1VQ61

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq6100
1VQKZ 3CCM1 3CCV1 1YIJ1 3CC7Z 1VQ61 1S72Z 1YI21 3CCU1 3CCVZ 1Q811 3G6EZ 1YITZ 3CCS1 1YHQ1 1Q812 1VQ51 1QVGY 3G6E1 1NJI1 3CC71 1YIT1 1VQ6Z 1VQ81 1VQ5Z 1VQOZ 1K731 1W2BY 3CCUZ 1NJI2 3CC2Z 3CCJZ 1N8R2 3CXCY 1YJNZ 1YJWZ 1VQPZ 3I561 2QA4Z 3OW2Z 1M902 1VQ8Z 1VQO1 3CPWY 3CXCZ 1VQLZ 3CC21 3CCJ1 2QA41 1YJN1 1M1K1 1YJ91 3OW2Y 1VQP1 1YJW1 1Q861 1VQ71 1VQL1 3CMAZ 1K732 3I56Z 1JJ2Z 1K8A1 2OTL1 1N8R1 3CCL1 2QEX1 1VQ7Z 1Q821 3CCE1 3CCQZ 1K8A2 1VQ9Z 3CMA1 1Q822 1Q7Y2 1QVFZ 3CCLZ 3G711 1YJ9Z 3CCQ1 1VQM1 1M1K2 3CD6Z 1KC81 1Q7Y1 1M901 1Q862 3G71Z 1QVGZ 2OTLZ 1VQN1 2QEXZ 1VQMZ 3CCEZ 3I55Z 3CMEZ 2OTJ1 1VQ91 1VQ41 3CCR1 3G4S1 1K9M1 1KQSY 3CC4Z 1KQSZ 3CD61 2OTJZ 3CCMZ 1QVFY 3CCRZ 1W2BZ 1S721 3CPWZ 1VQNZ 1KD11 1JJ2Y 3I551 3CME1 1VQK1 1VQ4Z 3G4SZ 1YIJZ 1KC82 1KD12 1K9M2 3CCSZ 1YHQZ 3CC41 1YI2Z
chains in the Genus database with same CATH superfamily
1WW9A 4A93I 1YIJ1 2VF1A 2V8JA 1YI21 3EEDA 2E9HA 4E31A 2RT9A 1YITZ 3CCS1 4E2XA 5T6BA 3I4MI 5IP7I 3S2HI 3G6E1 2NAPA 4MD7A 3T4NB 3NH4A 4NOZA 2DE7A 1NJI2 1LQLA 2I3CA 2RPRA 3GTOI 3GTGI 1PFTA 2KI7B 2OOXB 2E2II 2HF1A 1TWFI 4NH1C 4RVFA 3GTLI 1VQ8Z 1R9TI 3CPWY 3PO3S 3RZDI 3CCJ1 3VMGA 3MZLB 1WCMI 3IF8A 1ZB9A 3VMIA 3EERA 1Q861 4MXUA 3CMAZ 1K732 1JJ2Z 2JIMA 2IZ4A 1K8A1 3Q87A 4HH4A 4HGZA 3CCL1 2R93I 1X3WA 2QEX1 2YADA 3LUSA 1K8A2 4NB9A 4NBBA 1Q7Y2 4RVGA 3H0GI 2IV2X 1Z02A 4RVDA 2VPYA 1VQM1 1KC81 2V3VA 2VPXA 4CL1A 4MH4A 1Q862 4A3GI 2Q4ZA 3G71Z 3FQQA 2AYDA 1K83I 2NVTI 2VPWA 4MRIA 3CCEZ 5T67A 2NVYI 2PK7A 3CCR1 5IT9f 1Y1WI 3MONA 2RBLA 3TE5B 3HKZA 3CCMZ 2YU9I 4RVHA 1NUIA 4S1TA 4NBGA 3KIFA 3KIHA 2AKLA 1S721 2J6AA 1P9NA 1JJ2Y 1VQK1 3GTMS 1RO4A 1K9M2 4A3JI 2LEXA 3CC7Z 5C44I 2JNYA 2V8IA 5C3EI 4A3CI 4A3DI 4A3KI 1TWGI 3J81f 3S14I 1YHQ1 1Q812 1VQ51 2K5RA 1Y1VS 1QVGY 1NJI1 4QTTA 2LFUA 4AYBA 1YIT1 1VQ6Z 3BG0B 2V8KA 1VQOZ 1K731 3CC2Z 2O53A 5T64A 3GTPI 3FQMA 1Z03A 1YJNZ 1DL6A 2DE6A 4NBFA 1YJWZ 4MD9A 2VUMI 2KPIA 4QTUA 2B63I 5AN9F 1ZH1A 2VUGA 2V45A 1S7MA 1Y8CA 1VQO1 3TDHB 3CC21 4E30A 2E2JI 4NBAA 3OW2Y 2JIQA 1VQP1 1YJW1 3D2LA 