1Y1VI

Refined rna polymerase ii-tfiis complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI02
5CM2M 2AKLA 4NBFA 3GTKI 2E2JI 2JNYA 1ZB9A 3GTLI 1Y1VS 2VUMI 3S17I 4NBAA 3VMGA 3RZDI 1NUIA 1I50I 1USPA 1ZB8A 3PO2I 4BBRI 4A3JI 5IP7I 2J6AA 4NBCA 4A93I 4BY7I 1TWGI 4QTUA 3GTMI 3HOWI 3GKQA 3Q87A 3VB9A 4NBGA 3ESWA 2NVXI 1L1OC 2K5RA 2HF1A 1RLYA 3S2HI 1I3QI 5FLMI 2JA7I 2JA6I 3D6WA 3S1NI 2BJOA 3S2DI 2NVYI 2P3YA 1TWHI 1Y1WI 4NB8A 3I4MI 3H0GI 4NBBA 2R93I 2R7ZI 4A3MI 3H3VJ 1USPB 4NBDA 1DL6A 5C4JI 4A3FI 2NVQI 4X6AI 1I6HI 3I07A 2RBLA 2NVTI 3S14I 3GCFA 2F4OA 3S15I 3GTGI 2KPIA 4A3II 4A3DI 1TWCI 5C4XI 1QYPA 4Y7NI 4BBSI 3VMIA 3S16I 4BXXI 3RZOI 3S1QI 2JA8I 4A3CI 4A3LI 2DE7A 4NBHA 1X3WA 1X3ZA 3U50C 3GTMS 2DE5A 1SFOI 4A3BI 1R9TI 2YU9I 2B63I 4A3GI 4NB9A 3K7AI 2JR6A 1WCMI 2E2II 4A3EI 1TWAI 5C44I 2F4MA 4XX2A 3PO3I 3FKII 3CQZI 3VMHA 3HOZI 1K83I 3HOYI 3GTPI 1YUAA 3M4OI 2JS4A 4NBEA 3GTJI 3EERA 2JA5I 2R92I 1N2FA 4MH4A 1Y1VI 3M3YI 3I4NI 3S1MI 1PFTA 2E2HI 3GTQI 4QTTA 1TFIA 2PK7A 4BY1I 3HOVI 4NOZA 3LUSA 3HOUI 1LQLA 3PO3S 4A3KI 1ML8A 1TWFI 1VLAA 2DE6A 4Y52I 3GTOI 1WW9A 3S1RI 1RO4A 5IP9I 5C3EI 3HOXI
chains in the Genus database with same CATH superfamily
2AKLA 4NBFA 2JNYA 1YI21 1KC81 3CME1 1QXFA 3G4S1 4A3JI 5IP7I 2NAPA 3JAMb 4BY7I 1VQM1 3Q87A 5IT9f 2LFUA 2QEXZ 3EEDA 3ESWA 3G71Z 2OTJZ 2K5RA 4MRIA 4E33A 2HF1A 3S2HI 5FLMI 2K3RA 2JA6I 3CMAZ 1YHQ1 1M902 2P3YA 2QRCB 4NB8A 3H0GI 2R93I 4A3MI 3H3VJ 2H85A 5C4JI 5FLXf 2YADA 4A3FI 4X6AI 4RVDA 3NDJA 2VPZA 2RBLA 4E2XA 2NVTI 2WB1A 3GTGI 2KPIA 4A3DI 2JIOA 1TWCI 5C4XI 2Y0SA 1YI2Z 3CMEZ 2PMZA 3G4SZ 3VMIA 3P5JB 4BXXI 3RZOI 4A3LI 2RT9A 4DGLA 4MONA 1VQMZ 2GTIA 1K9M2 2RHBA 2DE5A 2W03A 1R9TI 1Q7Y2 2B63I 1VQ41 1YHQZ 2E2II 4A3EI 5C44I 1Q822 3I55Z 4XX2A 3PO3I 3HKZA 1WIIA 4MD7A 1YUAA 2JS4A 1K9M1 4NBEA 4E2YA 3GTJI 4HGZA 3J80f 2R92I 4MH4A 1Y1VI 3I4NI 2W04A 2R6MA 1Q7Y1 1VQP1 2PK7A 1KRLA 1Q16A 3LUSA 2VUGA 3PO3S 2AYDA 5A2Qf 1Q821 2RPRA 5IP9I 3HOXI 3GTKI 1X0TA 1Y1VS 2VUMI 2QA41 4HGYA 1NP6A 3J81f 4NBAA 1ZB8A 2VPXA 4A93I 5LL6f 1VQ61 4CL1A 1VQ4Z 4QTUA 3CC21 4HH4A 2OOYB 3IFUA 1RLYA 3NH5A 2JA7I 2QKDA 3CCL1 3BG1B 3D6WA 2QRDB 2G2KA 2NVYI 1N8R1 1S721 2EGTA 1QVGZ 3I4MI 