1Y1VI

Refined rna polymerase ii-tfiis complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI02
3S17I 1N2FA 4A3FI 4NBBA 3RZOI 4A3JI 4XX2A 2BJOA 2E2JI 1PFTA 2NVTI 2DE6A 1TWAI 4MH4A 4NB8A 1TWFI 2DE5A 4A3KI 4NBHA 3I07A 3S14I 2JA5I 3I4NI 5FLMI 1NUIA 1TWCI 3EERA 3I4MI 3H0GI 3ESWA 1DL6A 4BXXI 4A3EI 2R7ZI 1ML8A 3S1MI 1RLYA 2B63I 1WW9A 2NVQI 1Y1VS 5IP9I 3Q87A 1I50I 1R9TI 1ZB9A 4BY7I 4A93I 2K5RA 3GCFA 3VMIA 2F4MA 5C4JI 3VB9A 2NVXI 3GTPI 4NOZA 3CQZI 4NBDA 2JA7I 2HF1A 5IP7I 3HOUI 2DE7A 1K83I 3PO3S 2JA6I 3VMHA 1I3QI 1LQLA 4NBCA 2JNYA 4BBRI 1Y1WI 3S1NI 1TWHI 1YUAA 2J6AA 1Y1VI 3LUSA 4NBAA 2E2HI 3GTMS 3S15I 2PK7A 3GTKI 4NBEA 4NBGA 4BBSI 2VUMI 3U50C 2KPIA 2AKLA 4QTTA 3RZDI 1SFOI 4Y7NI 3GTJI 4A3LI 2E2II 3GKQA 1RO4A 1I6HI 3H3VJ 3GTQI 3GTOI 3S16I 2RBLA 1USPB 3D6WA 2F4OA 2JS4A 5CM2M 5C3EI 1WCMI 4X6AI 1L1OC 2JA8I 3M4OI 3GTGI 3HOYI 1TWGI 4BY1I 4A3II 5C4XI 2NVYI 2P3YA 3S1QI 3S2DI 3HOXI 4NBFA 4QTUA 3GTLI 1X3WA 3HOVI 4Y52I 3S1RI 1USPA 4A3CI 1X3ZA 4A3MI 1TFIA 2JR6A 3K7AI 1VLAA 4NB9A 1QYPA 3PO3I 3PO2I 4A3DI 1ZB8A 2R92I 3VMGA 3GTMI 4A3BI 3HOWI 3HOZI 3FKII 3M3YI 3S2HI 4A3GI 2YU9I 5C44I 2R93I
chains in the Genus database with same CATH superfamily
2LEXA 3CXCY 3CC4Z 1YIJ1 1JJ2Z 1RO2A 4A3FI 3CC71 4NBBA 2OTLZ 3RZOI 2RIQA 1PFTA 2NVTI 1S72Z 2DE5A 4A3KI 3CCVZ 3S14I 3I4NI 3CCJ1 1NUIA 2QEX1 1VQ9Z 4BXXI 1ML8A 1VQM1 4S1TA 1P9NA 1X0TA 1Q861 1VQ41 3I55Z 1Q811 1QVFZ 1YI2Z 3GCFA 2W04A 3GTPI 3CME1 5D1PA 2Q51A 4DK1A 1AA6A 4EWCA 3CC41 3T4NB 1JJ2Y 4MXUA 2OTL1 3FQMA 3S1NI 3D2LA 1YUAA 2J6AA 1VQ61 1Y1VI 2JIOA 1YHQ1 1VQ71 2Q4ZA 1S7MA 1Y8CA 1SFOI 2JIMA 4E2YA 1VQL1 4MD7A 3KIHA 3KIFA 2VPZA 3CCE1 2RBLA 3CCM1 3J7A4 3D6WA 1WCMI 4RVFA 3IFUA 1L1OC 4DQYB 3M4OI 3J81f 3GTGI 3HOYI 3I551 1K8A1 5C4XI 1YI21 4DGLA 2V8JA 2RPRA 5A2Qf 