1TWCI

Rna polymerase ii complexed with gtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI02
4A3CI 3CQZI 4Y52I 5C4JI 1L1OC 2P3YA 1TWAI 3FKII 3S1NI 4Y7NI 3U50C 3S1RI 3HOYI 2NVXI 4BXXI 2J6AA 3HOVI 3PO3S 4NOZA 1VLAA 4BBSI 4A3EI 3GTMI 1SFOI 3HOZI 2F4MA 3S14I 1WW9A 3ESWA 2PK7A 3GTPI 3GTLI 4NB9A 4X6AI 3GTJI 3VMIA 2JA8I 3GTGI 3GTMS 2AKLA 2BJOA 3S16I 3S1QI 1TWHI 4XX2A 1WCMI 4NBDA 3PO3I 3S2DI 3GTKI 1I3QI 1RO4A 1TWGI 2DE7A 3M4OI 4NB8A 1ML8A 3VMGA 2JA7I 3I4NI 3GCFA 2NVTI 3H0GI 1TWFI 5IP9I 2HF1A 1YUAA 2E2HI 3GTQI 2DE5A 1RLYA 4A3DI 2K5RA 4A3KI 1USPA 1Y1VS 5FLMI 3HOWI 1I50I 4NBGA 1DL6A 2JA5I 2JS4A 3RZOI 2YU9I 5C44I 4QTTA 3RZDI 1N2FA 4A3MI 2DE6A 1LQLA 4BBRI 4A3BI 4NBAA 3S15I 2JA6I 3H3VJ 2NVQI 3S17I 1ZB9A 4MH4A 5IP7I 1PFTA 5C4XI 4A3JI 3PO2I 2RBLA 1Y1VI 3K7AI 1NUIA 2E2II 4A3II 4NBHA 3VB9A 2R92I 2VUMI 4NBBA 2R93I 2NVYI 1K83I 3HOUI 2JR6A 2E2JI 2F4OA 2JNYA 3GTOI 1X3ZA 3EERA 1TFIA 4NBFA 4A3GI 3S1MI 1I6HI 2KPIA 3VMHA 1R9TI 5C3EI 1TWCI 4NBEA 1ZB8A 3D6WA 4BY7I 4A3LI 3M3YI 2R7ZI 1QYPA 1USPB 4NBCA 3HOXI 4A93I 3I4MI 3I07A 3Q87A 4A3FI 1X3WA 3LUSA 4QTUA 2B63I 5CM2M 3GKQA 1Y1WI 4BY1I 3S2HI
chains in the Genus database with same CATH superfamily
4A3CI 2WAQA 1Q862 2VPYA 1VQ7Z 3HOYI 2NVXI 2Q51A 2Y0SA 1K8A2 3OW2Y 4A3EI 3GTMI 3CMA1 1WW9A 2OTJ1 1YIJZ 2ZAEB 2JIPA 3CCL1 3GTPI 3GTLI 4NB9A 1VQM1 3FQMA 3GTJI 3NFZA 3QWUA 4MONA 3S16I 3CC7Z 1VQPZ 1YJN1 1YHQZ 1Q7Y2 4XX2A 5A2Qb 2QA41 3CPWY 4MXUA 1Y8CA 3G71Z 2DE7A 4E2ZA 2JIRA 1K732 1ML8A 1VQK1 1S721 2NVTI 4MD8A 5IP9I 1VQL1 4MD9A 1K8A1 2GTIA 4MD7A 4CL1A 2VPXA 3G4SZ 4A3KI 3HOWI 1Y1VS 3KIHA 1JJ2Y 4RS4A 1Q7Y1 5C44I 2RT9A 1SIWA 2JMOA 4A3MI 4NBAA 2JA6I 2R6MA 5IP7I 1YI2Z 3FQQA 2RBLA 3PO2I 1Q812 5A2Qf 3I551 2QEX1 4MRIA 3VB9A 2VUMI 2H85A 1YITZ 2JUBA 3CC21 1K83I 2I3CA 2JR6A 2JNYA 3EERA 3CCQZ 1YJ9Z 3OW2Z 2KPIA 2IZ3A 3CCV1 3T4NB 4E2XA 1R9TI 3IFUA 3CD6Z 2RIQA 3CCUZ 4BY7I 4A3LI 1VQ8Z 3TDHB 2OZKA 1Q811 3J7A4 3I4MI 3I07A 3CPWZ 3Q87A 1VQ51 3LUSA 5CM2M 1Z03A 1VQ91 2V3VA 5C4JI 5IT9b 4E33A 2V8IA 4Y7NI 2VPZA 2QRDB 3PO3S 1KQSY 3HOZI 2F4MA 1P9NA 2OTL1 2VPWA 4S1TA 3CCS1 1JJ2Z 3VMIA 1YUKA 2BJOA 3G6EZ 3S1QI 1TWHI 1K9M1 2VUGA 3MZKB 4RV9A 3S2DI 1YJW1 2PM9A 1RO4A 