1VQPZ 4NBDA 3VTNA 1YUKA 3NFZA 1I6HI 3NDIA 3CCR1 3S14I 2O4HA 1Q861 3CD61 4A3II 1QYPA 2QA4Z 3MZKB 4Y7NI 1QVFY 3S16I 5IT9b 2JA8I 5T67A 4A3CI 3I551 1VQ6Z 4RS4A 1YIJ1 1X3WA 3U50C 3CC2Z 2VF1A 3CCMZ 4A3BI 2M6NA 3F3PC 2YU9I 2HU9A 3CCS1 3CCLZ 1WCMI 2GTHA 2F4MA 1SIWA 1S72Z 3FKII 3CQZI 2V8IA 1Z03A 1K731 3VMHA 1K83I 3GTPI 2IZ4A 4E31A 2JMOA 1ZH1A 3KIFA 3EERA 2JA5I 1N2FA 2JIMA 1WZNA 2JIQA 3CXCZ 3CCRZ 1FDOA 1QVFZ 3GTQI 3CD6Z 4NH1C 4BY1I 3G6E1 1ML8A 1YJN1 2DE6A 3GTOI 3CCE1 1RO4A 1NJI1 2E9HA 3IF8A 2VPWA 2M48A 1YIJZ 1ZB9A 4E30A 1RO0A 5T64A 1KD12 3RZDI 1NUIA 2WAQA 4RVFA 3CC4Z 3IX0A 3CCSZ 1TWGI 1KQSZ 2P28A 1Q811 3GTMI 3HOWI 1Y8CA 4MD9A 3J80b 1RQFA 3CCQ1 3CCV1 1QVGY 1YJ9Z 1VQ71 3T4NB 1KD11 3S1NI 2BJOA 3IR7A 1VQ51 3D2LA 1TWHI 1Y1WI 3OW2Z 3NH4A 1DL6A 4E2WA 1N8R2 2E7ZA 2OOXB 3G6EZ 1YJNZ 3CCEZ 3GCFA 3J81b 2F4OA 3S15I 2PM9A 3CCM1 2OTLZ 1K8A2 1Q862 4BBSI 3CCU1 1QF8A 3MONA 2DE7A 2KI7B 2JIPA 2LIYA 1AA6A 1FDIA 3D9XA 4MXUA 1M1K1 3CCQZ 1SFOI 3CCVZ 1VQ7Z 1K8A1 4MD8A 3CPWY 2JR6A 1JWHC 4RV9A 1VQKZ 1VQ5Z 3CXCY 1TWAI 1VQLZ 2I3CA 3JAMf 1RNIA 2IV2X 3HOZI 1Z02A 1VQO1 4AYBA 1K732 3FQMA 3M3YI 4EWCA 3S1MI 1PFTA 2E2HI 1JJ2Z 2IZ3A 4QTTA 1TFIA 3KIHA 3HOVI 4NOZA 3HOUI 3BG0B 5D1PA 3CC41 1LQLA 3CCUZ 4A3KI 1VLAA 2Q4ZA 1WW9A 3S1RI 5FLXb 5CM2M 4TNUA 1W2BZ 3I56Z 4RVGA 5AN9F 2E2JI 1KQSY 2O53A 3GTLI 3S17I 1YJ91 1NJI2 3VMGA 3QWUA 1I50I 1USPA 3CPWZ 3PO2I 2VPYA 4BBRI 2ZAEB 1VQN1 2J6AA 4NBCA 2V3VA 4E2ZA 3GKQA 1VQ81 5D1OA 3VB9A 4NBGA 1Q812 3CCJ1 2NVXI 1S7MA 1L1OC 2JUBA 3OW2Y 1VQ91 1M901 4E32A 1I3QI 1VQOZ 3S2DI 2OTL1 4NBBA 2R7ZI 1USPB 3J7A4 1P9NA 2NVQI 3CC71 3I07A 1Z01A 5D1OB 2LEXA 2GU2A 1YJW1 2RIQA 1YIT1 1VQK1 3S1QI 1VQNZ 3FQQA 4S1TA 1VQL1 5A2Qb 4RVHA 4NBHA 1X3ZA 1VQ8Z 2V8JA 3GTMS 3F3FC 3CCJZ 1WJ2A 2QREB 1VQ9Z 1M1K2 4A3GI 2V8KA 4NFRA 4NB9A 3K7AI 5T6BA 4DK1A 2QR1B 2QEX1 3G711 1JJ2Y 4DQYB 2OTJ1 3HOYI 3TDHB 3M4OI 3CC7Z 3I561 3CMA1 2OZKA 1KC82 1W2BY 2JIRA 2Q51A 1YJWZ 1RO2A 2QLVB 1TWFI 4Y52I 3TE5B 3NH8A 1YITZ 2V45A 5C3EI 3MZLB
chains in the Genus database with same CATH topology