1M901 3HOXI 4NBFA 4QTUA 3JAMf 1FDIA 1QVGZ 3J80f 3NDJA 2M48A 1YIJZ 3CC7Z 3PO3I 1K9M2 1SIWA 4AYBA 1YJN1 3GTMI 2V45A 3JAMb 4E33A 3HOZI 2WAQA 2E7ZA 2OZKA 1K732 4MD8A 4E2WA 3IX0A 3VTNA 5C44I 2VPXA 3CCJZ 4RS4A 2R93I 1N8R1 2QEXZ 1RNIA 1N2FA 2V3VA 2YADA 1VQMZ 1TWAI 2V8KA 4NB8A 2EGTA 1VQN1 4NBHA 5FLMI 1FDOA 1TWCI 3EERA 1M1K2 5FLXb 3CMEZ 4A3EI 4E2XA 1QVGY 2B63I 1WZNA 5IP9I 1VQOZ 1VQ6Z 5T64A 4A93I 4BY7I 2RHBA 1RQFA 1YHQZ 1NJI2 1VQ7Z 1NP6A 2JA7I 2HF1A 1QXFA 5IP7I 3F3FC 4E31A 1VQLZ 1K83I 2AYDA 3MONA 4NH1C 3PO3S 2JA6I 1Y1WI 3GTMS 2PK7A 3CCEZ 2JIRA 4E2ZA 3OW2Z 2OOYB 3CCMZ 3QWUA 1W2BZ 1Q7Y2 2KPIA 4Y7NI 3CPWZ 3GTJI 5IT9f 2KI7B 4A3LI 2E2II 3GKQA 3CC21 1Z01A 1RO4A 2QLVB 3HKZA 3GTOI 2JS4A 5CM2M 4X6AI 2JA8I 4HGYA 4HH4A 1QF8A 3NFZA 1VQO1 5IT9b 2NVYI 2JIQA 1YJNZ 2OOXB 3MZKB 3F3PC 1K731 3GTLI 3CCL1 3G71Z 3G6E1 1KQSZ 2OTJZ 1TFIA 3K7AI 1YJW1 4RVDA 3OW2Y 1ZB8A 2R92I 4A3BI 1W2BY 1YUKA 2QRCB 5T6BA 1VQNZ 4RV9A 3TE5B 3M3YI 4A3GI 3CPWY 3CCS1 2VF1A 3IR7A 1M1K1 5AN9F 4A3JI 2BJOA 3D9XA 4MH4A 3J81b 1TWFI 1KD12 3I07A 2JA5I 2QKDA 2H85A 5A2Qb 1NJI1 3I56Z 3I4MI 3H0GI 1DL6A 3CD6Z 2Y0SA 3FQQA 3NH5A 2R7ZI 3S1MI 3G711 3J80b 1KRLA 2OTJ1 2NVQI 1Y1VS 1KQSY 1JWHC 3Q87A 1I50I 2P28A 2IV2X 2VPWA 1R9TI 3BG1B 2GTHA 3MZLB 2K5RA 2QR1B 2F4MA 5C4JI 3VB9A 2NVXI 4NOZA 1Q7Y1 3BG0B 3CQZI 2JUBA 4NBDA 1VQPZ 2QA41 1WJ2A 3VMHA 1I3QI 4BBRI 2JNYA 1WIIA 2GU2A 3CC2Z 3LUSA 2E2HI 1VQ51 3GTKI 2LIYA 4NBEA 4RVHA 2IZ3A 1ZH1A 2VPYA 3U50C 2VUGA 3RZDI 5D1OB 2G2KA 3I561 3CMAZ 1I6HI 2WB1A 3CD61 3H3VJ 3GTQI 4E32A 3CCLZ 1Z03A 3NDIA 3G6EZ 3CCU1 1Q822 2V8IA 1TWGI 1KC82 4A3II 5D1OA 1YJWZ 2P3YA 5LL6f 4Y52I 1X3WA 1VQP1 2LFUA 4A3MI 3CCSZ 4NB9A 1QYPA 3PO2I 4A3DI 2O4HA 3VMGA 1N8R2 2QRDB 1KD11 4MRIA 2YU9I 1K9M1 3CMA1 3S17I 3NH8A 4XX2A 2E2JI 1YJ9Z 2DE6A 2W03A 