1TWCI

Rna polymerase ii complexed with gtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twcI02
4BY7I 4A3II 4X6AI 3S1MI 1ZB8A 4NBAA 2E2II 2E2JI 1USPB 2J6AA 3ESWA 2KPIA 1Y1VS 5CM2M 1Y1VI 1LQLA 1DL6A 2JA6I 1NUIA 2YU9I 4NOZA 2NVXI 2AKLA 4NBCA 2DE6A 1QYPA 1TWCI 3H3VJ 4A3KI 4NBHA 3I4NI 2JS4A 1L1OC 3S14I 2DE5A 3VMGA 5C4XI 4NBGA 2F4MA 1Y1WI 4A3JI 4A3BI 2NVTI 3I07A 2NVQI 3PO3S 3S1QI 3S2HI 4BBRI 1ZB9A 1N2FA 1SFOI 4NBDA 3PO3I 3CQZI 2F4OA 2B63I 3GCFA 3EERA 4XX2A 1YUAA 1TFIA 3S15I 1TWFI 1VLAA 1TWGI 2JA7I 3S2DI 3GTKI 3GTLI 2R7ZI 3GTJI 2E2HI 3VMHA 2R93I 2VUMI 4MH4A 4NBBA 1PFTA 3HOWI 3PO2I 4BBSI 4QTUA 4Y52I 2NVYI 1TWHI 2R92I 3HOVI 5FLMI 3FKII 3GTPI 3VMIA 4A3DI 4A3EI 1WCMI 3S1RI 1I6HI 3GTMS 4NBFA 2RBLA 3LUSA 3GTMI 3M4OI 3S17I 1ML8A 4NB9A 3H0GI 3HOZI 5IP9I 3I4MI 3HOXI 3Q87A 1X3ZA 5IP7I 4A93I 4QTTA 1WW9A 3HOUI 3S16I 3VB9A 1TWAI 1USPA 3HOYI 2DE7A 2PK7A 5C4JI 3M3YI 2K5RA 3GTOI 4A3FI 2P3YA 4Y7NI 4BXXI 2HF1A 3K7AI 3GTGI 1RLYA 3RZDI 1X3WA 2JA8I 4A3CI 3GTQI 1I50I 2JR6A 4NBEA 1R9TI 2JNYA 5C3EI 3GKQA 4NB8A 1K83I 5C44I 2JA5I 1RO4A 3D6WA 4A3MI 1I3QI 3RZOI 3S1NI 4A3GI 2BJOA 4A3LI 3U50C 4BY1I
chains in the Genus database with same CATH superfamily
1VQN1 4X6AI 1Z02A 2QEX1 2VUGA 4NBAA 3FQQA 1WZNA 1USPB 1KQSY 3TE5B 2J6AA 4MRIA 1M1K2 3NH8A 3CCQZ 1RO2A 5CM2M 1LQLA 2JA6I 1VQ8Z 5AN9F 1FDIA 3CCQ1 2IV2X 1QYPA 1TWCI 2RIQA 1VQ81 3JAMf 1RQFA 3I4NI 4E2XA 3S14I 3JAMb 3VMGA 2Y0SA 2Q51A 1Y1WI 3D2LA 2V45A 1K8A2 1ZB9A 2IZ3A 1Q7Y1 2PMZA 3GCFA 3EEDA 5A2Qf 1VLAA 4MONA 3J81f 3GTLI 4NBBA 3PO2I 4BBSI 4Y52I 3HOVI 2W04A 5FLMI 1Q16A 3VMIA 3GTPI 1VQ9Z 2JIRA 1VQ4Z 1WCMI 1W2BZ 2K3RA 3HKZA 3CC71 1Q822 3NH4A 3S17I 1VQ41 4NB9A 1RNIA 3CC2Z 2JIMA 3T4NB 3BG0B 3QWUA 4A93I 1WW9A 3HOUI 1JJ2Z 3CC21 4DK1A 2G2KA 1YIJZ 3HOYI 4HH4A 2PK7A 4RS4A 2P3YA 4TNUA 1YIJ1 4E31A 1RLYA 2V8KA 1QVFY 2WAQA 2LEXA 2JR6A 4NBEA 4E33A 2JNYA 5C3EI 3NH5A 2O53A 3G71Z 2OTLZ 1K83I 1RO4A 3G711 2OTL1 1NP6A 3RZOI 3S1NI 4BY1I 4BY7I 4A3II 1YJNZ 1ZB8A 5D1OA 3I56Z 2E2II 2IZ4A 3D9XA 1YJN1 3ESWA 2KPIA 3I561 1Y1VS 1DL6A 4CL1A 1NUIA 1Q821 3IX0A 4E2WA 1S72Z 4A3KI 3VTNA 1L1OC 3J80f 3P5JB 1VQ6Z 4NBGA 3J80b 1QF8A 3CCJZ 2F4MA 4A3JI 2M48A 1S721 1WIIA 3PO3S 