2AKLA 4NBFA 2JNYA 1YI21 1KC81 3CME1 3G4S1 4A3JI 5IP7I 3JAMb 4BY7I 1VQM1 3Q87A 5IT9f 2LFUA 2QEXZ 3EEDA 3ESWA 3G71Z 2OTJZ 2K5RA 4MRIA 4E33A 2HF1A 3S2HI 5FLMI 2K3RA 2JA6I 3CMAZ 1YHQ1 1M902 2P3YA 2QRCB 4NB8A 3H0GI 2R93I 4A3MI 3H3VJ 2H85A 5C4JI 5FLXf 2YADA 4A3FI 4X6AI 4RVDA 3NDJA 2RBLA 4E2XA 2NVTI 2WB1A 3GTGI 2KPIA 4A3DI 1TWCI 5C4XI 2Y0SA 1YI2Z 3CMEZ 2PMZA 3G4SZ 3VMIA 3P5JB 4BXXI 3RZOI 4A3LI 2RT9A 4DGLA 1VQMZ 4MONA 2GTIA 1K9M2 2RHBA 2DE5A 2W03A 1R9TI 1Q7Y2 2B63I 1VQ41 1YHQZ 2E2II 4A3EI 5C44I 1Q822 3I55Z 4XX2A 3PO3I 3HKZA 1WIIA 4MD7A 1YUAA 2JS4A 1K9M1 4NBEA 4E2YA 3GTJI 4HGZA 3J80f 2R92I 4MH4A 1Y1VI 3I4NI 2W04A 2R6MA 1Q7Y1 1VQP1 2PK7A 1KRLA 3LUSA 2VUGA 3PO3S 5A2Qf 1Q821 2RPRA 5IP9I 3HOXI 3GTKI 1X0TA 1Y1VS 2VUMI 2QA41 4HGYA 1NP6A 3J81f 4NBAA 1ZB8A 4A93I 5LL6f 1VQ61 4CL1A 1VQ4Z 4QTUA 3CC21 4HH4A 2OOYB 3IFUA 1RLYA 3NH5A 2JA7I 2QKDA 3CCL1 3BG1B 3D6WA 2QRDB 2G2KA 2NVYI 1N8R1 1S721 2EGTA 1QVGZ 3I4MI 1VQPZ 4NBDA 3VTNA 1YUKA 3NFZA 1I6HI 3NDIA 3CCR1 3S14I 2O4HA 1Q861 3CD61 4A3II 1QYPA 2QA4Z 3MZKB 4Y7NI 1QVFY 3S16I 5IT9b 2JA8I 5T67A 4A3CI 3I551 1VQ6Z 4RS4A 1YIJ1 1X3WA 3U50C 3CC2Z 2VF1A 3CCMZ 4A3BI 2M6NA 3F3PC 2YU9I 2HU9A 3CCS1 3CCLZ 1WCMI 2GTHA 2F4MA 1S72Z 3FKII 3CQZI 2V8IA 1Z03A 1K731 3VMHA 1K83I 3GTPI 2IZ4A 4E31A 2JMOA 1ZH1A 3KIFA 3EERA 2JA5I 1N2FA 3CXCZ 3CCRZ 1QVFZ 3GTQI 3CD6Z 4NH1C 4BY1I 3G6E1 1ML8A 1YJN1 2DE6A 3GTOI 3CCE1 1RO4A 1NJI1 2E9HA 3IF8A 2M48A 1YIJZ 1ZB9A 4E30A 1RO0A 5T64A 1KD12 3RZDI 1NUIA 2WAQA 4RVFA 3CC4Z 3IX0A 3CCSZ 1TWGI 1KQSZ 2P28A 1Q811 3GTMI 3HOWI 4MD9A 3J80b 1RQFA 3CCQ1 3CCV1 1QVGY 1YJ9Z 1VQ71 3T4NB 1KD11 3S1NI 2BJOA 1VQ51 1TWHI 1Y1WI 3OW2Z 3NH4A 1DL6A 4E2WA 1N8R2 2OOXB 3G6EZ 1YJNZ 3CCEZ 3GCFA 3J81b 2F4OA 3S15I 2PM9A 3CCM1 2OTLZ 1K8A2 1Q862 4BBSI 3CCU1 1QF8A 3MONA 2DE7A 2KI7B 2LIYA 3D9XA 4MXUA 1M1K1 3CCQZ 1SFOI 3CCVZ 1VQ7Z 1K8A1 4MD8A 3CPWY 2JR6A 1JWHC 4RV9A 1VQKZ 1VQ5Z 3CXCY 1TWAI 1VQLZ 2I3CA 3JAMf 1RNIA 3HOZI 1Z02A 1VQO1 4AYBA 1K732 3FQMA 3M3YI 4EWCA 3S1MI 1PFTA 2E2HI 1JJ2Z 2IZ3A 4QTTA 1TFIA 3KIHA 3HOVI 4NOZA 3HOUI 3BG0B 5D1PA 1LQLA 3CC41 4A3KI 3CCUZ 1VLAA 2Q4ZA 1WW9A 3S1RI 5FLXb 5CM2M 4TNUA 1W2BZ 3I56Z 4RVGA 5AN9F 2E2JI 1KQSY 2O53A 3GTLI 3S17I 1YJ91 1NJI2 3VMGA 3QWUA 1I50I 1USPA 3CPWZ 3PO2I 4BBRI 2ZAEB 1VQN1 2J6AA 4NBCA 4E2ZA 3GKQA 1VQ81 5D1OA 3VB9A 4NBGA 1Q812 3CCJ1 