3IF8A 1VQKZ 2IZ4A 4RVGA 2PMZA 1VQ8Z 3ESWA 4MD9A 1RLYA 1S721 1RO0A 1WW9A 2QA4Z 4CL1A 3CCV1 2E9HA 1ZB9A 1Z02A 2HU9A 3VMIA 1VQ5Z 1VQ91 2JIPA 2NAPA 3CCQZ 3HOUI 3CCRZ 2DE7A 2PM9A 3TDHB 5T67A 1YITZ 1LQLA 4NBCA 3G4SZ 1Q862 1TWHI 4NBAA 3S15I 1Q812 4E30A 1QVFY 2GTIA 1YJ91 1Q821 4MONA 4NBGA 1VQK1 4BBSI 2VUMI 3CCUZ 2M6NA 4NFRA 1KC81 2AKLA 2RT9A 4QTTA 3CXCZ 1VQ81 3S16I 1USPB 2F4OA 5C3EI 1Q16A 4BY1I 2JMOA 2QREB 2I3CA 2O53A 3CCQ1 3S1QI 3P5JB 3S2DI 4TNUA 3HOVI 2R6MA 3EEDA 3S1RI 1USPA 5FLXf 4A3CI 1X3ZA 3CCR1 1YIT1 2K3RA 2JR6A 1VQ4Z 3G4S1 1VLAA 1K8A2 2ZAEB 3HOWI 4HGZA 3FKII 1M902 3S2HI 3NH4A
chains in the Genus database with same CATH topology
3CXCY 3CC4Z 1YIJ1 1JJ2Z 1RO2A 4A3FI 3CC71 4NBBA 2OTLZ 3RZOI 2RIQA 1PFTA 2NVTI 1S72Z 2DE5A 4A3KI 3CCVZ 3S14I 3I4NI 3CCJ1 1NUIA 2QEX1 1VQ9Z 4BXXI 1ML8A 1VQM1 4S1TA 1P9NA 1X0TA 1Q861 1VQ41 3I55Z 1Q811 1QVFZ 1YI2Z 3GCFA 2W04A 3GTPI 3CME1 5D1PA 2Q51A 4DK1A 4EWCA 3CC41 3T4NB 1JJ2Y 4MXUA 2OTL1 3FQMA 3S1NI 1VQ61 1YUAA 2J6AA 1Y1VI 1YHQ1 1VQ71 2Q4ZA 1S7MA 1SFOI 1VQL1 4E2YA 4MD7A 3KIHA 3KIFA 3CCE1 2RBLA 3CCM1 3J7A4 3D6WA 1WCMI 4RVFA 3IFUA 1L1OC 4DQYB 3M4OI 3J81f 3GTGI 3HOYI 3I551 1K8A1 5C4XI 1YI21 4DGLA 2V8JA 2RPRA 5A2Qf 1M901 3HOXI 4NBFA 4QTUA 3JAMf 1QVGZ 3J80f 3NDJA 2M48A 1YIJZ 3CC7Z 3PO3I 1K9M2 4AYBA 1YJN1 3GTMI 3JAMb 4E33A 3HOZI 2WAQA 2OZKA 1K732 4MD8A 4E2WA 3IX0A 3VTNA 5C44I 3CCJZ 2R93I 4RS4A 1N8R1 2QEXZ 1RNIA 1N2FA 2YADA 1VQMZ 1TWAI 2V8KA 4NB8A 2EGTA 1VQN1 4NBHA 5FLMI 1TWCI 3EERA 1M1K2 5FLXb 3CMEZ 4A3EI 4E2XA 1QVGY 2B63I 5IP9I 1VQOZ 1VQ6Z 5T64A 4A93I 4BY7I 2RHBA 1RQFA 1YHQZ 1NJI2 1VQ7Z 1NP6A 2JA7I 2HF1A 5IP7I 3F3FC 4E31A 1VQLZ 1K83I 3MONA 4NH1C 3PO3S 2JA6I 1Y1WI 3GTMS 2PK7A 3CCEZ 4E2ZA 3OW2Z 2OOYB 3CCMZ 3QWUA 1W2BZ 1Q7Y2 2KPIA 4Y7NI 3CPWZ 3GTJI 5IT9f 