1VQ61 3CCJ1 2F4OA 2B63I 2HU9A 1YUAA 2V8IA 2JA7I 3GTKI 2QKDA 2R7ZI 3GTJI 3VMHA 4MD7A 3CPWZ 1K731 1SIWA 1PFTA 1VQ7Z 3HOWI 1W2BY 2QRCB 1TWHI 1Q811 3J7A4 4MD8A 5T6BA 4A3EI 1VQ71 1I6HI 5LL6f 2H85A 1VQOZ 3GTMS 2YADA 4S1TA 3OW2Z 1N8R2 1ML8A 1JJ2Y 3G6EZ 1VQO1 2EGTA 2M6NA 3HOXI 3Q87A 1X3ZA 5T64A 3F3FC 5IP7I 3G6E1 3KIFA 2W03A 3IFUA 3KIHA 2GTHA 1USPA 2E9HA 4RVDA 2DE7A 2GU2A 5C4JI 1M901 3M3YI 2JMOA 4A3FI 3K7AI 3NFZA 3CXCZ 3CD6Z 3RZDI 2QLVB 1X3WA 2QA4Z 4A3CI 1VQ91 4E2YA 3GTQI 3CCSZ 5T67A 3CCVZ 1AA6A 2QA41 2JA5I 3CMAZ 3CCS1 2RPRA 3D6WA 4A3MI 1I3QI 3CCV1 4A3GI 2LIYA 4A3LI 3U50C 1KRLA 1YJ9Z 3CMA1 2OZKA 3S1MI 1YJ91 2E2JI 1VQKZ 2R6MA 2VPXA 1K732 1VQ5Z 4DQYB 1YJWZ 1N8R1 1Q812 2JUBA 2NVXI 2DE6A 3H3VJ 1VQ51 4NH1C 1YJW1 4NBHA 2DE5A 5C4XI 2QR1B 2JIQA 2WB1A 4A3BI 2NVTI 2NVQI 3S1QI 3S2HI 1K9M2 1YI2Z 5D1PA 4NBDA 2I3CA 3CCEZ 2ZAEB 4DGLA 3CPWY 3S15I 1YI21 1TWFI 3CCE1 1TWGI 1M902 2VF1A 3S2DI 2E2HI 2VUMI 3MZKB 4MH4A 1Z01A 1ZH1A 4QTUA 4A3DI 1JWHC 5IT9b 3IF8A 3LUSA 3M4OI 2OOYB 1VQLZ 4RVFA 3H0GI 1S7MA 1QVGZ 3I4MI 3FQMA 1QXFA 1VQL1 3S16I 3CMEZ 2NAPA 5FLXf 3VB9A 5FLXb 2QRDB 2LFUA 3CXCY 3CME1 1FDOA 2VPWA 4MXUA 3GTOI 4BXXI 2JIPA 2HF1A 1KC82 2O4HA 2JA8I 1YHQZ 2RHBA 1VQMZ 3IR7A 4E32A 4HGZA 1R9TI 1Q862 4NB8A 2E7ZA 4E2ZA 5C44I 1YHQ1 1K9M1 1VQM1 3NDIA 3G4SZ 2Q4ZA 2AYDA 1YUKA 2OTJZ 3MONA 3G4S1 2GTIA 1YITZ 2OTJ1 3CCLZ 1Y1VI 1YIT1 5A2Qb 1KQSZ 3CD61 4EWCA 2PM9A 3J81b 3CCL1 2YU9I 4NOZA 2VPYA 2AKLA 4NBCA 1KD11 2JS4A 3CC7Z 2OOXB 4E30A 3I07A 1NJI1 4BBRI 3PO3I 1N2FA 1SFOI 1RO0A 3CQZI 4RVHA 3EERA 4XX2A 1KC81 1TFIA 5D1OB 1VQK1 3CCRZ 2V8JA 3CCMZ 4RV9A 2KI7B 1M1K1 2R93I 3TDHB 1Q861 2JIOA 3CCR1 3MZLB 2NVYI 3CCM1 2R92I 3FKII 1P9NA 3I55Z 3S1RI 4HGYA 1QVGY 3F3PC 4NBFA 2RBLA 3GTMI 3I551 3HOZI 5IP9I 1K8A1 1Y8CA 3CCUZ 4QTTA 4RVGA 2V3VA 3CC4Z 1X0TA 3NDJA 1TWAI 3CCU1 3BG1B 3CC41 1Q7Y2 2K5RA 1Z03A 4AYBA 4Y7NI 3OW2Y 2P28A 3GTGI 5IT9f 4NFRA 1I50I 2QREB 3GKQA 1VQPZ 1QVFZ 2RT9A 1KD12 1VQNZ 1WJ2A 2VPZA 4MD9A 2QEXZ 1VQP1 2BJOA 1NJI2
chains in the Genus database with same CATH topology