2NVXI 1S7MA 1L1OC 2JUBA 3OW2Y 1VQ91 1M901 4E32A 1I3QI 1VQOZ 3S2DI 2OTL1 4NBBA 2R7ZI 1USPB 3J7A4 1P9NA 2NVQI 3CC71 3I07A 1Z01A 5D1OB 2GU2A 1YJW1 2RIQA 1YIT1 1VQK1 3S1QI 1VQNZ 3FQQA 4S1TA 1VQL1 5A2Qb 4RVHA 4NBHA 1X3ZA 1VQ8Z 2V8JA 3GTMS 3F3FC 3CCJZ 2QREB 1VQ9Z 1M1K2 4A3GI 2V8KA 4NFRA 4NB9A 3K7AI 5T6BA 4DK1A 2QR1B 2QEX1 3G711 1JJ2Y 4DQYB 2OTJ1 3HOYI 3TDHB 3M4OI 3CC7Z 3I561 3CMA1 2OZKA 1KC82 1W2BY 2Q51A 1YJWZ 1RO2A 2QLVB 1TWFI 4Y52I 3TE5B 3NH8A 1YITZ 5C3EI 3MZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM2 M;  2AKL A;  4NBF A;  3GTK I;  2E2J I;  2JNY A;  1ZB9 A;  3GTL I;  1Y1V S;  2VUM I;  3S17 I;  4NBA A;  3VMG A;  3RZD I;  1NUI A;  1I50 I;  1USP A;  1ZB8 A;  3PO2 I;  4BBR I;  4A3J I;  5IP7 I;  2J6A A;  4NBC A;  4A93 I;  4BY7 I;  1TWG I;  4QTU A;  3GTM I;  3HOW I;  3GKQ A;  3Q87 A;  3VB9 A;  4NBG A;  3ESW A;  2NVX I;  1L1O C;  2K5R A;  2HF1 A;  1RLY A;  3S2H I;  1I3Q I;  5FLM I;  2JA7 I;  2JA6 I;  3D6W A;  3S1N I;  2BJO A;  3S2D I;  2NVY I;  2P3Y A;  1TWH I;  1Y1W I;  4NB8 A;  3I4M I;  3H0G I;  4NBB A;  2R93 I;  2R7Z I;  4A3M I;  3H3V J;  1USP B;  4NBD A;  1DL6 A;  5C4J I;  4A3F I;  2NVQ I;  4X6A I;  1I6H I;  3I07 A;  2RBL A;  2NVT I;  3S14 I;  3GCF A;  2F4O A;  3S15 I;  3GTG I;  2KPI A;  4A3I I;  4A3D I;  1TWC I;  5C4X I;  1QYP A;  4Y7N I;  4BBS I;  3VMI A;  3S16 I;  4BXX I;  3RZO I;  3S1Q I;  2JA8 I;  4A3C I;  4A3L I;  2DE7 A;  4NBH A;  1X3W A;  1X3Z A;  3U50 C;  3GTM S;  2DE5 A;  1SFO I;  4A3B I;  1R9T I;  2YU9 I;  2B63 I;  4A3G I;  4NB9 A;  3K7A I;  2JR6 A;  1WCM I;  2E2I I;  4A3E I;  1TWA I;  5C44 I;  2F4M A;  4XX2 A;  3PO3 I;  3FKI I;  3CQZ I;  3VMH A;  3HOZ I;  1K83 I;  3HOY I;  3GTP I;  1YUA A;  3M4O I;  2JS4 A;  4NBE A;  3GTJ I;  3EER A;  2JA5 I;  2R92 I;  1N2F A;  4MH4 A;  1Y1V I;  3M3Y I;  3I4N I;  3S1M I;  1PFT A;  2E2H I;  3GTQ I;  4QTT A;  1TFI A;  2PK7 A;  4BY1 I;  3HOV I;  4NOZ A;  3LUS A;  3HOU I;  1LQL A;  3PO3 S;  4A3K I;  1ML8 A;  1TWF I;  1VLA A;  2DE6 A;  4Y52 I;  3GTO I;  1WW9 A;  3S1R I;  1RO4 A;  5IP9 I;  5C3E I;  3HOX I; 
#chains in the Genus database with same CATH topology