1TWGI 3M4OI 3I561 2JA7I 3CCR1 3VTNA 2HF1A 2YADA 3BG1B 5IT9f 2DE5A 3J81f 3CXCY 2QLVB 3NDIA 4A3DI 1M901 3CCE1 2Q4ZA 2JA5I 2YU9I 4QTTA 1N2FA 1VQNZ 3CMEZ 4BBRI 4A3BI 4E2YA 1N8R2 3H3VJ 3S17I 3CCMZ 5C4XI 5LL6f 2E2II 4A3II 1RNIA 4NBBA 3CC4Z 4HGZA 2EGTA 2GTHA 2E2JI 3GTOI 1X3ZA 4NBFA 1TFIA 3JAMb 1W2BY 4E32A 1VQ61 1KQSZ 5C3EI 1TWCI 1N8R1 2M48A 3IR7A 2O53A 5T64A 5D1PA 1ZH1A 2GU2A 2JIOA 1VQO1 2R7ZI 4NBCA 4A93I 3BG0B 3CMAZ 3J80b 1X3WA 2OTJZ 4E31A 3CCJ1 3HKZA 3GKQA 1Y1WI 3CQZI 1VQMZ 3NH8A 2P3YA 1VQ41 3FKII 4HH4A 3S1NI 1Z02A 1YJNZ 3U50C 3S1RI 2E7ZA 3NH4A 4DGLA 4E30A 2QA4Z 3HOVI 4BXXI 1QF8A 2PMZA 4NOZA 1VLAA 2JIMA 1X0TA 3CXCZ 1SFOI 3JAMf 1VQKZ 3S14I 1NP6A 2LFUA 1S72Z 2G2KA 1VQLZ 1QVGY 3NH5A 2AKLA 1K9M2 3NDJA 1VQ71 1WCMI 2W04A 3J81b 3F3FC 3VMGA 3TE5B 3J80f 3GCFA 1YIJ1 3I4NI 4RVHA 1NJI1 3H0GI 1RO0A 1YUAA 2E2HI 1Z01A 2JIQA 3CC71 1VQP1 1YHQ1 2O4HA 1W2BZ 1M902 3I55Z 2QEXZ 2W03A 1I50I 3G711 4NBGA 3CC2Z 1QVFY 2QKDA 1LQLA 2NVQI 4MH4A 3G4S1 3CCVZ 1PFTA 4A3JI 2QREB 1RO2A 2LIYA 1Y1VI 3K7AI 1NUIA 2R93I 2R92I 2NVYI 1KC82 2F4OA 2V8KA 3MZLB 1VQ5Z 1M1K1 1YI21 2V45A 1Q822 1VQ9Z 2HU9A 2OOYB 1AA6A 5T67A 1YIT1 1QVGZ 3MONA 1KD11 3HOXI 3CCQ1 1YJ91 4A3FI 4DK1A 2OTLZ 3RZOI 5D1OA 1KC81 4BY1I 3CCSZ 4Y52I 3IF8A 1L1OC 3CD61 1TWAI 3CCU1 1Q861 3KIFA 4RVGA 2J6AA 1Q821 1VQ81 4HGYA 3D9XA 1YJWZ 4BBSI 1WZNA 1QXFA 3ESWA 3I56Z 2RHBA 3CCRZ 2PK7A 1FDIA 2VF1A 4AYBA 1QVFZ 4X6AI 2JA8I 3GTGI 2RPRA 3GTMS 4RVDA 2LEXA 2M6NA 3CCLZ 4NBDA 3PO3I 4E2WA 3CCEZ 3GTKI 1I3QI 4NB8A 1NJI2 1K731 1TWFI 2QR1B 1FDOA 3GTQI 3G6E1 1RQFA 5D1OB 1RLYA 2IZ4A 2P28A 2K5RA 2E9HA 1USPA 5FLMI 2NAPA 1JWHC 1WJ2A 1DL6A 2JS4A 4NH1C 3RZDI 1KRLA 2DE6A 3IX0A 5FLXb 2QRCB 1VQ6Z 3S15I 1ZB9A 3D2LA 1Q16A 2K3RA 4NFRA 3F3PC 4NBHA 4TNUA 2WB1A 1S7MA 3HOUI 1VQOZ 1VQN1 3CME1 2IV2X 4A3GI 1M1K2 5AN9F 3S1MI 1I6HI 3CCJZ 3CCM1 2OOXB 3VMHA 4DQYB 4NBEA 4RVFA 1ZB8A 3EEDA 1VQ4Z 3P5JB 1WIIA 4EWCA 3D6WA 3CC41 2AYDA 1KD12 1QYPA 1USPB 2V8JA 5T6BA 5FLXf 4QTUA 2B63I 3M3YI 2KI7B 3S2HI
chains in the Genus database with same CATH topology