1VQL1 3NH5A 1FDOA 1X3ZA 2R92I 3I4NI 3M3YI 3F3PC 3H3VJ 1AA6A 1JWHC 3CCQZ 3VMHA 4DK1A 1Q822 3NDJA 3G711 2Y0SA 1M901 4TNUA 5FLMI 2OTLZ 1Z01A 3GTMI 4BBSI 2EGTA 1VQMZ 1TWAI 2M48A 3CMEZ 3J7A4 2OTJ1 1K9M1 3G4S1 4NBEA 5D1OA 1YUKA 1USPB 4RV9A 1QVFY 2E7ZA 5C4XI 1I3QI 1W2BZ 2O4HA 4E2WA 3HOXI 2RHBA 3GTQI 3I551 3S16I 2QRCB 2LIYA 3CC41 2JA7I 2QKDA 3JAMf 1VQKZ 3CCV1 2RIQA 2DE5A 2OOYB 3F3FC 4Y52I 2JIOA 3J80f 2F4MA 1Q811 2NVQI 5D1PA 2GTHA 4E33A 4NBCA 2JIRA 3S1RI 3I07A 2G2KA 5IP9I 1RNIA 3VTNA 1VQ81 1VQ5Z 2H85A 1Q16A 3NH8A 2IZ3A 5LL6f 3CCJZ 1N8R2 3HOUI 2R7ZI 3U50C 2GU2A 2WAQA 4E32A 3PO2I 1QYPA 5A2Qf 4MONA 3I561 4BY1I 1TWCI 2PMZA 3RZOI 1VQLZ 2QA41 2JA6I 1YJ91 2F4OA 1TWHI 4BXXI 1L1OC 3I56Z 4RS4A 1N8R1 5D1OB 1VQ7Z 1Q821 3CCE1 1USPA 2QREB 3FKII 2QLVB 4A3II 3S2DI 4NBDA 1YJ9Z 1YUAA 3CCQ1 1M1K2 3CQZI 3HOWI 1QVGZ 1QF8A 3IFUA 2OZKA 2QEXZ 2JUBA 3BG1B 2NVXI 5C4JI 1VQ41 1WJ2A 1I6HI 4E2ZA 1RLYA 4A3BI 2OTJZ 2JMOA 3IX0A 4E2YA 4A3FI 3CPWZ 3HOZI 3S1QI 1VQ4Z 3S1MI 1YIJZ 1KC82 5FLXb 1YHQZ 1YI2Z 2R6MA 5FLXf 1ML8A 4MD8A 1RO0A 3PO3I 3CCM1 3S15I 2QR1B 2ZAEB 1VQ61 1S72Z 3J80b 3HOYI 3CCU1 4Y7NI 3CCVZ 2PM9A 1I50I 3G6EZ 2W03A 1ZB8A 1WZNA 3D6WA 3JAMb 4BY7I 3HOVI 3NDIA 2W04A 4DQYB 5A2Qb 1Y1VI 3CC71 2JR6A 3D9XA 2BJOA 1W2BY 3CCUZ 3CXCY 4A3MI 4A3EI 1VQPZ 1TFIA 2P28A 3ESWA 3P5JB 2QA4Z 3GTJI 3OW2Z 1M902 3S1NI 1X0TA 3CXCZ 2GTIA 2QRDB 5IT9b 1YJN1 1M1K1 3K7AI 3GTKI 3VB9A 1VQ71 2JA5I 2VPZA 1RO2A 1SIWA 2E2HI 2OTL1 4X6AI 3QWUA 2WB1A 2JIPA 1VQ9Z 2HU9A 3CMA1 3GCFA 1QVFZ 2M6NA 1RQFA 3CCLZ 4NFRA 1KRLA 2JA8I 3CD6Z 1Q7Y1 3MZKB 3IR7A 1VLAA 3GKQA 4BBRI 1N2FA 1VQN1 4NBHA 3I55Z 1VQ91 4DGLA 1SFOI 4XX2A 2K3RA 1KQSY 3CC4Z 1KQSZ 3CD61 2JS4A 3CCRZ 4EWCA 2Q51A 1QXFA 1VQNZ 1KD11 4HGYA 1NP6A 1FDIA 3CME1 4A3LI 4NB8A 2P3YA 3G4SZ 5CM2M 3NFZA 3S17I 1KD12 1WIIA 3CCSZ 3J81b 3M4OI
chains in the Genus database with same CATH topology