 2AKL A;  4NBF A;  2JNY A;  1YI2 1;  1KC8 1;  3CME 1;  1QXF A;  3G4S 1;  4A3J I;  5IP7 I;  2NAP A;  3JAM b;  4BY7 I;  1VQM 1;  3Q87 A;  5IT9 f;  2LFU A;  2QEX Z;  3EED A;  3ESW A;  3G71 Z;  2OTJ Z;  2K5R A;  4MRI A;  4E33 A;  2HF1 A;  3S2H I;  5FLM I;  2K3R A;  2JA6 I;  3CMA Z;  1YHQ 1;  1M90 2;  2P3Y A;  2QRC B;  4NB8 A;  3H0G I;  2R93 I;  4A3M I;  3H3V J;  2H85 A;  5C4J I;  5FLX f;  2YAD A;  4A3F I;  4X6A I;  4RVD A;  3NDJ A;  2VPZ A;  2RBL A;  4E2X A;  2NVT I;  2WB1 A;  3GTG I;  2KPI A;  4A3D I;  2JIO A;  1TWC I;  5C4X I;  2Y0S A;  1YI2 Z;  3CME Z;  2PMZ A;  3G4S Z;  3VMI A;  3P5J B;  4BXX I;  3RZO I;  4A3L I;  2RT9 A;  4DGL A;  4MON A;  1VQM Z;  2GTI A;  1K9M 2;  2RHB A;  2DE5 A;  2W03 A;  1R9T I;  1Q7Y 2;  2B63 I;  1VQ4 1;  1YHQ Z;  2E2I I;  4A3E I;  5C44 I;  1Q82 2;  3I55 Z;  4XX2 A;  3PO3 I;  3HKZ A;  1WII A;  4MD7 A;  1YUA A;  2JS4 A;  1K9M 1;  4NBE A;  4E2Y A;  3GTJ I;  4HGZ A;  3J80 f;  2R92 I;  4MH4 A;  1Y1V I;  3I4N I;  2W04 A;  2R6M A;  1Q7Y 1;  1VQP 1;  2PK7 A;  1KRL A;  1Q16 A;  3LUS A;  2VUG A;  3PO3 S;  2AYD A;  5A2Q f;  1Q82 1;  2RPR A;  5IP9 I;  3HOX I;  3GTK I;  1X0T A;  1Y1V S;  2VUM I;  2QA4 1;  4HGY A;  1NP6 A;  3J81 f;  4NBA A;  1ZB8 A;  2VPX A;  4A93 I;  5LL6 f;  1VQ6 1;  4CL1 A;  1VQ4 Z;  4QTU A;  3CC2 1;  4HH4 A;  2OOY B;  3IFU A;  1RLY A;  3NH5 A;  2JA7 I;  2QKD A;  3CCL 1;  3BG1 B;  3D6W A;  2QRD B;  2G2K A;  2NVY I;  1N8R 1;  1S72 1;  2EGT A;  1QVG Z;  3I4M I;  1VQP Z;  4NBD A;  3VTN A;  1YUK A;  3NFZ A;  1I6H I;  3NDI A;  3CCR 1;  3S14 I;  2O4H A;  1Q86 1;  3CD6 1;  4A3I I;  1QYP A;  2QA4 Z;  3MZK B;  4Y7N I;  1QVF Y;  3S16 I;  5IT9 b;  2JA8 I;  5T67 A;  4A3C I;  3I55 1;  1VQ6 Z;  4RS4 A;  1YIJ 1;  1X3W A;  3U50 C;  3CC2 Z;  2VF1 A;  3CCM Z;  4A3B I;  2M6N A;  3F3P C;  2YU9 I;  2HU9 A;  3CCS 1;  3CCL Z;  1WCM I;  2GTH A;  2F4M A;  1SIW A;  1S72 Z;  3FKI I;  3CQZ I;  2V8I A;  1Z03 A;  1K73 1;  3VMH A;  1K83 I;  3GTP I;  2IZ4 A;  4E31 A;  2JMO A;  1ZH1 A;  3KIF A;  3EER A;  2JA5 I;  1N2F A;  2JIM A;  1WZN A;  2JIQ A;  3CXC Z;  3CCR Z;  1FDO A;  1QVF Z;  3GTQ I;  3CD6 Z;  4NH1 C;  4BY1 I;  3G6E 1;  1ML8 A;  1YJN 1;  2DE6 A;  3GTO I;  3CCE 1;  1RO4 A;  1NJI 1;  2E9H