2KI7B 4A3LI 2E2II 3GKQA 3CC21 1Z01A 1RO4A 2QLVB 3HKZA 3GTOI 2JS4A 5CM2M 4X6AI 2JA8I 4HGYA 4HH4A 1QF8A 3NFZA 1VQO1 5IT9b 2NVYI 1YJNZ 2OOXB 3MZKB 3F3PC 1K731 3GTLI 3CCL1 3G71Z 3G6E1 1KQSZ 2OTJZ 1TFIA 3K7AI 1YJW1 4RVDA 3OW2Y 1ZB8A 2R92I 4A3BI 1W2BY 1YUKA 2QRCB 5T6BA 1VQNZ 4RV9A 3TE5B 3M3YI 4A3GI 3CPWY 3CCS1 2VF1A 1M1K1 5AN9F 4A3JI 2BJOA 3D9XA 4MH4A 3J81b 1TWFI 1KD12 3I07A 2JA5I 2QKDA 2H85A 5A2Qb 1NJI1 3I56Z 3I4MI 3H0GI 1DL6A 3CD6Z 2Y0SA 3FQQA 3NH5A 2R7ZI 3S1MI 3G711 3J80b 1KRLA 2OTJ1 2NVQI 1Y1VS 1KQSY 1JWHC 3Q87A 1I50I 2P28A 1R9TI 3BG1B 2GTHA 3MZLB 2K5RA 2QR1B 2F4MA 5C4JI 3VB9A 2NVXI 4NOZA 1Q7Y1 3BG0B 3CQZI 2JUBA 4NBDA 1VQPZ 2QA41 3VMHA 1I3QI 4BBRI 2JNYA 1WIIA 2GU2A 3CC2Z 3LUSA 2E2HI 1VQ51 3GTKI 2LIYA 4NBEA 4RVHA 2IZ3A 1ZH1A 3U50C 2VUGA 3RZDI 5D1OB 2G2KA 3I561 3CMAZ 1I6HI 2WB1A 3CD61 3H3VJ 3GTQI 4E32A 3CCLZ 1Z03A 3NDIA 3G6EZ 3CCU1 1Q822 2V8IA 1TWGI 1KC82 4A3II 5D1OA 1YJWZ 2P3YA 5LL6f 4Y52I 1X3WA 1VQP1 2LFUA 4A3MI 3CCSZ 4NB9A 1QYPA 3PO2I 4A3DI 2O4HA 3VMGA 1N8R2 2QRDB 1KD11 4MRIA 2YU9I 1K9M1 3CMA1 3S17I 3NH8A 4XX2A 2E2JI 1YJ9Z 2DE6A 2W03A 3IF8A 1VQKZ 2IZ4A 4RVGA 2PMZA 1VQ8Z 3ESWA 4MD9A 1RLYA 1S721 1RO0A 1WW9A 2QA4Z 4CL1A 3CCV1 2E9HA 1ZB9A 1Z02A 2HU9A 3VMIA 1VQ5Z 1VQ91 3CCQZ 3HOUI 2DE7A 3CCRZ 2PM9A 3TDHB 5T67A 1YITZ 1LQLA 4NBCA 3G4SZ 1Q862 1TWHI 4NBAA 3S15I 1Q812 4E30A 1QVFY 2GTIA 1YJ91 1Q821 4MONA 4NBGA 1VQK1 4BBSI 2VUMI 3CCUZ 2M6NA 4NFRA 1KC81 2AKLA 2RT9A 4QTTA 3CXCZ 1VQ81 3S16I 1USPB 2F4OA 5C3EI 4BY1I 2JMOA 2QREB 2I3CA 2O53A 3CCQ1 3S1QI 3P5JB 3S2DI 4TNUA 3HOVI 2R6MA 3EEDA 3S1RI 1USPA 5FLXf 4A3CI 1X3ZA 3CCR1 1YIT1 2K3RA 2JR6A 1VQ4Z 3G4S1 1VLAA 1K8A2 2ZAEB 3HOWI 4HGZA 3FKII 1M902 3S2HI 3NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 I;  1N2F A;  4A3F I;  4NBB A;  