1VQN1 4X6AI 1Z02A 2QEX1 2VUGA 4NBAA 3FQQA 1USPB 1KQSY 3TE5B 2J6AA 4MRIA 1M1K2 3NH8A 3CCQZ 1RO2A 5CM2M 1LQLA 2JA6I 1VQ8Z 5AN9F 3CCQ1 1QYPA 1TWCI 2RIQA 1VQ81 3JAMf 1RQFA 3I4NI 4E2XA 3S14I 3JAMb 3VMGA 2Y0SA 2Q51A 1Y1WI 1K8A2 1ZB9A 2IZ3A 1Q7Y1 2PMZA 3GCFA 3EEDA 5A2Qf 1VLAA 4MONA 3J81f 3GTLI 4NBBA 3PO2I 4BBSI 4Y52I 3HOVI 2W04A 5FLMI 3GTPI 3VMIA 1VQ9Z 1VQ4Z 1WCMI 1W2BZ 2K3RA 3HKZA 3CC71 1Q822 3NH4A 3S17I 1VQ41 4NB9A 1RNIA 3CC2Z 3T4NB 3BG0B 3QWUA 4A93I 1WW9A 3HOUI 1JJ2Z 3CC21 4DK1A 2G2KA 1YIJZ 3HOYI 4HH4A 2PK7A 4RS4A 2P3YA 4TNUA 1YIJ1 4E31A 1RLYA 2V8KA 1QVFY 2WAQA 2JR6A 4NBEA 4E33A 2JNYA 5C3EI 3NH5A 2O53A 3G71Z 2OTLZ 1K83I 1RO4A 3G711 2OTL1 1NP6A 3RZOI 3S1NI 4BY1I 4BY7I 4A3II 1YJNZ 1ZB8A 5D1OA 3I56Z 2E2II 2IZ4A 3D9XA 1YJN1 3ESWA 2KPIA 3I561 1Y1VS 1DL6A 4CL1A 1NUIA 1Q821 3IX0A 4E2WA 1S72Z 4A3KI 3VTNA 1L1OC 3J80f 3P5JB 1VQ6Z 4NBGA 3J80b 1QF8A 3CCJZ 2F4MA 4A3JI 2M48A 1S721 1WIIA 3PO3S 1VQ61 3CCJ1 2F4OA 2B63I 2HU9A 1YUAA 2V8IA 2JA7I 3GTKI 2QKDA 2R7ZI 3GTJI 3VMHA 4MD7A 3CPWZ 1K731 1PFTA 1VQ7Z 3HOWI 1W2BY 2QRCB 1TWHI 1Q811 3J7A4 4MD8A 5T6BA 4A3EI 1VQ71 1I6HI 5LL6f 2H85A 1VQOZ 3GTMS 2YADA 4S1TA 3OW2Z 1N8R2 1ML8A 1JJ2Y 3G6EZ 1VQO1 2EGTA 2M6NA 3HOXI 3Q87A 1X3ZA 5T64A 3F3FC 5IP7I 3G6E1 3KIFA 2W03A 3IFUA 3KIHA 2E9HA 1USPA 2GTHA 4RVDA 2DE7A 2GU2A 5C4JI 1M901 3M3YI 2JMOA 4A3FI 3K7AI 3NFZA 3CXCZ 3CD6Z 3RZDI 2QLVB 1X3WA 2QA4Z 4A3CI 1VQ91 4E2YA 3GTQI 3CCSZ 5T67A 3CCVZ 2QA41 2JA5I 3CMAZ 3CCS1 2RPRA 3D6WA 4A3MI 1I3QI 3CCV1 4A3GI 2LIYA 4A3LI 3U50C 1KRLA 1YJ9Z 3CMA1 2OZKA 3S1MI 1YJ91 2E2JI 1VQKZ 2R6MA 1K732 1VQ5Z 4DQYB 1YJWZ 1N8R1 1Q812 2JUBA 2NVXI 2DE6A 3H3VJ 1VQ51 4NH1C 1YJW1 4NBHA 2DE5A 5C4XI 2QR1B 2WB1A 4A3BI 2NVTI 2NVQI 3S1QI 3S2HI 1K9M2 1YI2Z 5D1PA 4NBDA 2I3CA 3CCEZ 2ZAEB 4DGLA 3CPWY 3S15I 1YI21 1TWFI 3CCE1 1TWGI 1M902 2VF1A 3S2DI 2E2HI 2VUMI 3MZKB 4MH4A 1Z01A 1ZH1A 4QTUA 4A3DI 1JWHC 5IT9b 3IF8A 3LUSA 3M4OI 2OOYB 1VQLZ 4RVFA 3H0GI 1S7MA 1QVGZ 3I4MI 3FQMA 1VQL1 3S16I 3CMEZ 5FLXf 3VB9A 5FLXb 2QRDB 2LFUA 3CXCY 3CME1 4MXUA 3GTOI 4BXXI 2HF1A 1KC82 2O4HA 2JA8I 1YHQZ 2RHBA 1VQMZ 4E32A 4HGZA 1R9TI 1Q862 4NB8A 4E2ZA 5C44I 1YHQ1 1K9M1 1VQM1 3NDIA 3G4SZ 2Q4ZA 1YUKA 2OTJZ 3MONA 3G4S1 2GTIA 1YITZ 2OTJ1 3CCLZ 1Y1VI 1YIT1 5A2Qb 1KQSZ 3CD61 4EWCA 2PM9A 3J81b 3CCL1 2YU9I 4NOZA 2AKLA 4NBCA 1KD11 2JS4A 3CC7Z 2OOXB 