4A3CI 2WAQA 1Q862 1VQ7Z 3HOYI 2NVXI 2Q51A 2Y0SA 1K8A2 3OW2Y 4A3EI 3GTMI 3CMA1 1WW9A 2OTJ1 1YIJZ 2ZAEB 3GTPI 3CCL1 3GTLI 4NB9A 1VQM1 3FQMA 3GTJI 3NFZA 3QWUA 4MONA 3S16I 3CC7Z 1VQPZ 1YJN1 1YHQZ 1Q7Y2 4XX2A 5A2Qb 2QA41 3CPWY 4MXUA 3G71Z 2DE7A 4E2ZA 1K732 1ML8A 1VQK1 1S721 2NVTI 4MD8A 5IP9I 1VQL1 4MD9A 1K8A1 2GTIA 4MD7A 4CL1A 3G4SZ 4A3KI 3HOWI 1Y1VS 3KIHA 1JJ2Y 4RS4A 1Q7Y1 5C44I 2RT9A 2JMOA 4A3MI 4NBAA 2JA6I 2R6MA 5IP7I 1YI2Z 3FQQA 2RBLA 3PO2I 1Q812 5A2Qf 3I551 2QEX1 4MRIA 3VB9A 2VUMI 2H85A 1YITZ 2JUBA 3CC21 1K83I 2I3CA 2JR6A 2JNYA 3EERA 3CCQZ 1YJ9Z 3OW2Z 2KPIA 2IZ3A 3CCV1 3T4NB 4E2XA 1R9TI 3IFUA 3CD6Z 2RIQA 3CCUZ 4BY7I 4A3LI 1VQ8Z 3TDHB 2OZKA 1Q811 3J7A4 3I4MI 3I07A 3CPWZ 3Q87A 1VQ51 3LUSA 5CM2M 1Z03A 1VQ91 5C4JI 5IT9b 4E33A 2V8IA 4Y7NI 2QRDB 3PO3S 1KQSY 3HOZI 2F4MA 1P9NA 2OTL1 4S1TA 3CCS1 1JJ2Z 3VMIA 1YUKA 2BJOA 3G6EZ 3S1QI 1TWHI 1K9M1 2VUGA 3MZKB 4RV9A 3S2DI 1YJW1 2PM9A 1RO4A 1TWGI 3M4OI 3I561 2JA7I 3CCR1 3VTNA 2HF1A 2YADA 3BG1B 5IT9f 2DE5A 3J81f 3CXCY 2QLVB 3NDIA 4A3DI 1M901 3CCE1 2Q4ZA 2JA5I 2YU9I 4QTTA 1N2FA 1VQNZ 3CMEZ 4BBRI 4A3BI 4E2YA 1N8R2 3H3VJ 3S17I 3CCMZ 5C4XI 5LL6f 2E2II 4A3II 1RNIA 4NBBA 3CC4Z 4HGZA 2EGTA 2GTHA 2E2JI 3GTOI 1X3ZA 4NBFA 1TFIA 3JAMb 1W2BY 4E32A 1VQ61 1KQSZ 5C3EI 1TWCI 1N8R1 2M48A 2O53A 5T64A 5D1PA 1ZH1A 2GU2A 1VQO1 2R7ZI 4NBCA 4A93I 3BG0B 3CMAZ 3J80b 1X3WA 2OTJZ 4E31A 3CCJ1 3HKZA 3GKQA 1Y1WI 3CQZI 1VQMZ 3NH8A 2P3YA 1VQ41 3FKII 4HH4A 3S1NI 1Z02A 1YJNZ 3U50C 3S1RI 3NH4A 4E30A 4DGLA 2QA4Z 4BXXI 3HOVI 1QF8A 2PMZA 4NOZA 1VLAA 1X0TA 3CXCZ 1SFOI 3JAMf 1VQKZ 3S14I 1NP6A 2LFUA 1S72Z 2G2KA 1VQLZ 1QVGY 3NH5A 2AKLA 1K9M2 3NDJA 1VQ71 1WCMI 2W04A 3J81b 3F3FC 3VMGA 3TE5B 3J80f 3GCFA 1YIJ1 3I4NI 4RVHA 1NJI1 3H0GI 1RO0A 1YUAA 2E2HI 1Z01A 3CC71 1VQP1 1YHQ1 2O4HA 1W2BZ 1M902 3I55Z 2QEXZ 2W03A 1I50I 3G711 4NBGA 3CC2Z 1QVFY 2QKDA 1LQLA 2NVQI 4MH4A 3G4S1 3CCVZ 1PFTA 4A3JI 2QREB 1RO2A 2LIYA 1Y1VI 3K7AI 1NUIA 2R93I 2R92I 2NVYI 1KC82 2F4OA 2V8KA 3MZLB 1VQ5Z 1M1K1 1YI21 1Q822 1VQ9Z 2HU9A 2OOYB 5T67A 1YIT1 1QVGZ 3MONA 1KD11 3HOXI 3CCQ1 1YJ91 4A3FI 4DK1A 2OTLZ 3RZOI 5D1OA 1KC81 4BY1I 3CCSZ 4Y52I 3IF8A 1L1OC 3CD61 1TWAI 3CCU1 1Q861 3KIFA 4RVGA 2J6AA 1Q821 1VQ81 4HGYA 3D9XA 1YJWZ 4BBSI 3ESWA 3I56Z 2RHBA 3CCRZ 2PK7A 2VF1A 4AYBA 1QVFZ 4X6AI 2JA8I 3GTGI 2RPRA 3GTMS 4RVDA 2M6NA 3CCLZ 4NBDA 