3RZO I;  4A3J I;  4XX2 A;  2BJO A;  2E2J I;  1PFT A;  2NVT I;  2DE6 A;  1TWA I;  4MH4 A;  4NB8 A;  1TWF I;  2DE5 A;  4A3K I;  4NBH A;  3I07 A;  3S14 I;  2JA5 I;  3I4N I;  5FLM I;  1NUI A;  1TWC I;  3EER A;  3I4M I;  3H0G I;  3ESW A;  1DL6 A;  4BXX I;  4A3E I;  2R7Z I;  1ML8 A;  3S1M I;  1RLY A;  2B63 I;  1WW9 A;  2NVQ I;  1Y1V S;  5IP9 I;  3Q87 A;  1I50 I;  1R9T I;  1ZB9 A;  4BY7 I;  4A93 I;  2K5R A;  3GCF A;  3VMI A;  2F4M A;  5C4J I;  3VB9 A;  2NVX I;  3GTP I;  4NOZ A;  3CQZ I;  4NBD A;  2JA7 I;  2HF1 A;  5IP7 I;  3HOU I;  2DE7 A;  1K83 I;  3PO3 S;  2JA6 I;  3VMH A;  1I3Q I;  1LQL A;  4NBC A;  2JNY A;  4BBR I;  1Y1W I;  3S1N I;  1TWH I;  1YUA A;  2J6A A;  1Y1V I;  3LUS A;  4NBA A;  2E2H I;  3GTM S;  3S15 I;  2PK7 A;  3GTK I;  4NBE A;  4NBG A;  4BBS I;  2VUM I;  3U50 C;  2KPI A;  2AKL A;  4QTT A;  3RZD I;  1SFO I;  4Y7N I;  3GTJ I;  4A3L I;  2E2I I;  3GKQ A;  1RO4 A;  1I6H I;  3H3V J;  3GTQ I;  3GTO I;  3S16 I;  2RBL A;  1USP B;  3D6W A;  2F4O A;  2JS4 A;  5CM2 M;  5C3E I;  1WCM I;  4X6A I;  1L1O C;  2JA8 I;  3M4O I;  3GTG I;  3HOY I;  1TWG I;  4BY1 I;  4A3I I;  5C4X I;  2NVY I;  2P3Y A;  3S1Q I;  3S2D I;  3HOX I;  4NBF A;  4QTU A;  3GTL I;  1X3W A;  3HOV I;  4Y52 I;  3S1R I;  1USP A;  4A3C I;  1X3Z A;  4A3M I;  1TFI A;  2JR6 A;  3K7A I;  1VLA A;  4NB9 A;  1QYP A;  3PO3 I;  3PO2 I;  4A3D I;  1ZB8 A;  2R92 I;  3VMG A;  3GTM I;  4A3B I;  3HOW I;  3HOZ I;  3FKI I;  3M3Y I;  3S2H I;  4A3G I;  2YU9 I;  5C44 I;  2R93 I; 
#chains in the Genus database with same CATH topology