1WW9A 4A93I 1YIJ1 2VF1A 2V8JA 1YI21 3EEDA 2E9HA 4E31A 2RT9A 1YITZ 3CCS1 4E2XA 5T6BA 3I4MI 5IP7I 3S2HI 3G6E1 4MD7A 3T4NB 3NH4A 4NOZA 2DE7A 1NJI2 1LQLA 2I3CA 2RPRA 3GTOI 3GTGI 1PFTA 2KI7B 2OOXB 2E2II 2HF1A 1TWFI 4NH1C 4RVFA 3GTLI 1VQ8Z 1R9TI 3CPWY 3PO3S 3RZDI 3CCJ1 3VMGA 3MZLB 1WCMI 3IF8A 1ZB9A 3VMIA 3EERA 1Q861 4MXUA 3CMAZ 1K732 1JJ2Z 1K8A1 2IZ4A 3Q87A 4HH4A 4HGZA 3CCL1 2R93I 1X3WA 2QEX1 2YADA 3LUSA 1K8A2 4NB9A 4NBBA 1Q7Y2 4RVGA 3H0GI 1Z02A 4RVDA 1VQM1 1KC81 4CL1A 4MH4A 1Q862 4A3GI 2Q4ZA 3G71Z 3FQQA 1K83I 2NVTI 4MRIA 3CCEZ 5T67A 2NVYI 2PK7A 3CCR1 5IT9f 1Y1WI 3MONA 2RBLA 3TE5B 3HKZA 3CCMZ 2YU9I 4RVHA 1NUIA 4S1TA 4NBGA 3KIFA 3KIHA 1S721 2AKLA 2J6AA 1P9NA 1JJ2Y 1VQK1 3GTMS 1RO4A 1K9M2 4A3JI 3CC7Z 5C44I 2JNYA 2V8IA 5C3EI 4A3CI 4A3DI 4A3KI 1TWGI 3J81f 3S14I 1YHQ1 1Q812 1VQ51 2K5RA 1Y1VS 1QVGY 1NJI1 4QTTA 2LFUA 4AYBA 1YIT1 1VQ6Z 3BG0B 2V8KA 1VQOZ 1K731 3CC2Z 2O53A 5T64A 3GTPI 3FQMA 1Z03A 1YJNZ 1DL6A 2DE6A 4NBFA 1YJWZ 4MD9A 2VUMI 2KPIA 4QTUA 2B63I 5AN9F 1ZH1A 2VUGA 1S7MA 1VQO1 3TDHB 3CC21 4E30A 2E2JI 4NBAA 3OW2Y 1VQP1 1YJW1 1VQL1 3NH5A 1X3ZA 2R92I 3I4NI 3M3YI 3F3PC 3H3VJ 1JWHC 3CCQZ 3VMHA 4DK1A 1Q822 3NDJA 3G711 2Y0SA 1M901 4TNUA 5FLMI 2OTLZ 1Z01A 3GTMI 4BBSI 2EGTA 1VQMZ 1TWAI 2M48A 3CMEZ 3J7A4 2OTJ1 1K9M1 3G4S1 4NBEA 5D1OA 1YUKA 1USPB 4RV9A 1QVFY 5C4XI 1W2BZ 1I3QI 2O4HA 4E2WA 3HOXI 2RHBA 3GTQI 3I551 3S16I 2QRCB 2LIYA 3CC41 2JA7I 2QKDA 3JAMf 1VQKZ 3CCV1 2RIQA 2DE5A 2OOYB 3F3FC 4Y52I 3J80f 2F4MA 1Q811 2NVQI 5D1PA 2GTHA 4E33A 4NBCA 3S1RI 3I07A 2G2KA 5IP9I 1RNIA 3VTNA 1VQ81 1VQ5Z 2H85A 3NH8A 2IZ3A 5LL6f 3CCJZ 1N8R2 3HOUI 2R7ZI 3U50C 2GU2A 2WAQA 4E32A 3PO2I 1QYPA 5A2Qf 4MONA 3I561 4BY1I 1TWCI 2PMZA 3RZOI 1VQLZ 2QA41 2JA6I 1YJ91 2F4OA 1TWHI 4BXXI 1L1OC 3I56Z 4RS4A 1N8R1 5D1OB 1VQ7Z 1Q821 3CCE1 1USPA 2QREB 3FKII 2QLVB 4A3II 3S2DI 4NBDA 1YJ9Z 1YUAA 3CCQ1 1M1K2 3CQZI 3HOWI 1QVGZ 1QF8A 3IFUA 2OZKA 2QEXZ 2JUBA 3BG1B 2NVXI 5C4JI 1VQ41 1I6HI 4E2ZA 1RLYA 4A3BI 2OTJZ 2JMOA 3IX0A 4E2YA 4A3FI 3CPWZ 3HOZI 3S1QI 1VQ4Z 3S1MI 1YIJZ 1KC82 5FLXb 1YHQZ 1YI2Z 2R6MA 5FLXf 1ML8A 4MD8A 1RO0A 3PO3I 3CCM1 3S15I 2QR1B 2ZAEB 1VQ61 1S72Z 3J80b 3HOYI 3CCU1 4Y7NI 3CCVZ 2PM9A 1I50I 3G6EZ 2W03A 1ZB8A 3D6WA 3JAMb 4BY7I 3HOVI 3NDIA 2W04A 4DQYB 5A2Qb 1Y1VI 3CC71 2JR6A 3D9XA 2BJOA 1W2BY 3CCUZ 3CXCY 4A3MI 4A3EI 1VQPZ 1TFIA 2P28A 3ESWA 3P5JB 2QA4Z 3GTJI 3OW2Z 