3PO3I 4E2WA 3CCEZ 3GTKI 1I3QI 4NB8A 1NJI2 1K731 1TWFI 2QR1B 3GTQI 3G6E1 1RQFA 5D1OB 1RLYA 2IZ4A 2P28A 2K5RA 2E9HA 1USPA 5FLMI 1JWHC 1DL6A 2JS4A 4NH1C 3RZDI 1KRLA 2DE6A 3IX0A 5FLXb 2QRCB 1VQ6Z 3S15I 1ZB9A 2K3RA 4NFRA 3F3PC 4NBHA 4TNUA 2WB1A 1S7MA 3HOUI 1VQOZ 1VQN1 3CME1 4A3GI 1M1K2 5AN9F 3S1MI 1I6HI 3CCJZ 3CCM1 2OOXB 3VMHA 4DQYB 4NBEA 4RVFA 1ZB8A 3EEDA 1VQ4Z 3P5JB 1WIIA 4EWCA 3D6WA 3CC41 1KD12 1QYPA 1USPB 2V8JA 5T6BA 5FLXf 4QTUA 2B63I 3M3YI 2KI7B 3S2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C I;  3CQZ I;  4Y52 I;  5C4J I;  1L1O C;  2P3Y A;  1TWA I;  3FKI I;  3S1N I;  4Y7N I;  3U50 C;  3S1R I;  3HOY I;  2NVX I;  4BXX I;  2J6A A;  3HOV I;  3PO3 S;  4NOZ A;  1VLA A;  4BBS I;  4A3E I;  3GTM I;  1SFO I;  3HOZ I;  2F4M A;  3S14 I;  1WW9 A;  3ESW A;  2PK7 A;  3GTP I;  3GTL I;  4NB9 A;  4X6A I;  3GTJ I;  3VMI A;  2JA8 I;  3GTG I;  3GTM S;  2AKL A;  2BJO A;  3S16 I;  3S1Q I;  1TWH I;  4XX2 A;  1WCM I;  4NBD A;  3PO3 I;  3S2D I;  3GTK I;  1I3Q I;  1RO4 A;  1TWG I;  2DE7 A;  3M4O I;  4NB8 A;  1ML8 A;  3VMG A;  2JA7 I;  3I4N I;  3GCF A;  2NVT I;  3H0G I;  1TWF I;  5IP9 I;  2HF1 A;  1YUA A;  2E2H I;  3GTQ I;  2DE5 A;  1RLY A;  4A3D I;  2K5R A;  4A3K I;  1USP A;  1Y1V S;  5FLM I;  3HOW I;  1I50 I;  4NBG A;  1DL6 A;  2JA5 I;  2JS4 A;  3RZO I;  2YU9 I;  5C44 I;  4QTT A;  3RZD I;  1N2F A;  4A3M I;  2DE6 A;  1LQL A;  4BBR I;  4A3B I;  4NBA A;  3S15 I;  2JA6 I;  3H3V J;  2NVQ I;  3S17 I;  1ZB9 A;  4MH4 A;  5IP7 I;  1PFT A;  5C4X I;  4A3J I;  3PO2 I;  2RBL A;  1Y1V I;  3K7A I;  1NUI A;  2E2I I;  4A3I I;  4NBH A;  3VB9 A;  2R92 I;  2VUM I;  4NBB A;  2R93 I;  2NVY I;  1K83 I;  3HOU I;  2JR6 A;  2E2J I;  2F4O A;  2JNY A;  3GTO I;  1X3Z A;  3EER A;  1TFI A;  4NBF A;  4A3G I;  3S1M I;  1I6H I;  2KPI A;  3VMH A;  1R9T I;  5C3E I;  1TWC I;  4NBE A;  1ZB8 A;  3D6W A;  4BY7 I;  4A3L I;  3M3Y I;  2R7Z I;  1QYP A;  1USP B;  4NBC A;  3HOX I;  4A93 I;  3I4M I;  3I07 A;  3Q87 A;  4A3F I;  1X3W A;  3LUS A;  4QTU A;  2B63 I;  5CM2 M;  3GKQ A;  1Y1W I;  4BY1 I;  3S2H I; 
#chains in the Genus database with same CATH topology
