1SIWA 4RV9A 3VMHA 2AKLA 1YIJZ 3GTGI 1Y1VI 1TWCI 1Q862 3NDIA 1VQ7Z 1WZNA 3S17I 1R9TI 1K8A1 3M4OI 3CXCZ 1WW9A 2IZ3A 1N8R1 3I4NI 3CCRZ 3S1RI 1Q822 1YJW1 1YHQZ 2K3RA 1QYPA 5LL6f 5A2Qf 5AN9F 4A3DI 4NB8A 2WAQA 3TDHB 2OOYB 4A93I 1YUKA 2OOXB 1KQSY 1VQPZ 3G71Z 3CC71 1DL6A 5D1PA 3VMIA 3CCMZ 3CMAZ 2IV2X 1QVFY 1KRLA 3HOUI 3H3VJ 2Q51A 2VPZA 3CCV1 3MONA 3CPWZ 4RVFA 5IT9f 2QLVB 2V3VA 3U50C 3GTJI 2RPRA 3Q87A 2JA8I 1JJ2Y 1TWFI 2NVTI 2M6NA 2GTHA 3MZKB 3S2HI 5FLXf 3TE5B 3M3YI 2VPYA 2VUGA 2LIYA 5T67A 2I3CA 3BG1B 2F4MA 2IZ4A 5FLMI 2R6MA 3EERA 1RO0A 1WCMI 3OW2Z 1KC82 1USPA 1AA6A 1YJNZ 1YJ9Z 1VQLZ 3J80b 2QA4Z 2R92I 1M902 4NBAA 2RBLA 4BY1I 1VQ8Z 3K7AI 1YIJ1 4MD8A 4EWCA 1YITZ 1FDOA 3S1QI 3CQZI 2G2KA 1Y8CA 4E30A 2JIQA 2NAPA 3I561 4BBSI 4Y7NI 3CCUZ 3CCE1 3NH8A 4RVGA 2OTJZ 5T6BA 2LFUA 4MD9A 1Q861 3CCJZ 2OTLZ 1S721 3J81f 3LUSA 2E7ZA 1KQSZ 1VQNZ 3GTMS 4CL1A 3CD61 5C4XI 2OZKA 1QVFZ 1VQK1 5T64A 1NJI2 3S2DI 3P5JB 3CCQ1 3I4MI 3IF8A 2NVQI 1Q7Y1 1NP6A 1TWGI 4TNUA 2R7ZI 3IFUA 2QEX1 1ZB8A 2DE6A 3HOYI 3QWUA 2M48A 2R93I 1WIIA 3G4SZ 3CC21 4DGLA 3G6EZ 3S14I 5IP9I 3CMEZ 4MRIA 1ZB9A 3HOVI 3D2LA 3F3PC 1TWHI 1VQ9Z 3NFZA 1USPB 2E2II 3NH5A 1WJ2A 3VB9A 3NDJA 3KIFA 2PK7A 2V8KA 3PO3S 2RHBA 1Z03A 1YJN1 3GTMI 4MD7A 4RS4A 1VQ51 1X3WA 1Q811 1M1K2 3CCSZ 1VQ81 1VQ6Z 2JA6I 2VUMI 1TWAI 2F4OA 1VQM1 3BG0B 2P3YA 4E32A 1K9M1 1KD11 3CC4Z 4A3KI 2V45A 4S1TA 1N8R2 1PFTA 1VQ41 4NH1C 3CCJ1
chains in the Genus database with same CATH topology
1VQO1 3S1MI 2E2JI 3CXCY 2EGTA 1YI21 4AYBA 2JR6A 1N2FA 3MZLB 4NBCA 2W03A 1YJWZ 3J80f 2PM9A 4HH4A 4NB9A 4A3BI 3HOWI 3S1NI 3GTKI 3NH4A 4A3MI 1VQ71 2NVXI 3CC7Z 2PMZA 4X6AI 1Y1VS 4A3LI 3VTNA 3CCR1 2QR1B 2QRCB 4NBGA 3CCVZ 2QRDB 1YHQ1 1K732 3GTLI 2JNYA 2JA7I 2DE5A 3CPWY 1K83I 3HKZA 3I55Z 3VMGA 2NVYI 1VQP1 3G711 3CCM1 3CMA1 1Q821 1RO2A 1I50I 2V8IA 3HOZI 1JWHC 4A3GI 3JAMb 4NBDA 4A3CI 1QF8A 2JUBA 3T4NB 4E2ZA 1Y1WI 4MXUA 1I6HI 1JJ2Z 4Y52I 1QVGY 3KIHA 3OW2Y 4DQYB 3FQMA 4E2WA 4E33A 3GCFA 3D6WA 4MONA 4QTTA 1I3QI 4NOZA 4A3JI 2BJOA 2E2HI 2O53A 5C4JI 2DE7A 1NUIA 3I56Z 1VLAA 2RT9A 1W2BY 3CCEZ 2K5RA 1Z01A 1YJ91 1VQL1 