4E30A 3I07A 1NJI1 4BBRI 3PO3I 1N2FA 1SFOI 1RO0A 3CQZI 4RVHA 3EERA 4XX2A 1KC81 1TFIA 5D1OB 1VQK1 3CCRZ 2V8JA 3CCMZ 4RV9A 2KI7B 1M1K1 2R93I 3TDHB 1Q861 3CCR1 3MZLB 2NVYI 3CCM1 2R92I 3FKII 1P9NA 3I55Z 3S1RI 4HGYA 1QVGY 3F3PC 4NBFA 2RBLA 3GTMI 3I551 3HOZI 5IP9I 1K8A1 3CCUZ 4QTTA 4RVGA 3CC4Z 1X0TA 3NDJA 1TWAI 3CCU1 3BG1B 3CC41 1Q7Y2 2K5RA 1Z03A 4AYBA 4Y7NI 3OW2Y 2P28A 3GTGI 5IT9f 4NFRA 1I50I 2QREB 3GKQA 1VQPZ 1QVFZ 2RT9A 1KD12 1VQNZ 4MD9A 2QEXZ 1VQP1 2BJOA 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 I;  4A3I I;  4X6A I;  3S1M I;  1ZB8 A;  4NBA A;  2E2I I;  2E2J I;  1USP B;  2J6A A;  3ESW A;  2KPI A;  1Y1V S;  5CM2 M;  1Y1V I;  1LQL A;  1DL6 A;  2JA6 I;  1NUI A;  2YU9 I;  4NOZ A;  2NVX I;  2AKL A;  4NBC A;  2DE6 A;  1QYP A;  1TWC I;  3H3V J;  4A3K I;  4NBH A;  3I4N I;  2JS4 A;  1L1O C;  3S14 I;  2DE5 A;  3VMG A;  5C4X I;  4NBG A;  2F4M A;  1Y1W I;  4A3J I;  4A3B I;  2NVT I;  3I07 A;  2NVQ I;  3PO3 S;  3S1Q I;  3S2H I;  4BBR I;  1ZB9 A;  1N2F A;  1SFO I;  4NBD A;  3PO3 I;  3CQZ I;  2F4O A;  2B63 I;  3GCF A;  3EER A;  4XX2 A;  1YUA A;  1TFI A;  3S15 I;  1TWF I;  1VLA A;  1TWG I;  2JA7 I;  3S2D I;  3GTK I;  3GTL I;  2R7Z I;  3GTJ I;  2E2H I;  3VMH A;  2R93 I;  2VUM I;  4MH4 A;  4NBB A;  1PFT A;  3HOW I;  3PO2 I;  4BBS I;  4QTU A;  4Y52 I;  2NVY I;  1TWH I;  2R92 I;  3HOV I;  5FLM I;  3FKI I;  3GTP I;  3VMI A;  4A3D I;  4A3E I;  1WCM I;  3S1R I;  1I6H I;  3GTM S;  4NBF A;  2RBL A;  3LUS A;  3GTM I;  3M4O I;  3S17 I;  1ML8 A;  4NB9 A;  3H0G I;  3HOZ I;  5IP9 I;  3I4M I;  3HOX I;  3Q87 A;  1X3Z A;  5IP7 I;  4A93 I;  4QTT A;  1WW9 A;  3HOU I;  3S16 I;  3VB9 A;  1TWA I;  1USP A;  3HOY I;  2DE7 A;  2PK7 A;  5C4J I;  3M3Y I;  2K5R A;  3GTO I;  4A3F I;  2P3Y A;  4Y7N I;  4BXX I;  2HF1 A;  3K7A I;  3GTG I;  1RLY A;  3RZD I;  1X3W A;  2JA8 I;  4A3C I;  3GTQ I;  1I50 I;  2JR6 A;  4NBE A;  1R9T I;  2JNY A;  5C3E I;  3GKQ A;  4NB8 A;  1K83 I;  5C44 I;  2JA5 I;  1RO4 A;  3D6W A;  4A3M I;  1I3Q I;  3RZO I;  3S1N I;  4A3G I;  2BJO A;  4A3L I;  3U50 C;  4BY1 I; 
#chains in the Genus database with same CATH topology