A;  3IF8 A;  2VPW A;  2M48 A;  1YIJ Z;  1ZB9 A;  4E30 A;  1RO0 A;  5T64 A;  1KD1 2;  3RZD I;  1NUI A;  2WAQ A;  4RVF A;  3CC4 Z;  3IX0 A;  3CCS Z;  1TWG I;  1KQS Z;  2P28 A;  1Q81 1;  3GTM I;  3HOW I;  1Y8C A;  4MD9 A;  3J80 b;  1RQF A;  3CCQ 1;  3CCV 1;  1QVG Y;  1YJ9 Z;  1VQ7 1;  3T4N B;  1KD1 1;  3S1N I;  2BJO A;  3IR7 A;  1VQ5 1;  3D2L A;  1TWH I;  1Y1W I;  3OW2 Z;  3NH4 A;  1DL6 A;  4E2W A;  1N8R 2;  2E7Z A;  2OOX B;  3G6E Z;  1YJN Z;  3CCE Z;  3GCF A;  3J81 b;  2F4O A;  3S15 I;  2PM9 A;  3CCM 1;  2OTL Z;  1K8A 2;  1Q86 2;  4BBS I;  3CCU 1;  1QF8 A;  3MON A;  2DE7 A;  2KI7 B;  2JIP A;  2LIY A;  1AA6 A;  1FDI A;  3D9X A;  4MXU A;  1M1K 1;  3CCQ Z;  1SFO I;  3CCV Z;  1VQ7 Z;  1K8A 1;  4MD8 A;  3CPW Y;  2JR6 A;  1JWH C;  4RV9 A;  1VQK Z;  1VQ5 Z;  3CXC Y;  1TWA I;  1VQL Z;  2I3C A;  3JAM f;  1RNI A;  2IV2 X;  3HOZ I;  1Z02 A;  1VQO 1;  4AYB A;  1K73 2;  3FQM A;  3M3Y I;  4EWC A;  3S1M I;  1PFT A;  2E2H I;  1JJ2 Z;  2IZ3 A;  4QTT A;  1TFI A;  3KIH A;  3HOV I;  4NOZ A;  3HOU I;  3BG0 B;  5D1P A;  3CC4 1;  1LQL A;  3CCU Z;  4A3K I;  1VLA A;  2Q4Z A;  1WW9 A;  3S1R I;  5FLX b;  5CM2 M;  4TNU A;  1W2B Z;  3I56 Z;  4RVG A;  5AN9 F;  2E2J I;  1KQS Y;  2O53 A;  3GTL I;  3S17 I;  1YJ9 1;  1NJI 2;  3VMG A;  3QWU A;  1I50 I;  1USP A;  3CPW Z;  3PO2 I;  2VPY A;  4BBR I;  2ZAE B;  1VQN 1;  2J6A A;  4NBC A;  2V3V A;  4E2Z A;  3GKQ A;  1VQ8 1;  5D1O A;  3VB9 A;  4NBG A;  1Q81 2;  3CCJ 1;  2NVX I;  1S7M A;  1L1O C;  2JUB A;  3OW2 Y;  1VQ9 1;  1M90 1;  4E32 A;  1I3Q I;  1VQO Z;  3S2D I;  2OTL 1;  4NBB A;  2R7Z I;  1USP B;  3J7A 4;  1P9N A;  2NVQ I;  3CC7 1;  3I07 A;  1Z01 A;  5D1O B;  2LEX A;  2GU2 A;  1YJW 1;  2RIQ A;  1YIT 1;  1VQK 1;  3S1Q I;  1VQN Z;  3FQQ A;  4S1T A;  1VQL 1;  5A2Q b;  4RVH A;  4NBH A;  1X3Z A;  1VQ8 Z;  2V8J A;  3GTM S;  3F3F C;  3CCJ Z;  1WJ2 A;  2QRE B;  1VQ9 Z;  1M1K 2;  4A3G I;  2V8K A;  4NFR A;  4NB9 A;  3K7A I;  5T6B A;  4DK1 A;  2QR1 B;  2QEX 1;  3G71 1;  1JJ2 Y;  4DQY B;  2OTJ 1;  3HOY I;  3TDH B;  3M4O I;  3CC7 Z;  3I56 1;  3CMA 1;  2OZK A;  1KC8 2;  1W2B Y;  2JIR A;  2Q51 A;  1YJW Z;  1RO2 A;  2QLV B;  1TWF I;  4Y52 I;  3TE5 B;  3NH8 A;  1YIT Z;  2V45 A;  5C3E I;  3MZL B; 