2QA41 2JMOA 4NBFA 1Q7Y2 5A2Qb 1S72Z 4E2XA 3S15I 5IP7I 1RLYA 1YIT1 3GKQA 4RVHA 2V8JA 3CD6Z 3D9XA 2HF1A 1KC81 1K8A2 1P9NA 2RIQA 5D1OA 1VQKZ 2ZAEB 3CCQZ 4DK1A 1M901 3CCLZ 3CCU1 2OTJ1 2H85A 1YUAA 3PO2I 1RQFA 5IT9b 2O4HA 2QEXZ 1X0TA 3I551 4A3FI 2GU2A 1VQN1 4HGZA 1ML8A 2QKDA 3F3FC 2VF1A 4NBEA 1K731 4XX2A 3CC2Z 2YADA 1RNIA 1Z02A 5FLXb 4BXXI 3GTQI 3RZDI 3PO3I 4BY7I 1Q812 4NBHA 3GTOI 4RVDA 3RZOI 3ESWA 3FQQA 1NJI1 2E9HA 2B63I 1K9M2 1QVGZ 1KD12 3J7A4 4A3EI 1S7MA 3G4S1 1SFOI 3G6E1 1LQLA 1VQ5Z 3CME1 2Y0SA 5C3EI 2QREB 1TFIA 2KPIA 4HGYA 1VQMZ 1VQ91 2YU9I 3HOXI 4NFRA 4MH4A 4BBRI 3IX0A 1ZH1A 4E31A 1X3ZA 3S16I 1W2BZ 4NBBA 2W04A 4A3II 1VQ4Z 2OTL1 3H0GI 2KI7B 3JAMf 3CCS1 1VQ61 3J81b 5D1OB 1VQOZ 5CM2M 2JA5I 3GTPI 2HU9A 2JS4A 3FKII 4E2YA 3CC41 1L1OC 3EEDA 5C44I 1YI2Z 2WB1A 4QTUA 2P28A 2Q4ZA 3CCL1 2J6AA 1M1K1 1RO4A 2GTIA 3I07A 4RV9A 3VMHA 2AKLA 1YIJZ 3GTGI 1Y1VI 1TWCI 1Q862 3NDIA 1VQ7Z 3S17I 1R9TI 1K8A1 3M4OI 3CXCZ 1WW9A 2IZ3A 1N8R1 3I4NI 3CCRZ 3S1RI 1Q822 1YJW1 1YHQZ 2K3RA 1QYPA 5LL6f 5A2Qf 5AN9F 4A3DI 4NB8A 2WAQA 3TDHB 2OOYB 4A93I 1YUKA 2OOXB 1KQSY 1VQPZ 3G71Z 3CC71 1DL6A 5D1PA 3VMIA 3CCMZ 3CMAZ 1QVFY 1KRLA 3HOUI 3H3VJ 2Q51A 3CCV1 3MONA 3CPWZ 4RVFA 5IT9f 2QLVB 3U50C 3GTJI 2RPRA 3Q87A 2JA8I 1JJ2Y 1TWFI 2NVTI 2M6NA 2GTHA 3MZKB 3S2HI 5FLXf 3TE5B 3M3YI 2VUGA 2LIYA 5T67A 2I3CA 3BG1B 2F4MA 2IZ4A 5FLMI 2R6MA 3EERA 1RO0A 1WCMI 3OW2Z 1KC82 1USPA 1YJNZ 1YJ9Z 1VQLZ 3J80b 2QA4Z 2R92I 1M902 4NBAA 2RBLA 4BY1I 1VQ8Z 3K7AI 1YIJ1 4MD8A 4EWCA 1YITZ 3S1QI 3CQZI 2G2KA 4E30A 3I561 4BBSI 4Y7NI 3CCUZ 3CCE1 3NH8A 4RVGA 2OTJZ 5T6BA 2LFUA 4MD9A 1Q861 3CCJZ 2OTLZ 1S721 3J81f 3LUSA 1KQSZ 1VQNZ 3GTMS 4CL1A 3CD61 5C4XI 2OZKA 1QVFZ 1VQK1 5T64A 1NJI2 3S2DI 3P5JB 3CCQ1 3I4MI 3IF8A 2NVQI 1Q7Y1 1NP6A 1TWGI 4TNUA 2R7ZI 3IFUA 2QEX1 1ZB8A 2DE6A 3HOYI 3QWUA 2M48A 2R93I 1WIIA 3G4SZ 3CC21 4DGLA 3G6EZ 3S14I 5IP9I 3CMEZ 4MRIA 1ZB9A 3HOVI 3F3PC 1TWHI 1VQ9Z 3NFZA 1USPB 2E2II 3NH5A 3VB9A 3NDJA 3KIFA 2PK7A 2V8KA 3PO3S 2RHBA 1Z03A 1YJN1 3GTMI 4MD7A 4RS4A 1VQ51 1X3WA 1Q811 1M1K2 3CCSZ 1VQ81 1VQ6Z 2JA6I 2VUMI 1TWAI 2F4OA 1VQM1 3BG0B 2P3YA 