 1VQN 1;  4X6A I;  1Z02 A;  2QEX 1;  2VUG A;  4NBA A;  3FQQ A;  1WZN A;  1USP B;  1KQS Y;  3TE5 B;  2J6A A;  4MRI A;  1M1K 2;  3NH8 A;  3CCQ Z;  1RO2 A;  5CM2 M;  1LQL A;  2JA6 I;  1VQ8 Z;  5AN9 F;  1FDI A;  3CCQ 1;  2IV2 X;  1QYP A;  1TWC I;  2RIQ A;  1VQ8 1;  3JAM f;  1RQF A;  3I4N I;  4E2X A;  3S14 I;  3JAM b;  3VMG A;  2Y0S A;  2Q51 A;  1Y1W I;  3D2L A;  2V45 A;  1K8A 2;  1ZB9 A;  2IZ3 A;  1Q7Y 1;  2PMZ A;  3GCF A;  3EED A;  5A2Q f;  1VLA A;  4MON A;  3J81 f;  3GTL I;  4NBB A;  3PO2 I;  4BBS I;  4Y52 I;  3HOV I;  2W04 A;  5FLM I;  1Q16 A;  3VMI A;  3GTP I;  1VQ9 Z;  2JIR A;  1VQ4 Z;  1WCM I;  1W2B Z;  2K3R A;  3HKZ A;  3CC7 1;  1Q82 2;  3NH4 A;  3S17 I;  1VQ4 1;  4NB9 A;  1RNI A;  3CC2 Z;  2JIM A;  3T4N B;  3BG0 B;  3QWU A;  4A93 I;  1WW9 A;  3HOU I;  1JJ2 Z;  3CC2 1;  4DK1 A;  2G2K A;  1YIJ Z;  3HOY I;  4HH4 A;  2PK7 A;  4RS4 A;  2P3Y A;  4TNU A;  1YIJ 1;  4E31 A;  1RLY A;  2V8K A;  1QVF Y;  2WAQ A;  2LEX A;  2JR6 A;  4NBE A;  4E33 A;  2JNY A;  5C3E I;  3NH5 A;  2O53 A;  3G71 Z;  2OTL Z;  1K83 I;  1RO4 A;  3G71 1;  2OTL 1;  1NP6 A;  3RZO I;  3S1N I;  4BY1 I;  4BY7 I;  4A3I I;  1YJN Z;  1ZB8 A;  5D1O A;  3I56 Z;  2E2I I;  2IZ4 A;  3D9X A;  1YJN 1;  3ESW A;  2KPI A;  3I56 1;  1Y1V S;  1DL6 A;  4CL1 A;  1NUI A;  1Q82 1;  3IX0 A;  4E2W A;  1S72 Z;  4A3K I;  3VTN A;  1L1O C;  3J80 f;  3P5J B;  1VQ6 Z;  4NBG A;  3J80 b;  1QF8 A;  3CCJ Z;  2F4M A;  4A3J I;  2M48 A;  1S72 1;  1WII A;  3PO3 S;  1VQ6 1;  3CCJ 1;  2F4O A;  2B63 I;  2HU9 A;  1YUA A;  2V8I A;  2JA7 I;  3GTK I;  2QKD A;  2R7Z I;  3GTJ I;  3VMH A;  4MD7 A;  3CPW Z;  1K73 1;  1SIW A;  1PFT A;  1VQ7 Z;  3HOW I;  1W2B Y;  2QRC B;  1TWH I;  1Q81 1;  3J7A 4;  4MD8 A;  5T6B A;  4A3E I;  1VQ7 1;  1I6H I;  5LL6 f;  2H85 A;  1VQO Z;  3GTM S;  2YAD A;  4S1T A;  3OW2 Z;  1N8R 2;  1ML8 A;  1JJ2 Y;  3G6E Z;  1VQO 1;  2EGT A;  2M6N A;  3HOX I;  3Q87 A;  1X3Z A;  5T64 A;  3F3F C;  5IP7 I;  3G6E 1;  3KIF A;  2W03 A;  3IFU A;  3KIH A;  2GTH A;  1USP A;  2E9H A;  4RVD A;  2DE7 A;  2GU2 A;  5C4J I;  1M90 1;  3M3Y I;  2JMO A;  4A3F I;  3K7A I;  3NFZ A;  3CXC Z;  3CD6 Z;  3RZD I;  2QLV B;  1X3W A;  2QA4 Z;  4A3C I;  1VQ9 1;  4E2Y A;  3GTQ I;  3CCS Z;  