#chains in the Genus database with same CATH homology
 2AKL A;  4NBF A;  2JNY A;  1YI2 1;  1KC8 1;  3CME 1;  3G4S 1;  4A3J I;  5IP7 I;  3JAM b;  4BY7 I;  1VQM 1;  3Q87 A;  5IT9 f;  2LFU A;  2QEX Z;  3EED A;  3ESW A;  3G71 Z;  2OTJ Z;  2K5R A;  4MRI A;  4E33 A;  2HF1 A;  3S2H I;  5FLM I;  2K3R A;  2JA6 I;  3CMA Z;  1YHQ 1;  1M90 2;  2P3Y A;  2QRC B;  4NB8 A;  3H0G I;  2R93 I;  4A3M I;  3H3V J;  2H85 A;  5C4J I;  5FLX f;  2YAD A;  4A3F I;  4X6A I;  4RVD A;  3NDJ A;  2RBL A;  4E2X A;  2NVT I;  2WB1 A;  3GTG I;  2KPI A;  4A3D I;  1TWC I;  5C4X I;  2Y0S A;  1YI2 Z;  3CME Z;  2PMZ A;  3G4S Z;  3VMI A;  3P5J B;  4BXX I;  3RZO I;  4A3L I;  2RT9 A;  4DGL A;  1VQM Z;  4MON A;  2GTI A;  1K9M 2;  2RHB A;  2DE5 A;  2W03 A;  1R9T I;  1Q7Y 2;  2B63 I;  1VQ4 1;  1YHQ Z;  2E2I I;  4A3E I;  5C44 I;  1Q82 2;  3I55 Z;  4XX2 A;  3PO3 I;  3HKZ A;  1WII A;  4MD7 A;  1YUA A;  2JS4 A;  1K9M 1;  4NBE A;  4E2Y A;  3GTJ I;  4HGZ A;  3J80 f;  2R92 I;  4MH4 A;  1Y1V I;  3I4N I;  2W04 A;  2R6M A;  1Q7Y 1;  1VQP 1;  2PK7 A;  1KRL A;  3LUS A;  2VUG A;  3PO3 S;  5A2Q f;  1Q82 1;  2RPR A;  5IP9 I;  3HOX I;  3GTK I;  1X0T A;  1Y1V S;  2VUM I;  2QA4 1;  4HGY A;  1NP6 A;  3J81 f;  4NBA A;  1ZB8 A;  4A93 I;  5LL6 f;  1VQ6 1;  4CL1 A;  1VQ4 Z;  4QTU A;  3CC2 1;  4HH4 A;  2OOY B;  3IFU A;  1RLY A;  3NH5 A;  2JA7 I;  2QKD A;  3CCL 1;  3BG1 B;  3D6W A;  2QRD B;  2G2K A;  2NVY I;  1N8R 1;  1S72 1;  2EGT A;  1QVG Z;  3I4M I;  1VQP Z;  4NBD A;  3VTN A;  1YUK A;  3NFZ A;  1I6H I;  3NDI A;  3CCR 1;  3S14 I;  2O4H A;  1Q86 1;  3CD6 1;  4A3I I;  1QYP A;  2QA4 Z;  3MZK B;  4Y7N I;  1QVF Y;  3S16 I;  5IT9 b;  2JA8 I;  5T67 A;  4A3C I;  3I55 1;  1VQ6 Z;  4RS4 A;  1YIJ 1;  1X3W A;  3U50 C;  3CC2 Z;  2VF1 A;  3CCM Z;  4A3B I;  2M6N A;  3F3P C;  2YU9 I;  2HU9 A;  3CCS 1;  3CCL Z;  1WCM I;  2GTH A;  2F4M A;  1S72 Z;  3FKI I;  3CQZ I;  2V8I A;  1Z03 A;  1K73 1;  3VMH A;  1K83 I;  3GTP I;  2IZ4 A;  4E31 A;  2JMO A;  1ZH1 A;  3KIF A;  3EER A;  2JA5 I;  1N2F A;  3CXC Z;  3CCR Z;  1QVF Z;  3GTQ I;  3CD6 Z;  4NH1 C;  4BY1 I;  3G6E 1;  1ML8 A;  1YJN 1;  2DE6 A;  