 4A3C I;  2WAQ A;  1Q86 2;  2VPY A;  1VQ7 Z;  3HOY I;  2NVX I;  2Q51 A;  2Y0S A;  1K8A 2;  3OW2 Y;  4A3E I;  3GTM I;  3CMA 1;  1WW9 A;  2OTJ 1;  1YIJ Z;  2ZAE B;  2JIP A;  3CCL 1;  3GTP I;  3GTL I;  4NB9 A;  1VQM 1;  3FQM A;  3GTJ I;  3NFZ A;  3QWU A;  4MON A;  3S16 I;  3CC7 Z;  1VQP Z;  1YJN 1;  1YHQ Z;  1Q7Y 2;  4XX2 A;  5A2Q b;  2QA4 1;  3CPW Y;  4MXU A;  1Y8C A;  3G71 Z;  2DE7 A;  4E2Z A;  2JIR A;  1K73 2;  1ML8 A;  1VQK 1;  1S72 1;  2NVT I;  4MD8 A;  5IP9 I;  1VQL 1;  4MD9 A;  1K8A 1;  2GTI A;  4MD7 A;  4CL1 A;  2VPX A;  3G4S Z;  4A3K I;  3HOW I;  1Y1V S;  3KIH A;  1JJ2 Y;  4RS4 A;  1Q7Y 1;  5C44 I;  2RT9 A;  1SIW A;  2JMO A;  4A3M I;  4NBA A;  2JA6 I;  2R6M A;  5IP7 I;  1YI2 Z;  3FQQ A;  2RBL A;  3PO2 I;  1Q81 2;  5A2Q f;  3I55 1;  2QEX 1;  4MRI A;  3VB9 A;  2VUM I;  2H85 A;  1YIT Z;  2JUB A;  3CC2 1;  1K83 I;  2I3C A;  2JR6 A;  2JNY A;  3EER A;  3CCQ Z;  1YJ9 Z;  3OW2 Z;  2KPI A;  2IZ3 A;  3CCV 1;  3T4N B;  4E2X A;  1R9T I;  3IFU A;  3CD6 Z;  2RIQ A;  3CCU Z;  4BY7 I;  4A3L I;  1VQ8 Z;  3TDH B;  2OZK A;  1Q81 1;  3J7A 4;  3I4M I;  3I07 A;  3CPW Z;  3Q87 A;  1VQ5 1;  3LUS A;  5CM2 M;  1Z03 A;  1VQ9 1;  2V3V A;  5C4J I;  5IT9 b;  4E33 A;  2V8I A;  4Y7N I;  2VPZ A;  2QRD B;  3PO3 S;  1KQS Y;  3HOZ I;  2F4M A;  1P9N A;  2OTL 1;  2VPW A;  4S1T A;  3CCS 1;  1JJ2 Z;  3VMI A;  1YUK A;  2BJO A;  3G6E Z;  3S1Q I;  1TWH I;  1K9M 1;  2VUG A;  3MZK B;  4RV9 A;  3S2D I;  1YJW 1;  2PM9 A;  1RO4 A;  1TWG I;  3M4O I;  3I56 1;  2JA7 I;  3CCR 1;  3VTN A;  2HF1 A;  2YAD A;  3BG1 B;  5IT9 f;  2DE5 A;  3J81 f;  3CXC Y;  2QLV B;  3NDI A;  4A3D I;  1M90 1;  3CCE 1;  2Q4Z A;  2JA5 I;  2YU9 I;  4QTT A;  1N2F A;  1VQN Z;  3CME Z;  4BBR I;  4A3B I;  4E2Y A;  1N8R 2;  3H3V J;  3S17 I;  3CCM Z;  5C4X I;  5LL6 f;  2E2I I;  4A3I I;  1RNI A;  4NBB A;  3CC4 Z;  4HGZ A;  2EGT A;  2GTH A;  2E2J I;  3GTO I;  1X3Z A;  4NBF A;  1TFI A;  3JAM b;  1W2B Y;  4E32 A;  1VQ6 1;  1KQS Z;  5C3E I;  1TWC I;  1N8R 1;  2M48 A;  3IR7 A;  2O53 A;  5T64 A;  5D1P A;  1ZH1 A;  2GU2 A;  2JIO A;  1VQO 1;  2R7Z I;  4NBC A;  4A93 I;  3BG0 B;  3CMA Z;  3J80 b;  1X3W A;  2OTJ Z;  4E31 A;  3CCJ 1;  3HKZ A;  3GKQ A;  1Y1W I;  3CQZ I;  1VQM Z;  3NH8 