1M902 3S1NI 1X0TA 3CXCZ 2GTIA 2QRDB 5IT9b 1YJN1 1M1K1 3K7AI 3GTKI 3VB9A 1VQ71 2JA5I 1RO2A 2E2HI 2OTL1 4X6AI 3QWUA 2WB1A 1VQ9Z 2HU9A 3CMA1 3GCFA 1QVFZ 2M6NA 1RQFA 3CCLZ 4NFRA 1KRLA 2JA8I 3CD6Z 1Q7Y1 3MZKB 1VLAA 3GKQA 4BBRI 1N2FA 1VQN1 4NBHA 3I55Z 1VQ91 4DGLA 1SFOI 4XX2A 2K3RA 1KQSY 3CC4Z 1KQSZ 3CD61 2JS4A 3CCRZ 4EWCA 2Q51A 1VQNZ 1KD11 4HGYA 1NP6A 3CME1 4A3LI 4NB8A 2P3YA 3G4SZ 5CM2M 3NFZA 3S17I 1KD12 1WIIA 3CCSZ 3J81b 3M4OI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK Z;  3CCM 1;  3CCV 1;  1YIJ 1;  3CC7 Z;  1VQ6 1;  1S72 Z;  1YI2 1;  3CCU 1;  3CCV Z;  1Q81 1;  3G6E Z;  1YIT Z;  3CCS 1;  1YHQ 1;  1Q81 2;  1VQ5 1;  1QVG Y;  3G6E 1;  1NJI 1;  3CC7 1;  1YIT 1;  1VQ6 Z;  1VQ8 1;  1VQ5 Z;  1VQO Z;  1K73 1;  1W2B Y;  3CCU Z;  1NJI 2;  3CC2 Z;  3CCJ Z;  1N8R 2;  3CXC Y;  1YJN Z;  1YJW Z;  1VQP Z;  3I56 1;  2QA4 Z;  3OW2 Z;  1M90 2;  1VQ8 Z;  1VQO 1;  3CPW Y;  3CXC Z;  1VQL Z;  3CC2 1;  3CCJ 1;  2QA4 1;  1YJN 1;  1M1K 1;  1YJ9 1;  3OW2 Y;  1VQP 1;  1YJW 1;  1Q86 1;  1VQ7 1;  1VQL 1;  3CMA Z;  1K73 2;  3I56 Z;  1JJ2 Z;  1K8A 1;  2OTL 1;  1N8R 1;  3CCL 1;  2QEX 1;  1VQ7 Z;  1Q82 1;  3CCE 1;  3CCQ Z;  1K8A 2;  1VQ9 Z;  3CMA 1;  1Q82 2;  1Q7Y 2;  1QVF Z;  3CCL Z;  3G71 1;  1YJ9 Z;  3CCQ 1;  1VQM 1;  1M1K 2;  3CD6 Z;  1KC8 1;  1Q7Y 1;  1M90 1;  1Q86 2;  3G71 Z;  1QVG Z;  2OTL Z;  1VQN 1;  2QEX Z;  1VQM Z;  3CCE Z;  3I55 Z;  3CME Z;  2OTJ 1;  1VQ9 1;  1VQ4 1;  3CCR 1;  3G4S 1;  1K9M 1;  1KQS Y;  3CC4 Z;  1KQS Z;  3CD6 1;  2OTJ Z;  3CCM Z;  1QVF Y;  3CCR Z;  1W2B Z;  1S72 1;  3CPW Z;  1VQN Z;  1KD1 1;  1JJ2 Y;  3I55 1;  3CME 1;  1VQK 1;  1VQ4 Z;  3G4S Z;  1YIJ Z;  1KC8 2;  1KD1 2;  1K9M 2;  3CCS Z;  1YHQ Z;  3CC4 1;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 1WW9 A;  4A93 I;  1YIJ 1;  2VF1 A;  2V8J A;  1YI2 1;  3EED A;  2E9H A;  4E31 A;  2RT9 A;  1YIT Z;  3CCS 1;  4E2X A;  5T6B A;  3I4M I;  5IP7 I;  3S2H I;  3G6E 1;  2NAP A;  4MD7 A;  3T4N B;  3NH4 A;  4NOZ A;  2DE7 A;  1NJI 2;  1LQL A;  2I3C A;  2RPR A;  3GTO I;  3GTG I;  1PFT A;  2KI7 B;  2OOX B;  2E2I I;  2HF1 A;  1TWF I;  