4E32A 1K9M1 1KD11 3CC4Z 4A3KI 4S1TA 1N8R2 1PFTA 1VQ41 4NH1C 3CCJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBF A;  3S1M I;  2J6A A;  3S15 I;  2E2J I;  4BBS I;  4Y7N I;  1RO4 A;  3I07 A;  5IP7 I;  1RLY A;  3VMH A;  3GKQ A;  2AKL A;  3GTG I;  1Y1V I;  2JR6 A;  1N2F A;  1TWC I;  2HF1 A;  4NBC A;  3S17 I;  1R9T I;  3M4O I;  3LUS A;  1WW9 A;  4NB9 A;  3I4N I;  3GTM S;  4A3B I;  3HOW I;  1YUA A;  3S1N I;  3GTK I;  3S1R I;  3PO2 I;  5C4X I;  4A3M I;  2NVX I;  3S2D I;  4X6A I;  3I4M I;  1QYP A;  2NVQ I;  4A3F I;  1Y1V S;  4NB8 A;  4A3D I;  4A3L I;  4A93 I;  1TWG I;  4NBG A;  1ML8 A;  4NBE A;  1DL6 A;  3GTL I;  2R7Z I;  2JNY A;  2JA7 I;  3VMI A;  2DE5 A;  4XX2 A;  1K83 I;  1ZB8 A;  2DE6 A;  3HOU I;  4BXX I;  3H3V J;  3GTQ I;  3RZD I;  3HOY I;  3VMG A;  3PO3 I;  4BY7 I;  2NVY I;  4NBH A;  3GTO I;  2R93 I;  3U50 C;  3GTJ I;  3RZO I;  3ESW A;  3S14 I;  1I50 I;  5IP9 I;  3HOZ I;  1ZB9 A;  2B63 I;  3Q87 A;  3HOV I;  4A3G I;  1TWH I;  4A3E I;  2JA8 I;  4NBD A;  1USP B;  4A3C I;  1TWF I;  2E2I I;  1SFO I;  2NVT I;  1Y1W I;  1LQL A;  3VB9 A;  5C3E I;  2PK7 A;  1TFI A;  2KPI A;  3PO3 S;  3S2H I;  1I6H I;  3M3Y I;  2YU9 I;  4Y52 I;  3HOX I;  4MH4 A;  4BBR I;  3GTM I;  1X3Z A;  1X3W A;  2VUM I;  3S16 I;  2JA6 I;  1TWA I;  2F4M A;  2F4O A;  5FLM I;  2P3Y A;  3EER A;  4NBB A;  3GCF A;  3D6W A;  1WCM I;  4A3I I;  4QTT A;  3H0G I;  1USP A;  4A3K I;  1I3Q I;  4NOZ A;  4A3J I;  2BJO A;  2R92 I;  2E2H I;  4NBA A;  1PFT A;  2RBL A;  5CM2 M;  4BY1 I;  5C4J I;  2DE7 A;  1NUI A;  3K7A I;  1VLA A;  2JA5 I;  3GTP I;  2JS4 A;  3FKI I;  2K5R A;  1L1O C;  5C44 I;  3S1Q I;  4QTU A;  3CQZ I; 
#chains in the Genus database with same CATH topology
 1VQO 1;  3S1M I;  2E2J I;  3CXC Y;  2EGT A;  1YI2 1;  4AYB A;  2JR6 A;  1N2F A;  3MZL B;  4NBC A;  2W03 A;  1YJW Z;  3J80 f;  2PM9 A;  4HH4 A;  4NB9 A;  1FDI A;  4A3B I;  3HOW I;  3S1N I;  3GTK I;  3NH4 A;  4A3M I;  1VQ7 1;  2NVX I;  3CC7 Z;  2PMZ A;  4X6A I;  1Y1V S;  4A3L I;  3VTN A;  3CCR 1;  2QR1 B;  2QRC B;  4NBG A;  3CCV Z;  2QRD B;  1YHQ 1;  1K73 2;  