A;  2P3Y A;  1VQ4 1;  3FKI I;  4HH4 A;  3S1N I;  1Z02 A;  1YJN Z;  3U50 C;  3S1R I;  2E7Z A;  3NH4 A;  4DGL A;  4E30 A;  2QA4 Z;  3HOV I;  4BXX I;  1QF8 A;  2PMZ A;  4NOZ A;  1VLA A;  2JIM A;  1X0T A;  3CXC Z;  1SFO I;  3JAM f;  1VQK Z;  3S14 I;  1NP6 A;  2LFU A;  1S72 Z;  2G2K A;  1VQL Z;  1QVG Y;  3NH5 A;  2AKL A;  1K9M 2;  3NDJ A;  1VQ7 1;  1WCM I;  2W04 A;  3J81 b;  3F3F C;  3VMG A;  3TE5 B;  3J80 f;  3GCF A;  1YIJ 1;  3I4N I;  4RVH A;  1NJI 1;  3H0G I;  1RO0 A;  1YUA A;  2E2H I;  1Z01 A;  2JIQ A;  3CC7 1;  1VQP 1;  1YHQ 1;  2O4H A;  1W2B Z;  1M90 2;  3I55 Z;  2QEX Z;  2W03 A;  1I50 I;  3G71 1;  4NBG A;  3CC2 Z;  1QVF Y;  2QKD A;  1LQL A;  2NVQ I;  4MH4 A;  3G4S 1;  3CCV Z;  1PFT A;  4A3J I;  2QRE B;  1RO2 A;  2LIY A;  1Y1V I;  3K7A I;  1NUI A;  2R93 I;  2R92 I;  2NVY I;  1KC8 2;  2F4O A;  2V8K A;  3MZL B;  1VQ5 Z;  1M1K 1;  1YI2 1;  2V45 A;  1Q82 2;  1VQ9 Z;  2HU9 A;  2OOY B;  1AA6 A;  5T67 A;  1YIT 1;  1QVG Z;  3MON A;  1KD1 1;  3HOX I;  3CCQ 1;  1YJ9 1;  4A3F I;  4DK1 A;  2OTL Z;  3RZO I;  5D1O A;  1KC8 1;  4BY1 I;  3CCS Z;  4Y52 I;  3IF8 A;  1L1O C;  3CD6 1;  1TWA I;  3CCU 1;  1Q86 1;  3KIF A;  4RVG A;  2J6A A;  1Q82 1;  1VQ8 1;  4HGY A;  3D9X A;  1YJW Z;  4BBS I;  1WZN A;  1QXF A;  3ESW A;  3I56 Z;  2RHB A;  3CCR Z;  2PK7 A;  1FDI A;  2VF1 A;  4AYB A;  1QVF Z;  4X6A I;  2JA8 I;  3GTG I;  2RPR A;  3GTM S;  4RVD A;  2LEX A;  2M6N A;  3CCL Z;  4NBD A;  3PO3 I;  4E2W A;  3CCE Z;  3GTK I;  1I3Q I;  4NB8 A;  1NJI 2;  1K73 1;  1TWF I;  2QR1 B;  1FDO A;  3GTQ I;  3G6E 1;  1RQF A;  5D1O B;  1RLY A;  2IZ4 A;  2P28 A;  2K5R A;  2E9H A;  1USP A;  5FLM I;  2NAP A;  1JWH C;  1WJ2 A;  1DL6 A;  2JS4 A;  4NH1 C;  3RZD I;  1KRL A;  2DE6 A;  3IX0 A;  5FLX b;  2QRC B;  1VQ6 Z;  3S15 I;  1ZB9 A;  3D2L A;  1Q16 A;  2K3R A;  4NFR A;  3F3P C;  4NBH A;  4TNU A;  2WB1 A;  1S7M A;  3HOU I;  1VQO Z;  1VQN 1;  3CME 1;  2IV2 X;  4A3G I;  1M1K 2;  5AN9 F;  3S1M I;  1I6H I;  3CCJ Z;  3CCM 1;  2OOX B;  3VMH A;  4DQY B;  4NBE A;  4RVF A;  1ZB8 A;  3EED A;  1VQ4 Z;  3P5J B;  1WII A;  4EWC A;  3D6W A;  3CC4 1;  2AYD A;  1KD1 2;  1QYP A;  1USP B;  2V8J A;  5T6B A;  5FLX f;  4QTU A;  2B63 I;  3M3Y I;  2KI7 B;  3S2H I; 