5T67 A;  3CCV Z;  1AA6 A;  2QA4 1;  2JA5 I;  3CMA Z;  3CCS 1;  2RPR A;  3D6W A;  4A3M I;  1I3Q I;  3CCV 1;  4A3G I;  2LIY A;  4A3L I;  3U50 C;  1KRL A;  1YJ9 Z;  3CMA 1;  2OZK A;  3S1M I;  1YJ9 1;  2E2J I;  1VQK Z;  2R6M A;  2VPX A;  1K73 2;  1VQ5 Z;  4DQY B;  1YJW Z;  1N8R 1;  1Q81 2;  2JUB A;  2NVX I;  2DE6 A;  3H3V J;  1VQ5 1;  4NH1 C;  1YJW 1;  4NBH A;  2DE5 A;  5C4X I;  2QR1 B;  2JIQ A;  2WB1 A;  4A3B I;  2NVT I;  2NVQ I;  3S1Q I;  3S2H I;  1K9M 2;  1YI2 Z;  5D1P A;  4NBD A;  2I3C A;  3CCE Z;  2ZAE B;  4DGL A;  3CPW Y;  3S15 I;  1YI2 1;  1TWF I;  3CCE 1;  1TWG I;  1M90 2;  2VF1 A;  3S2D I;  2E2H I;  2VUM I;  3MZK B;  4MH4 A;  1Z01 A;  1ZH1 A;  4QTU A;  4A3D I;  1JWH C;  5IT9 b;  3IF8 A;  3LUS A;  3M4O I;  2OOY B;  1VQL Z;  4RVF A;  3H0G I;  1S7M A;  1QVG Z;  3I4M I;  3FQM A;  1QXF A;  1VQL 1;  3S16 I;  3CME Z;  2NAP A;  5FLX f;  3VB9 A;  5FLX b;  2QRD B;  2LFU A;  3CXC Y;  3CME 1;  1FDO A;  2VPW A;  4MXU A;  3GTO I;  4BXX I;  2JIP A;  2HF1 A;  1KC8 2;  2O4H A;  2JA8 I;  1YHQ Z;  2RHB A;  1VQM Z;  3IR7 A;  4E32 A;  4HGZ A;  1R9T I;  1Q86 2;  4NB8 A;  2E7Z A;  4E2Z A;  5C44 I;  1YHQ 1;  1K9M 1;  1VQM 1;  3NDI A;  3G4S Z;  2Q4Z A;  2AYD A;  1YUK A;  2OTJ Z;  3MON A;  3G4S 1;  2GTI A;  1YIT Z;  2OTJ 1;  3CCL Z;  1Y1V I;  1YIT 1;  5A2Q b;  1KQS Z;  3CD6 1;  4EWC A;  2PM9 A;  3J81 b;  3CCL 1;  2YU9 I;  4NOZ A;  2VPY A;  2AKL A;  4NBC A;  1KD1 1;  2JS4 A;  3CC7 Z;  2OOX B;  4E30 A;  3I07 A;  1NJI 1;  4BBR I;  3PO3 I;  1N2F A;  1SFO I;  1RO0 A;  3CQZ I;  4RVH A;  3EER A;  4XX2 A;  1KC8 1;  1TFI A;  5D1O B;  1VQK 1;  3CCR Z;  2V8J A;  3CCM Z;  4RV9 A;  2KI7 B;  1M1K 1;  2R93 I;  3TDH B;  1Q86 1;  2JIO A;  3CCR 1;  3MZL B;  2NVY I;  3CCM 1;  2R92 I;  3FKI I;  1P9N A;  3I55 Z;  3S1R I;  4HGY A;  1QVG Y;  3F3P C;  4NBF A;  2RBL A;  3GTM I;  3I55 1;  3HOZ I;  5IP9 I;  1K8A 1;  1Y8C A;  3CCU Z;  4QTT A;  4RVG A;  2V3V A;  3CC4 Z;  1X0T A;  3NDJ A;  1TWA I;  3CCU 1;  3BG1 B;  3CC4 1;  1Q7Y 2;  2K5R A;  1Z03 A;  4AYB A;  4Y7N I;  3OW2 Y;  2P28 A;  3GTG I;  5IT9 f;  4NFR A;  1I50 I;  2QRE B;  3GKQ A;  1VQP Z;  1QVF Z;  2RT9 A;  1KD1 2;  1VQN Z;  1WJ2 A;  2VPZ A;  4MD9 A;  2QEX Z;  1VQP 1;  2BJO A;  1NJI 2; 