3GTL I;  2JNY A;  2JA7 I;  2DE5 A;  3CPW Y;  1K83 I;  3HKZ A;  3I55 Z;  3VMG A;  2NVY I;  1VQP 1;  3G71 1;  3CCM 1;  3CMA 1;  1Q82 1;  1RO2 A;  1I50 I;  2V8I A;  2VPW A;  1JWH C;  3HOZ I;  4A3G I;  3JAM b;  4NBD A;  4A3C I;  1QF8 A;  2JUB A;  3T4N B;  4E2Z A;  1Y1W I;  4MXU A;  1I6H I;  1JJ2 Z;  2VPX A;  4Y52 I;  2LEX A;  1QVG Y;  3KIH A;  3OW2 Y;  4DQY B;  3FQM A;  4E2W A;  4E33 A;  3GCF A;  3D6W A;  4MON A;  2JIR A;  2JIM A;  4QTT A;  1I3Q I;  4NOZ A;  4A3J I;  2BJO A;  2E2H I;  2O53 A;  5C4J I;  2DE7 A;  1NUI A;  3I56 Z;  1VLA A;  2RT9 A;  1W2B Y;  3CCE Z;  2K5R A;  1Z01 A;  1YJ9 1;  1VQL 1;  2QA4 1;  2JMO A;  4NBF A;  1Q7Y 2;  5A2Q b;  1S72 Z;  4E2X A;  3S15 I;  1Q16 A;  1QXF A;  5IP7 I;  1RLY A;  1YIT 1;  3GKQ A;  4RVH A;  2V8J A;  3CD6 Z;  3D9X A;  2HF1 A;  1KC8 1;  1K8A 2;  1P9N A;  2RIQ A;  5D1O A;  1VQK Z;  2ZAE B;  3CCQ Z;  4DK1 A;  1M90 1;  3CCL Z;  3CCU 1;  2OTJ 1;  2H85 A;  1YUA A;  3PO2 I;  1RQF A;  5IT9 b;  2O4H A;  2QEX Z;  1X0T A;  3I55 1;  4A3F I;  2GU2 A;  1VQN 1;  4HGZ A;  1ML8 A;  2QKD A;  3F3F C;  2VF1 A;  4NBE A;  1K73 1;  4XX2 A;  3CC2 Z;  2JIO A;  2YAD A;  1RNI A;  1Z02 A;  5FLX b;  4BXX I;  3GTQ I;  3RZD I;  3IR7 A;  3PO3 I;  4BY7 I;  1Q81 2;  4NBH A;  2JIP A;  3GTO I;  4RVD A;  3RZO I;  3ESW A;  3FQQ A;  1NJI 1;  2E9H A;  2B63 I;  1K9M 2;  1QVG Z;  1KD1 2;  3J7A 4;  4A3E I;  1S7M A;  3G4S 1;  1SFO I;  3G6E 1;  1LQL A;  1VQ5 Z;  3CME 1;  2Y0S A;  5C3E I;  2QRE B;  1TFI A;  2KPI A;  4HGY A;  1VQM Z;  1VQ9 1;  2YU9 I;  3HOX I;  4NFR A;  4MH4 A;  4BBR I;  3IX0 A;  1ZH1 A;  4E31 A;  1X3Z A;  3S16 I;  1W2B Z;  4NBB A;  2AYD A;  2W04 A;  4A3I I;  1VQ4 Z;  2OTL 1;  3H0G I;  2KI7 B;  3JAM f;  3CCS 1;  1VQ6 1;  3J81 b;  5D1O B;  1VQO Z;  5CM2 M;  2JA5 I;  3GTP I;  2HU9 A;  2JS4 A;  3FKI I;  4E2Y A;  3CC4 1;  1L1O C;  3EED A;  5C44 I;  1YI2 Z;  2WB1 A;  4QTU A;  2P28 A;  2Q4Z A;  3CCL 1;  2J6A A;  1M1K 1;  1RO4 A;  2GTI A;  3I07 A;  1SIW A;  4RV9 A;  3VMH A;  2AKL A;  1YIJ Z;  3GTG I;  1Y1V I;  1TWC I;  1Q86 2;  3NDI A;  1VQ7 Z;  1WZN A;  3S17 I;  1R9T