#chains in the Genus database with same CATH homology
 4A3C I;  2WAQ A;  1Q86 2;  1VQ7 Z;  3HOY I;  2NVX I;  2Q51 A;  2Y0S A;  1K8A 2;  3OW2 Y;  4A3E I;  3GTM I;  3CMA 1;  1WW9 A;  2OTJ 1;  1YIJ Z;  2ZAE B;  3GTP I;  3CCL 1;  3GTL I;  4NB9 A;  1VQM 1;  3FQM A;  3GTJ I;  3NFZ A;  3QWU A;  4MON A;  3S16 I;  3CC7 Z;  1VQP Z;  1YJN 1;  1YHQ Z;  1Q7Y 2;  4XX2 A;  5A2Q b;  2QA4 1;  3CPW Y;  4MXU A;  3G71 Z;  2DE7 A;  4E2Z A;  1K73 2;  1ML8 A;  1VQK 1;  1S72 1;  2NVT I;  4MD8 A;  5IP9 I;  1VQL 1;  4MD9 A;  1K8A 1;  2GTI A;  4MD7 A;  4CL1 A;  3G4S Z;  4A3K I;  3HOW I;  1Y1V S;  3KIH A;  1JJ2 Y;  4RS4 A;  1Q7Y 1;  5C44 I;  2RT9 A;  2JMO A;  4A3M I;  4NBA A;  2JA6 I;  2R6M A;  5IP7 I;  1YI2 Z;  3FQQ A;  2RBL A;  3PO2 I;  1Q81 2;  5A2Q f;  3I55 1;  2QEX 1;  4MRI A;  3VB9 A;  2VUM I;  2H85 A;  1YIT Z;  2JUB A;  3CC2 1;  1K83 I;  2I3C A;  2JR6 A;  2JNY A;  3EER A;  3CCQ Z;  1YJ9 Z;  3OW2 Z;  2KPI A;  2IZ3 A;  3CCV 1;  3T4N B;  4E2X A;  1R9T I;  3IFU A;  3CD6 Z;  2RIQ A;  3CCU Z;  4BY7 I;  4A3L I;  1VQ8 Z;  3TDH B;  2OZK A;  1Q81 1;  3J7A 4;  3I4M I;  3I07 A;  3CPW Z;  3Q87 A;  1VQ5 1;  3LUS A;  5CM2 M;  1Z03 A;  1VQ9 1;  5C4J I;  5IT9 b;  4E33 A;  2V8I A;  4Y7N I;  2QRD B;  3PO3 S;  1KQS Y;  3HOZ I;  2F4M A;  1P9N A;  2OTL 1;  4S1T A;  3CCS 1;  1JJ2 Z;  3VMI A;  1YUK A;  2BJO A;  3G6E Z;  3S1Q I;  1TWH I;  1K9M 1;  2VUG A;  3MZK B;  4RV9 A;  3S2D I;  1YJW 1;  2PM9 A;  1RO4 A;  1TWG I;  3M4O I;  3I56 1;  2JA7 I;  3CCR 1;  3VTN A;  2HF1 A;  2YAD A;  3BG1 B;  5IT9 f;  2DE5 A;  3J81 f;  3CXC Y;  2QLV B;  3NDI A;  4A3D I;  1M90 1;  3CCE 1;  2Q4Z A;  2JA5 I;  2YU9 I;  4QTT A;  1N2F A;  1VQN Z;  3CME Z;  4BBR I;  4A3B I;  4E2Y A;  1N8R 2;  3H3V J;  3S17 I;  3CCM Z;  5C4X I;  5LL6 f;  2E2I I;  4A3I I;  1RNI A;  4NBB A;  3CC4 Z;  4HGZ A;  2EGT A;  2GTH A;  2E2J I;  3GTO I;  1X3Z A;  4NBF A;  1TFI A;  3JAM b;  1W2B Y;  4E32 A;  1VQ6 1;  1KQS Z;  5C3E I;  1TWC I;  1N8R 1;  2M48 A;  2O53 A;  5T64 A;  5D1P A;  1ZH1 A;  2GU2 A;  1VQO 1;  2R7Z I;  4NBC A;  4A93 I;  3BG0 B;  3CMA Z;  3J80 b;  1X3W A;  2OTJ Z;  4E31 A;  3CCJ 1;  