4NH1 C;  4RVF A;  3GTL I;  1VQ8 Z;  1R9T I;  3CPW Y;  3PO3 S;  3RZD I;  3CCJ 1;  3VMG A;  3MZL B;  1WCM I;  3IF8 A;  1ZB9 A;  3VMI A;  3EER A;  1Q86 1;  4MXU A;  3CMA Z;  1K73 2;  1JJ2 Z;  2JIM A;  2IZ4 A;  1K8A 1;  3Q87 A;  4HH4 A;  4HGZ A;  3CCL 1;  2R93 I;  1X3W A;  2QEX 1;  2YAD A;  3LUS A;  1K8A 2;  4NB9 A;  4NBB A;  1Q7Y 2;  4RVG A;  3H0G I;  2IV2 X;  1Z02 A;  4RVD A;  2VPY A;  1VQM 1;  1KC8 1;  2V3V A;  2VPX A;  4CL1 A;  4MH4 A;  1Q86 2;  4A3G I;  2Q4Z A;  3G71 Z;  3FQQ A;  2AYD A;  1K83 I;  2NVT I;  2VPW A;  4MRI A;  3CCE Z;  5T67 A;  2NVY I;  2PK7 A;  3CCR 1;  5IT9 f;  1Y1W I;  3MON A;  2RBL A;  3TE5 B;  3HKZ A;  3CCM Z;  2YU9 I;  4RVH A;  1NUI A;  4S1T A;  4NBG A;  3KIF A;  3KIH A;  2AKL A;  1S72 1;  2J6A A;  1P9N A;  1JJ2 Y;  1VQK 1;  3GTM S;  1RO4 A;  1K9M 2;  4A3J I;  2LEX A;  3CC7 Z;  5C44 I;  2JNY A;  2V8I A;  5C3E I;  4A3C I;  4A3D I;  4A3K I;  1TWG I;  3J81 f;  3S14 I;  1YHQ 1;  1Q81 2;  1VQ5 1;  2K5R A;  1Y1V S;  1QVG Y;  1NJI 1;  4QTT A;  2LFU A;  4AYB A;  1YIT 1;  1VQ6 Z;  3BG0 B;  2V8K A;  1VQO Z;  1K73 1;  3CC2 Z;  2O53 A;  5T64 A;  3GTP I;  3FQM A;  1Z03 A;  1YJN Z;  1DL6 A;  2DE6 A;  4NBF A;  1YJW Z;  4MD9 A;  2VUM I;  2KPI A;  4QTU A;  2B63 I;  5AN9 F;  1ZH1 A;  2VUG A;  2V45 A;  1S7M A;  1Y8C A;  1VQO 1;  3TDH B;  3CC2 1;  4E30 A;  2E2J I;  4NBA A;  3OW2 Y;  2JIQ A;  1VQP 1;  1YJW 1;  3D2L A;  1VQL 1;  3NH5 A;  1FDO A;  1X3Z A;  2R92 I;  3I4N I;  3M3Y I;  3F3P C;  3H3V J;  1AA6 A;  1JWH C;  3CCQ Z;  3VMH A;  4DK1 A;  1Q82 2;  3NDJ A;  3G71 1;  2Y0S A;  1M90 1;  4TNU A;  5FLM I;  2OTL Z;  1Z01 A;  3GTM I;  4BBS I;  2EGT A;  1VQM Z;  1TWA I;  2M48 A;  3CME Z;  3J7A 4;  2OTJ 1;  1K9M 1;  3G4S 1;  4NBE A;  5D1O A;  1YUK A;  1USP B;  4RV9 A;  1QVF Y;  2E7Z A;  5C4X I;  1I3Q I;  1W2B Z;  2O4H A;  4E2W A;  3HOX I;  2RHB A;  3GTQ I;  3I55 1;  3S16 I;  2QRC B;  2LIY A;  3CC4 1;  2JA7 I;  2QKD A;  3JAM f;  1VQK Z;  3CCV 1;  2RIQ A;  2DE5 A;  2OOY B;  3F3F C;  4Y52 I;  2JIO A;  3J80 f;  2F4M A;  1Q81 1;  2NVQ I;  5D1P A;  2GTH A;  4E33 A;  4NBC A;  2JIR A;  3S1R