#chains in the Genus database with same CATH homology
 1VQN 1;  4X6A I;  1Z02 A;  2QEX 1;  2VUG A;  4NBA A;  3FQQ A;  1USP B;  1KQS Y;  3TE5 B;  2J6A A;  4MRI A;  1M1K 2;  3NH8 A;  3CCQ Z;  1RO2 A;  5CM2 M;  1LQL A;  2JA6 I;  1VQ8 Z;  5AN9 F;  3CCQ 1;  1QYP A;  1TWC I;  2RIQ A;  1VQ8 1;  3JAM f;  1RQF A;  3I4N I;  4E2X A;  3S14 I;  3JAM b;  3VMG A;  2Y0S A;  2Q51 A;  1Y1W I;  1K8A 2;  1ZB9 A;  2IZ3 A;  1Q7Y 1;  2PMZ A;  3GCF A;  3EED A;  5A2Q f;  1VLA A;  4MON A;  3J81 f;  3GTL I;  4NBB A;  3PO2 I;  4BBS I;  4Y52 I;  3HOV I;  2W04 A;  5FLM I;  3GTP I;  3VMI A;  1VQ9 Z;  1VQ4 Z;  1WCM I;  1W2B Z;  2K3R A;  3HKZ A;  3CC7 1;  1Q82 2;  3NH4 A;  3S17 I;  1VQ4 1;  4NB9 A;  1RNI A;  3CC2 Z;  3T4N B;  3BG0 B;  3QWU A;  4A93 I;  1WW9 A;  3HOU I;  1JJ2 Z;  3CC2 1;  4DK1 A;  2G2K A;  1YIJ Z;  3HOY I;  4HH4 A;  2PK7 A;  4RS4 A;  2P3Y A;  4TNU A;  1YIJ 1;  4E31 A;  1RLY A;  2V8K A;  1QVF Y;  2WAQ A;  2JR6 A;  4NBE A;  4E33 A;  2JNY A;  5C3E I;  3NH5 A;  2O53 A;  3G71 Z;  2OTL Z;  1K83 I;  1RO4 A;  3G71 1;  2OTL 1;  1NP6 A;  3RZO I;  3S1N I;  4BY1 I;  4BY7 I;  4A3I I;  1YJN Z;  1ZB8 A;  5D1O A;  3I56 Z;  2E2I I;  2IZ4 A;  3D9X A;  1YJN 1;  3ESW A;  2KPI A;  3I56 1;  1Y1V S;  1DL6 A;  4CL1 A;  1NUI A;  1Q82 1;  3IX0 A;  4E2W A;  1S72 Z;  4A3K I;  3VTN A;  1L1O C;  3J80 f;  3P5J B;  1VQ6 Z;  4NBG A;  3J80 b;  1QF8 A;  3CCJ Z;  2F4M A;  4A3J I;  2M48 A;  1S72 1;  1WII A;  3PO3 S;  1VQ6 1;  3CCJ 1;  2F4O A;  2B63 I;  2HU9 A;  1YUA A;  2V8I A;  2JA7 I;  3GTK I;  2QKD A;  2R7Z I;  3GTJ I;  3VMH A;  4MD7 A;  3CPW Z;  1K73 1;  1PFT A;  1VQ7 Z;  3HOW I;  1W2B Y;  2QRC B;  1TWH I;  1Q81 1;  3J7A 4;  4MD8 A;  5T6B A;  4A3E I;  1VQ7 1;  1I6H I;  5LL6 f;  2H85 A;  1VQO Z;  3GTM S;  2YAD A;  4S1T A;  3OW2 Z;  1N8R 2;  1ML8 A;  1JJ2 Y;  3G6E Z;  1VQO 1;  2EGT A;  2M6N A;  3HOX I;  3Q87 A;  1X3Z A;  5T64 A;  3F3F C;  5IP7 I;  3G6E 1;  3KIF A;  2W03 A;  3IFU A;  3KIH A;  2E9H A;  1USP A;  2GTH A;  4RVD A;  2DE7 A;  2GU2 A;  5C4J I;  1M90 1;  3M3Y I;  2JMO A;  4A3F I;  3K7A I;  3NFZ A;  3CXC Z;  3CD6 Z;  3RZD I;  2QLV B;  1X3W