3HKZ A;  3GKQ A;  1Y1W I;  3CQZ I;  1VQM Z;  3NH8 A;  2P3Y A;  1VQ4 1;  3FKI I;  4HH4 A;  3S1N I;  1Z02 A;  1YJN Z;  3U50 C;  3S1R I;  3NH4 A;  4E30 A;  4DGL A;  2QA4 Z;  4BXX I;  3HOV I;  1QF8 A;  2PMZ A;  4NOZ A;  1VLA A;  1X0T A;  3CXC Z;  1SFO I;  3JAM f;  1VQK Z;  3S14 I;  1NP6 A;  2LFU A;  1S72 Z;  2G2K A;  1VQL Z;  1QVG Y;  3NH5 A;  2AKL A;  1K9M 2;  3NDJ A;  1VQ7 1;  1WCM I;  2W04 A;  3J81 b;  3F3F C;  3VMG A;  3TE5 B;  3J80 f;  3GCF A;  1YIJ 1;  3I4N I;  4RVH A;  1NJI 1;  3H0G I;  1RO0 A;  1YUA A;  2E2H I;  1Z01 A;  3CC7 1;  1VQP 1;  1YHQ 1;  2O4H A;  1W2B Z;  1M90 2;  3I55 Z;  2QEX Z;  2W03 A;  1I50 I;  3G71 1;  4NBG A;  3CC2 Z;  1QVF Y;  2QKD A;  1LQL A;  2NVQ I;  4MH4 A;  3G4S 1;  3CCV Z;  1PFT A;  4A3J I;  2QRE B;  1RO2 A;  2LIY A;  1Y1V I;  3K7A I;  1NUI A;  2R93 I;  2R92 I;  2NVY I;  1KC8 2;  2F4O A;  2V8K A;  3MZL B;  1VQ5 Z;  1M1K 1;  1YI2 1;  1Q82 2;  1VQ9 Z;  2HU9 A;  2OOY B;  5T67 A;  1YIT 1;  1QVG Z;  3MON A;  1KD1 1;  3HOX I;  3CCQ 1;  1YJ9 1;  4A3F I;  4DK1 A;  2OTL Z;  3RZO I;  5D1O A;  1KC8 1;  4BY1 I;  3CCS Z;  4Y52 I;  3IF8 A;  1L1O C;  3CD6 1;  1TWA I;  3CCU 1;  1Q86 1;  3KIF A;  4RVG A;  2J6A A;  1Q82 1;  1VQ8 1;  4HGY A;  3D9X A;  1YJW Z;  4BBS I;  3ESW A;  3I56 Z;  2RHB A;  3CCR Z;  2PK7 A;  2VF1 A;  4AYB A;  1QVF Z;  4X6A I;  2JA8 I;  3GTG I;  2RPR A;  3GTM S;  4RVD A;  2M6N A;  3CCL Z;  4NBD A;  3PO3 I;  4E2W A;  3CCE Z;  3GTK I;  1I3Q I;  4NB8 A;  1NJI 2;  1K73 1;  1TWF I;  2QR1 B;  3GTQ I;  3G6E 1;  1RQF A;  5D1O B;  1RLY A;  2IZ4 A;  2P28 A;  2K5R A;  2E9H A;  1USP A;  5FLM I;  1JWH C;  1DL6 A;  2JS4 A;  4NH1 C;  3RZD I;  1KRL A;  2DE6 A;  3IX0 A;  5FLX b;  2QRC B;  1VQ6 Z;  3S15 I;  1ZB9 A;  2K3R A;  4NFR A;  3F3P C;  4NBH A;  4TNU A;  2WB1 A;  1S7M A;  3HOU I;  1VQO Z;  1VQN 1;  3CME 1;  4A3G I;  1M1K 2;  5AN9 F;  3S1M I;  1I6H I;  3CCJ Z;  3CCM 1;  2OOX B;  3VMH A;  4DQY B;  4NBE A;  4RVF A;  1ZB8 A;  3EED A;  1VQ4 Z;  3P5J B;  1WII A;  4EWC A;  3D6W A;  3CC4 1;  1KD1 2;  1QYP A;  1USP B;  2V8J A;  5T6B A;  5FLX f;  4QTU A;  2B63 I;  3M3Y I;  2KI7 B;  3S2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...