I;  3I07 A;  2G2K A;  5IP9 I;  1RNI A;  3VTN A;  1VQ8 1;  1VQ5 Z;  2H85 A;  1Q16 A;  3NH8 A;  2IZ3 A;  5LL6 f;  3CCJ Z;  1N8R 2;  3HOU I;  2R7Z I;  3U50 C;  2GU2 A;  2WAQ A;  4E32 A;  3PO2 I;  1QYP A;  5A2Q f;  4MON A;  3I56 1;  4BY1 I;  1TWC I;  2PMZ A;  3RZO I;  1VQL Z;  2QA4 1;  2JA6 I;  1YJ9 1;  2F4O A;  1TWH I;  4BXX I;  1L1O C;  3I56 Z;  4RS4 A;  1N8R 1;  5D1O B;  1VQ7 Z;  1Q82 1;  3CCE 1;  1USP A;  2QRE B;  3FKI I;  2QLV B;  4A3I I;  3S2D I;  4NBD A;  1YJ9 Z;  1YUA A;  3CCQ 1;  1M1K 2;  3CQZ I;  3HOW I;  1QVG Z;  1QF8 A;  3IFU A;  2OZK A;  2QEX Z;  2JUB A;  3BG1 B;  2NVX I;  5C4J I;  1VQ4 1;  1WJ2 A;  1I6H I;  4E2Z A;  1RLY A;  4A3B I;  2OTJ Z;  2JMO A;  3IX0 A;  4E2Y A;  4A3F I;  3CPW Z;  3HOZ I;  3S1Q I;  1VQ4 Z;  3S1M I;  1YIJ Z;  1KC8 2;  5FLX b;  1YHQ Z;  1YI2 Z;  2R6M A;  5FLX f;  1ML8 A;  4MD8 A;  1RO0 A;  3PO3 I;  3CCM 1;  3S15 I;  2QR1 B;  2ZAE B;  1VQ6 1;  1S72 Z;  3J80 b;  3HOY I;  3CCU 1;  4Y7N I;  3CCV Z;  2PM9 A;  1I50 I;  3G6E Z;  2W03 A;  1ZB8 A;  1WZN A;  3D6W A;  3JAM b;  4BY7 I;  3HOV I;  3NDI A;  2W04 A;  4DQY B;  5A2Q b;  1Y1V I;  3CC7 1;  2JR6 A;  3D9X A;  2BJO A;  1W2B Y;  3CCU Z;  3CXC Y;  4A3M I;  4A3E I;  1VQP Z;  1TFI A;  2P28 A;  3ESW A;  3P5J B;  2QA4 Z;  3GTJ I;  3OW2 Z;  1M90 2;  3S1N I;  1X0T A;  3CXC Z;  2GTI A;  2QRD B;  5IT9 b;  1YJN 1;  1M1K 1;  3K7A I;  3GTK I;  3VB9 A;  1VQ7 1;  2JA5 I;  2VPZ A;  1RO2 A;  1SIW A;  2E2H I;  2OTL 1;  4X6A I;  3QWU A;  2WB1 A;  2JIP A;  1VQ9 Z;  2HU9 A;  3CMA 1;  3GCF A;  1QVF Z;  2M6N A;  1RQF A;  3CCL Z;  4NFR A;  1KRL A;  2JA8 I;  3CD6 Z;  1Q7Y 1;  3MZK B;  3IR7 A;  1VLA A;  3GKQ A;  4BBR I;  1N2F A;  1VQN 1;  4NBH A;  3I55 Z;  1VQ9 1;  4DGL A;  1SFO I;  4XX2 A;  2K3R A;  1KQS Y;  3CC4 Z;  1KQS Z;  3CD6 1;  2JS4 A;  3CCR Z;  4EWC A;  2Q51 A;  1QXF A;  1VQN Z;  1KD1 1;  4HGY A;  1NP6 A;  1FDI A;  3CME 1;  4A3L I;  4NB8 A;  2P3Y A;  3G4S Z;  5CM2 M;  3NFZ A;  3S17 I;  1KD1 2;  1WII A;  3CCS Z;  3J81 b;  3M4O I; 
#chains in the Genus database with same CATH homology