A;  2QA4 Z;  4A3C I;  1VQ9 1;  4E2Y A;  3GTQ I;  3CCS Z;  5T67 A;  3CCV Z;  2QA4 1;  2JA5 I;  3CMA Z;  3CCS 1;  2RPR A;  3D6W A;  4A3M I;  1I3Q I;  3CCV 1;  4A3G I;  2LIY A;  4A3L I;  3U50 C;  1KRL A;  1YJ9 Z;  3CMA 1;  2OZK A;  3S1M I;  1YJ9 1;  2E2J I;  1VQK Z;  2R6M A;  1K73 2;  1VQ5 Z;  4DQY B;  1YJW Z;  1N8R 1;  1Q81 2;  2JUB A;  2NVX I;  2DE6 A;  3H3V J;  1VQ5 1;  4NH1 C;  1YJW 1;  4NBH A;  2DE5 A;  5C4X I;  2QR1 B;  2WB1 A;  4A3B I;  2NVT I;  2NVQ I;  3S1Q I;  3S2H I;  1K9M 2;  1YI2 Z;  5D1P A;  4NBD A;  2I3C A;  3CCE Z;  2ZAE B;  4DGL A;  3CPW Y;  3S15 I;  1YI2 1;  1TWF I;  3CCE 1;  1TWG I;  1M90 2;  2VF1 A;  3S2D I;  2E2H I;  2VUM I;  3MZK B;  4MH4 A;  1Z01 A;  1ZH1 A;  4QTU A;  4A3D I;  1JWH C;  5IT9 b;  3IF8 A;  3LUS A;  3M4O I;  2OOY B;  1VQL Z;  4RVF A;  3H0G I;  1S7M A;  1QVG Z;  3I4M I;  3FQM A;  1VQL 1;  3S16 I;  3CME Z;  5FLX f;  3VB9 A;  5FLX b;  2QRD B;  2LFU A;  3CXC Y;  3CME 1;  4MXU A;  3GTO I;  4BXX I;  2HF1 A;  1KC8 2;  2O4H A;  2JA8 I;  1YHQ Z;  2RHB A;  1VQM Z;  4E32 A;  4HGZ A;  1R9T I;  1Q86 2;  4NB8 A;  4E2Z A;  5C44 I;  1YHQ 1;  1K9M 1;  1VQM 1;  3NDI A;  3G4S Z;  2Q4Z A;  1YUK A;  2OTJ Z;  3MON A;  3G4S 1;  2GTI A;  1YIT Z;  2OTJ 1;  3CCL Z;  1Y1V I;  1YIT 1;  5A2Q b;  1KQS Z;  3CD6 1;  4EWC A;  2PM9 A;  3J81 b;  3CCL 1;  2YU9 I;  4NOZ A;  2AKL A;  4NBC A;  1KD1 1;  2JS4 A;  3CC7 Z;  2OOX B;  4E30 A;  3I07 A;  1NJI 1;  4BBR I;  3PO3 I;  1N2F A;  1SFO I;  1RO0 A;  3CQZ I;  4RVH A;  3EER A;  4XX2 A;  1KC8 1;  1TFI A;  5D1O B;  1VQK 1;  3CCR Z;  2V8J A;  3CCM Z;  4RV9 A;  2KI7 B;  1M1K 1;  2R93 I;  3TDH B;  1Q86 1;  3CCR 1;  3MZL B;  2NVY I;  3CCM 1;  2R92 I;  3FKI I;  1P9N A;  3I55 Z;  3S1R I;  4HGY A;  1QVG Y;  3F3P C;  4NBF A;  2RBL A;  3GTM I;  3I55 1;  3HOZ I;  5IP9 I;  1K8A 1;  3CCU Z;  4QTT A;  4RVG A;  3CC4 Z;  1X0T A;  3NDJ A;  1TWA I;  3CCU 1;  3BG1 B;  3CC4 1;  1Q7Y 2;  2K5R A;  1Z03 A;  4AYB A;  4Y7N I;  3OW2 Y;  2P28 A;  3GTG I;  5IT9 f;  4NFR A;  1I50 I;  2QRE B;  3GKQ A;  1VQP Z;  1QVF Z;  2RT9 A;  1KD1 2;  1VQN Z;  4MD9 A;  2QEX Z;  1VQP 1;  2BJO A;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...