I;  1K8A 1;  3M4O I;  3CXC Z;  1WW9 A;  2IZ3 A;  1N8R 1;  3I4N I;  3CCR Z;  3S1R I;  1Q82 2;  1YJW 1;  1YHQ Z;  2K3R A;  1QYP A;  5LL6 f;  5A2Q f;  5AN9 F;  4A3D I;  4NB8 A;  2WAQ A;  3TDH B;  2OOY B;  4A93 I;  1YUK A;  2OOX B;  1KQS Y;  1VQP Z;  3G71 Z;  3CC7 1;  1DL6 A;  5D1P A;  3VMI A;  3CCM Z;  3CMA Z;  2IV2 X;  1QVF Y;  1KRL A;  3HOU I;  3H3V J;  2Q51 A;  2VPZ A;  3CCV 1;  3MON A;  3CPW Z;  4RVF A;  5IT9 f;  2QLV B;  2V3V A;  3U50 C;  3GTJ I;  2RPR A;  3Q87 A;  2JA8 I;  1JJ2 Y;  1TWF I;  2NVT I;  2M6N A;  2GTH A;  3MZK B;  3S2H I;  5FLX f;  3TE5 B;  3M3Y I;  2VPY A;  2VUG A;  2LIY A;  5T67 A;  2I3C A;  3BG1 B;  2F4M A;  2IZ4 A;  5FLM I;  2R6M A;  3EER A;  1RO0 A;  1WCM I;  3OW2 Z;  1KC8 2;  1USP A;  1AA6 A;  1YJN Z;  1YJ9 Z;  1VQL Z;  3J80 b;  2QA4 Z;  2R92 I;  1M90 2;  4NBA A;  2RBL A;  4BY1 I;  1VQ8 Z;  3K7A I;  1YIJ 1;  4MD8 A;  4EWC A;  1YIT Z;  1FDO A;  3S1Q I;  3CQZ I;  2G2K A;  1Y8C A;  4E30 A;  2JIQ A;  2NAP A;  3I56 1;  4BBS I;  4Y7N I;  3CCU Z;  3CCE 1;  3NH8 A;  4RVG A;  2OTJ Z;  5T6B A;  2LFU A;  4MD9 A;  1Q86 1;  3CCJ Z;  2OTL Z;  1S72 1;  3J81 f;  3LUS A;  2E7Z A;  1KQS Z;  1VQN Z;  3GTM S;  4CL1 A;  3CD6 1;  5C4X I;  2OZK A;  1QVF Z;  1VQK 1;  5T64 A;  1NJI 2;  3S2D I;  3P5J B;  3CCQ 1;  3I4M I;  3IF8 A;  2NVQ I;  1Q7Y 1;  1NP6 A;  1TWG I;  4TNU A;  2R7Z I;  3IFU A;  2QEX 1;  1ZB8 A;  2DE6 A;  3HOY I;  3QWU A;  2M48 A;  2R93 I;  1WII A;  3G4S Z;  3CC2 1;  4DGL A;  3G6E Z;  3S14 I;  5IP9 I;  3CME Z;  4MRI A;  1ZB9 A;  3HOV I;  3D2L A;  3F3P C;  1TWH I;  1VQ9 Z;  3NFZ A;  1USP B;  2E2I I;  3NH5 A;  1WJ2 A;  3VB9 A;  3NDJ A;  3KIF A;  2PK7 A;  2V8K A;  3PO3 S;  2RHB A;  1Z03 A;  1YJN 1;  3GTM I;  4MD7 A;  4RS4 A;  1VQ5 1;  1X3W A;  1Q81 1;  1M1K 2;  3CCS Z;  1VQ8 1;  1VQ6 Z;  2JA6 I;  2VUM I;  1TWA I;  2F4O A;  1VQM 1;  3BG0 B;  2P3Y A;  4E32 A;  1K9M 1;  1KD1 1;  3CC4 Z;  4A3K I;  2V45 A;  4S1T A;  1N8R 2;  1PFT A;  1VQ4 1;  4NH1 C;  3CCJ 1; 
#chains in the Genus database with same CATH homology