 1WW9 A;  4A93 I;  1YIJ 1;  2VF1 A;  2V8J A;  1YI2 1;  3EED A;  2E9H A;  4E31 A;  2RT9 A;  1YIT Z;  3CCS 1;  4E2X A;  5T6B A;  3I4M I;  5IP7 I;  3S2H I;  3G6E 1;  4MD7 A;  3T4N B;  3NH4 A;  4NOZ A;  2DE7 A;  1NJI 2;  1LQL A;  2I3C A;  2RPR A;  3GTO I;  3GTG I;  1PFT A;  2KI7 B;  2OOX B;  2E2I I;  2HF1 A;  1TWF I;  4NH1 C;  4RVF A;  3GTL I;  1VQ8 Z;  1R9T I;  3CPW Y;  3PO3 S;  3RZD I;  3CCJ 1;  3VMG A;  3MZL B;  1WCM I;  3IF8 A;  1ZB9 A;  3VMI A;  3EER A;  1Q86 1;  4MXU A;  3CMA Z;  1K73 2;  1JJ2 Z;  1K8A 1;  2IZ4 A;  3Q87 A;  4HH4 A;  4HGZ A;  3CCL 1;  2R93 I;  1X3W A;  2QEX 1;  2YAD A;  3LUS A;  1K8A 2;  4NB9 A;  4NBB A;  1Q7Y 2;  4RVG A;  3H0G I;  1Z02 A;  4RVD A;  1VQM 1;  1KC8 1;  4CL1 A;  4MH4 A;  1Q86 2;  4A3G I;  2Q4Z A;  3G71 Z;  3FQQ A;  1K83 I;  2NVT I;  4MRI A;  3CCE Z;  5T67 A;  2NVY I;  2PK7 A;  3CCR 1;  5IT9 f;  1Y1W I;  3MON A;  2RBL A;  3TE5 B;  3HKZ A;  3CCM Z;  2YU9 I;  4RVH A;  1NUI A;  4S1T A;  4NBG A;  3KIF A;  3KIH A;  1S72 1;  2AKL A;  2J6A A;  1P9N A;  1JJ2 Y;  1VQK 1;  3GTM S;  1RO4 A;  1K9M 2;  4A3J I;  3CC7 Z;  5C44 I;  2JNY A;  2V8I A;  5C3E I;  4A3C I;  4A3D I;  4A3K I;  1TWG I;  3J81 f;  3S14 I;  1YHQ 1;  1Q81 2;  1VQ5 1;  2K5R A;  1Y1V S;  1QVG Y;  1NJI 1;  4QTT A;  2LFU A;  4AYB A;  1YIT 1;  1VQ6 Z;  3BG0 B;  2V8K A;  1VQO Z;  1K73 1;  3CC2 Z;  2O53 A;  5T64 A;  3GTP I;  3FQM A;  1Z03 A;  1YJN Z;  1DL6 A;  2DE6 A;  4NBF A;  1YJW Z;  4MD9 A;  2VUM I;  2KPI A;  4QTU A;  2B63 I;  5AN9 F;  1ZH1 A;  2VUG A;  1S7M A;  1VQO 1;  3TDH B;  3CC2 1;  4E30 A;  2E2J I;  4NBA A;  3OW2 Y;  1VQP 1;  1YJW 1;  1VQL 1;  3NH5 A;  1X3Z A;  2R92 I;  3I4N I;  3M3Y I;  3F3P C;  3H3V J;  1JWH C;  3CCQ Z;  3VMH A;  4DK1 A;  1Q82 2;  3NDJ A;  3G71 1;  2Y0S A;  1M90 1;  4TNU A;  5FLM I;  2OTL Z;  1Z01 A;  3GTM I;  4BBS I;  2EGT A;  1VQM Z;  1TWA I;  2M48 A;  3CME Z;  3J7A 4;  2OTJ 1;  1K9M 1;  3G4S 1;  4NBE A;  5D1O A;  1YUK A;  1USP B;  4RV9 A;  1QVF Y;  5C4X I;  1W2B Z;  1I3Q I;  2O4H A;  4E2W A;  3HOX I;  2RHB A;  3GTQ I;  3I55 1;  3S16 I;  2QRC B;  2LIY A;  3CC4 1;  2JA7 I;  2QKD A;  3JAM f;  1VQK Z;  3CCV 1;  