3GTO I;  3CCE 1;  1RO4 A;  1NJI 1;  2E9H A;  3IF8 A;  2M48 A;  1YIJ Z;  1ZB9 A;  4E30 A;  1RO0 A;  5T64 A;  1KD1 2;  3RZD I;  1NUI A;  2WAQ A;  4RVF A;  3CC4 Z;  3IX0 A;  3CCS Z;  1TWG I;  1KQS Z;  2P28 A;  1Q81 1;  3GTM I;  3HOW I;  4MD9 A;  3J80 b;  1RQF A;  3CCQ 1;  3CCV 1;  1QVG Y;  1YJ9 Z;  1VQ7 1;  3T4N B;  1KD1 1;  3S1N I;  2BJO A;  1VQ5 1;  1TWH I;  1Y1W I;  3OW2 Z;  3NH4 A;  1DL6 A;  4E2W A;  1N8R 2;  2OOX B;  3G6E Z;  1YJN Z;  3CCE Z;  3GCF A;  3J81 b;  2F4O A;  3S15 I;  2PM9 A;  3CCM 1;  2OTL Z;  1K8A 2;  1Q86 2;  4BBS I;  3CCU 1;  1QF8 A;  3MON A;  2DE7 A;  2KI7 B;  2LIY A;  3D9X A;  4MXU A;  1M1K 1;  3CCQ Z;  1SFO I;  3CCV Z;  1VQ7 Z;  1K8A 1;  4MD8 A;  3CPW Y;  2JR6 A;  1JWH C;  4RV9 A;  1VQK Z;  1VQ5 Z;  3CXC Y;  1TWA I;  1VQL Z;  2I3C A;  3JAM f;  1RNI A;  3HOZ I;  1Z02 A;  1VQO 1;  4AYB A;  1K73 2;  3FQM A;  3M3Y I;  4EWC A;  3S1M I;  1PFT A;  2E2H I;  1JJ2 Z;  2IZ3 A;  4QTT A;  1TFI A;  3KIH A;  3HOV I;  4NOZ A;  3HOU I;  3BG0 B;  5D1P A;  1LQL A;  3CC4 1;  4A3K I;  3CCU Z;  1VLA A;  2Q4Z A;  1WW9 A;  3S1R I;  5FLX b;  5CM2 M;  4TNU A;  1W2B Z;  3I56 Z;  4RVG A;  5AN9 F;  2E2J I;  1KQS Y;  2O53 A;  3GTL I;  3S17 I;  1YJ9 1;  1NJI 2;  3VMG A;  3QWU A;  1I50 I;  1USP A;  3CPW Z;  3PO2 I;  4BBR I;  2ZAE B;  1VQN 1;  2J6A A;  4NBC A;  4E2Z A;  3GKQ A;  1VQ8 1;  5D1O A;  3VB9 A;  4NBG A;  1Q81 2;  3CCJ 1;  2NVX I;  1S7M A;  1L1O C;  2JUB A;  3OW2 Y;  1VQ9 1;  1M90 1;  4E32 A;  1I3Q I;  1VQO Z;  3S2D I;  2OTL 1;  4NBB A;  2R7Z I;  1USP B;  3J7A 4;  1P9N A;  2NVQ I;  3CC7 1;  3I07 A;  1Z01 A;  5D1O B;  2GU2 A;  1YJW 1;  2RIQ A;  1YIT 1;  1VQK 1;  3S1Q I;  1VQN Z;  3FQQ A;  4S1T A;  1VQL 1;  5A2Q b;  4RVH A;  4NBH A;  1X3Z A;  1VQ8 Z;  2V8J A;  3GTM S;  3F3F C;  3CCJ Z;  2QRE B;  1VQ9 Z;  1M1K 2;  4A3G I;  2V8K A;  4NFR A;  4NB9 A;  3K7A I;  5T6B A;  4DK1 A;  2QR1 B;  2QEX 1;  3G71 1;  1JJ2 Y;  4DQY B;  2OTJ 1;  3HOY I;  3TDH B;  3M4O I;  3CC7 Z;  3I56 1;  3CMA 1;  2OZK A;  1KC8 2;  1W2B Y;  2Q51 A;  1YJW Z;  1RO2 A;  2QLV B;  1TWF I;  4Y52 I;  3TE5 B;  3NH8 A;  1YIT Z;  5C3E I;  3MZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...