 1VQO 1;  3S1M I;  2E2J I;  3CXC Y;  2EGT A;  1YI2 1;  4AYB A;  2JR6 A;  1N2F A;  3MZL B;  4NBC A;  2W03 A;  1YJW Z;  3J80 f;  2PM9 A;  4HH4 A;  4NB9 A;  4A3B I;  3HOW I;  3S1N I;  3GTK I;  3NH4 A;  4A3M I;  1VQ7 1;  2NVX I;  3CC7 Z;  2PMZ A;  4X6A I;  1Y1V S;  4A3L I;  3VTN A;  3CCR 1;  2QR1 B;  2QRC B;  4NBG A;  3CCV Z;  2QRD B;  1YHQ 1;  1K73 2;  3GTL I;  2JNY A;  2JA7 I;  2DE5 A;  3CPW Y;  1K83 I;  3HKZ A;  3I55 Z;  3VMG A;  2NVY I;  1VQP 1;  3G71 1;  3CCM 1;  3CMA 1;  1Q82 1;  1RO2 A;  1I50 I;  2V8I A;  3HOZ I;  1JWH C;  4A3G I;  3JAM b;  4NBD A;  4A3C I;  1QF8 A;  2JUB A;  3T4N B;  4E2Z A;  1Y1W I;  4MXU A;  1I6H I;  1JJ2 Z;  4Y52 I;  1QVG Y;  3KIH A;  3OW2 Y;  4DQY B;  3FQM A;  4E2W A;  4E33 A;  3GCF A;  3D6W A;  4MON A;  4QTT A;  1I3Q I;  4NOZ A;  4A3J I;  2BJO A;  2E2H I;  2O53 A;  5C4J I;  2DE7 A;  1NUI A;  3I56 Z;  1VLA A;  2RT9 A;  1W2B Y;  3CCE Z;  2K5R A;  1Z01 A;  1YJ9 1;  1VQL 1;  2QA4 1;  2JMO A;  4NBF A;  1Q7Y 2;  5A2Q b;  1S72 Z;  4E2X A;  3S15 I;  5IP7 I;  1RLY A;  1YIT 1;  3GKQ A;  4RVH A;  2V8J A;  3CD6 Z;  3D9X A;  2HF1 A;  1KC8 1;  1K8A 2;  1P9N A;  2RIQ A;  5D1O A;  1VQK Z;  2ZAE B;  3CCQ Z;  4DK1 A;  1M90 1;  3CCL Z;  3CCU 1;  2OTJ 1;  2H85 A;  1YUA A;  3PO2 I;  1RQF A;  5IT9 b;  2O4H A;  2QEX Z;  1X0T A;  3I55 1;  4A3F I;  2GU2 A;  1VQN 1;  4HGZ A;  1ML8 A;  2QKD A;  3F3F C;  2VF1 A;  4NBE A;  1K73 1;  4XX2 A;  3CC2 Z;  2YAD A;  1RNI A;  1Z02 A;  5FLX b;  4BXX I;  3GTQ I;  3RZD I;  3PO3 I;  4BY7 I;  1Q81 2;  4NBH A;  3GTO I;  4RVD A;  3RZO I;  3ESW A;  3FQQ A;  1NJI 1;  2E9H A;  2B63 I;  1K9M 2;  1QVG Z;  1KD1 2;  3J7A 4;  4A3E I;  1S7M A;  3G4S 1;  1SFO I;  3G6E 1;  1LQL A;  1VQ5 Z;  3CME 1;  2Y0S A;  5C3E I;  2QRE B;  1TFI A;  2KPI A;  4HGY A;  1VQM Z;  1VQ9 1;  2YU9 I;  3HOX I;  4NFR A;  4MH4 A;  4BBR I;  3IX0 A;  1ZH1 A;  4E31 A;  1X3Z A;  3S16 I;  1W2B Z;  4NBB A;  2W04 A;  4A3I I;  1VQ4 Z;  2OTL 1;  3H0G I;  2KI7 B;  3JAM f;  3CCS 1;  1VQ6 1;  3J81 b;  5D1O B;  1VQO Z;  5CM2 M;  2JA5 I;  3GTP I;  2HU9 A;  2JS4 A;  3FKI I;  4E2Y A;  3CC4 1;  1L1O C;  3EED A;  5C44 I;  1YI2 Z;  2WB1 A;  4QTU A;  