2RIQ A;  2DE5 A;  2OOY B;  3F3F C;  4Y52 I;  3J80 f;  2F4M A;  1Q81 1;  2NVQ I;  5D1P A;  2GTH A;  4E33 A;  4NBC A;  3S1R I;  3I07 A;  2G2K A;  5IP9 I;  1RNI A;  3VTN A;  1VQ8 1;  1VQ5 Z;  2H85 A;  3NH8 A;  2IZ3 A;  5LL6 f;  3CCJ Z;  1N8R 2;  3HOU I;  2R7Z I;  3U50 C;  2GU2 A;  2WAQ A;  4E32 A;  3PO2 I;  1QYP A;  5A2Q f;  4MON A;  3I56 1;  4BY1 I;  1TWC I;  2PMZ A;  3RZO I;  1VQL Z;  2QA4 1;  2JA6 I;  1YJ9 1;  2F4O A;  1TWH I;  4BXX I;  1L1O C;  3I56 Z;  4RS4 A;  1N8R 1;  5D1O B;  1VQ7 Z;  1Q82 1;  3CCE 1;  1USP A;  2QRE B;  3FKI I;  2QLV B;  4A3I I;  3S2D I;  4NBD A;  1YJ9 Z;  1YUA A;  3CCQ 1;  1M1K 2;  3CQZ I;  3HOW I;  1QVG Z;  1QF8 A;  3IFU A;  2OZK A;  2QEX Z;  2JUB A;  3BG1 B;  2NVX I;  5C4J I;  1VQ4 1;  1I6H I;  4E2Z A;  1RLY A;  4A3B I;  2OTJ Z;  2JMO A;  3IX0 A;  4E2Y A;  4A3F I;  3CPW Z;  3HOZ I;  3S1Q I;  1VQ4 Z;  3S1M I;  1YIJ Z;  1KC8 2;  5FLX b;  1YHQ Z;  1YI2 Z;  2R6M A;  5FLX f;  1ML8 A;  4MD8 A;  1RO0 A;  3PO3 I;  3CCM 1;  3S15 I;  2QR1 B;  2ZAE B;  1VQ6 1;  1S72 Z;  3J80 b;  3HOY I;  3CCU 1;  4Y7N I;  3CCV Z;  2PM9 A;  1I50 I;  3G6E Z;  2W03 A;  1ZB8 A;  3D6W A;  3JAM b;  4BY7 I;  3HOV I;  3NDI A;  2W04 A;  4DQY B;  5A2Q b;  1Y1V I;  3CC7 1;  2JR6 A;  3D9X A;  2BJO A;  1W2B Y;  3CCU Z;  3CXC Y;  4A3M I;  4A3E I;  1VQP Z;  1TFI A;  2P28 A;  3ESW A;  3P5J B;  2QA4 Z;  3GTJ I;  3OW2 Z;  1M90 2;  3S1N I;  1X0T A;  3CXC Z;  2GTI A;  2QRD B;  5IT9 b;  1YJN 1;  1M1K 1;  3K7A I;  3GTK I;  3VB9 A;  1VQ7 1;  2JA5 I;  1RO2 A;  2E2H I;  2OTL 1;  4X6A I;  3QWU A;  2WB1 A;  1VQ9 Z;  2HU9 A;  3CMA 1;  3GCF A;  1QVF Z;  2M6N A;  1RQF A;  3CCL Z;  4NFR A;  1KRL A;  2JA8 I;  3CD6 Z;  1Q7Y 1;  3MZK B;  1VLA A;  3GKQ A;  4BBR I;  1N2F A;  1VQN 1;  4NBH A;  3I55 Z;  1VQ9 1;  4DGL A;  1SFO I;  4XX2 A;  2K3R A;  1KQS Y;  3CC4 Z;  1KQS Z;  3CD6 1;  2JS4 A;  3CCR Z;  4EWC A;  2Q51 A;  1VQN Z;  1KD1 1;  4HGY A;  1NP6 A;  3CME 1;  4A3L I;  4NB8 A;  2P3Y A;  3G4S Z;  5CM2 M;  3NFZ A;  3S17 I;  1KD1 2;  1WII A;  3CCS Z;  3J81 b;  3M4O I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...