2P28 A;  2Q4Z A;  3CCL 1;  2J6A A;  1M1K 1;  1RO4 A;  2GTI A;  3I07 A;  4RV9 A;  3VMH A;  2AKL A;  1YIJ Z;  3GTG I;  1Y1V I;  1TWC I;  1Q86 2;  3NDI A;  1VQ7 Z;  3S17 I;  1R9T I;  1K8A 1;  3M4O I;  3CXC Z;  1WW9 A;  2IZ3 A;  1N8R 1;  3I4N I;  3CCR Z;  3S1R I;  1Q82 2;  1YJW 1;  1YHQ Z;  2K3R A;  1QYP A;  5LL6 f;  5A2Q f;  5AN9 F;  4A3D I;  4NB8 A;  2WAQ A;  3TDH B;  2OOY B;  4A93 I;  1YUK A;  2OOX B;  1KQS Y;  1VQP Z;  3G71 Z;  3CC7 1;  1DL6 A;  5D1P A;  3VMI A;  3CCM Z;  3CMA Z;  1QVF Y;  1KRL A;  3HOU I;  3H3V J;  2Q51 A;  3CCV 1;  3MON A;  3CPW Z;  4RVF A;  5IT9 f;  2QLV B;  3U50 C;  3GTJ I;  2RPR A;  3Q87 A;  2JA8 I;  1JJ2 Y;  1TWF I;  2NVT I;  2M6N A;  2GTH A;  3MZK B;  3S2H I;  5FLX f;  3TE5 B;  3M3Y I;  2VUG A;  2LIY A;  5T67 A;  2I3C A;  3BG1 B;  2F4M A;  2IZ4 A;  5FLM I;  2R6M A;  3EER A;  1RO0 A;  1WCM I;  3OW2 Z;  1KC8 2;  1USP A;  1YJN Z;  1YJ9 Z;  1VQL Z;  3J80 b;  2QA4 Z;  2R92 I;  1M90 2;  4NBA A;  2RBL A;  4BY1 I;  1VQ8 Z;  3K7A I;  1YIJ 1;  4MD8 A;  4EWC A;  1YIT Z;  3S1Q I;  3CQZ I;  2G2K A;  4E30 A;  3I56 1;  4BBS I;  4Y7N I;  3CCU Z;  3CCE 1;  3NH8 A;  4RVG A;  2OTJ Z;  5T6B A;  2LFU A;  4MD9 A;  1Q86 1;  3CCJ Z;  2OTL Z;  1S72 1;  3J81 f;  3LUS A;  1KQS Z;  1VQN Z;  3GTM S;  4CL1 A;  3CD6 1;  5C4X I;  2OZK A;  1QVF Z;  1VQK 1;  5T64 A;  1NJI 2;  3S2D I;  3P5J B;  3CCQ 1;  3I4M I;  3IF8 A;  2NVQ I;  1Q7Y 1;  1NP6 A;  1TWG I;  4TNU A;  2R7Z I;  3IFU A;  2QEX 1;  1ZB8 A;  2DE6 A;  3HOY I;  3QWU A;  2M48 A;  2R93 I;  1WII A;  3G4S Z;  3CC2 1;  4DGL A;  3G6E Z;  3S14 I;  5IP9 I;  3CME Z;  4MRI A;  1ZB9 A;  3HOV I;  3F3P C;  1TWH I;  1VQ9 Z;  3NFZ A;  1USP B;  2E2I I;  3NH5 A;  3VB9 A;  3NDJ A;  3KIF A;  2PK7 A;  2V8K A;  3PO3 S;  2RHB A;  1Z03 A;  1YJN 1;  3GTM I;  4MD7 A;  4RS4 A;  1VQ5 1;  1X3W A;  1Q81 1;  1M1K 2;  3CCS Z;  1VQ8 1;  1VQ6 Z;  2JA6 I;  2VUM I;  1TWA I;  2F4O A;  1VQM 1;  3BG0 B;  2P3Y A;  4E32 A;  1K9M 1;  1KD1 1;  3CC4 Z;  4A3K I;  4S1T A;  1N8R 2;  1PFT A;  1VQ4 1;  4NH1 C;  3CCJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...