 2LEX A;  3CXC Y;  3CC4 Z;  1YIJ 1;  1JJ2 Z;  1RO2 A;  4A3F I;  3CC7 1;  4NBB A;  2OTL Z;  3RZO I;  2RIQ A;  1PFT A;  2NVT I;  1S72 Z;  2DE5 A;  4A3K I;  3CCV Z;  3S14 I;  3I4N I;  3CCJ 1;  1NUI A;  2QEX 1;  1VQ9 Z;  4BXX I;  1ML8 A;  1VQM 1;  4S1T A;  1P9N A;  1X0T A;  1Q86 1;  1VQ4 1;  3I55 Z;  1Q81 1;  1QVF Z;  1YI2 Z;  3GCF A;  2W04 A;  3GTP I;  3CME 1;  5D1P A;  2Q51 A;  4DK1 A;  1AA6 A;  4EWC A;  3CC4 1;  3T4N B;  1JJ2 Y;  4MXU A;  2OTL 1;  3FQM A;  3S1N I;  3D2L A;  1YUA A;  2J6A A;  1VQ6 1;  1Y1V I;  2JIO A;  1YHQ 1;  1VQ7 1;  2Q4Z A;  1S7M A;  1Y8C A;  1SFO I;  2JIM A;  4E2Y A;  1VQL 1;  4MD7 A;  3KIH A;  3KIF A;  2VPZ A;  3CCE 1;  2RBL A;  3CCM 1;  3J7A 4;  3D6W A;  1WCM I;  4RVF A;  3IFU A;  1L1O C;  4DQY B;  3M4O I;  3J81 f;  3GTG I;  3HOY I;  3I55 1;  1K8A 1;  5C4X I;  1YI2 1;  4DGL A;  2V8J A;  2RPR A;  5A2Q f;  1M90 1;  3HOX I;  4NBF A;  4QTU A;  3JAM f;  1FDI A;  1QVG Z;  3J80 f;  3NDJ A;  2M48 A;  1YIJ Z;  3CC7 Z;  3PO3 I;  1K9M 2;  1SIW A;  4AYB A;  1YJN 1;  3GTM I;  2V45 A;  3JAM b;  4E33 A;  3HOZ I;  2WAQ A;  2E7Z A;  2OZK A;  1K73 2;  4MD8 A;  4E2W A;  3IX0 A;  3VTN A;  5C44 I;  2VPX A;  3CCJ Z;  4RS4 A;  2R93 I;  1N8R 1;  2QEX Z;  1RNI A;  1N2F A;  2V3V A;  2YAD A;  1VQM Z;  1TWA I;  2V8K A;  4NB8 A;  2EGT A;  1VQN 1;  4NBH A;  5FLM I;  1FDO A;  1TWC I;  3EER A;  1M1K 2;  5FLX b;  3CME Z;  4A3E I;  4E2X A;  1QVG Y;  2B63 I;  1WZN A;  5IP9 I;  1VQO Z;  1VQ6 Z;  5T64 A;  4A93 I;  4BY7 I;  2RHB A;  1RQF A;  1YHQ Z;  1NJI 2;  1VQ7 Z;  1NP6 A;  2JA7 I;  2HF1 A;  1QXF A;  5IP7 I;  3F3F C;  4E31 A;  1VQL Z;  1K83 I;  2AYD A;  3MON A;  4NH1 C;  3PO3 S;  2JA6 I;  1Y1W I;  3GTM S;  2PK7 A;  3CCE Z;  2JIR A;  4E2Z A;  3OW2 Z;  2OOY B;  3CCM Z;  3QWU A;  1W2B Z;  1Q7Y 2;  2KPI A;  4Y7N I;  3CPW Z;  3GTJ I;  5IT9 f;  2KI7 B;  4A3L I;  2E2I I;  3GKQ A;  3CC2 1;  1Z01 A;  1RO4 A;  2QLV B;  3HKZ A;  3GTO I;  2JS4 A;  5CM2 M;  4X6A I;  2JA8 I;  4HGY A;  4HH4 A;  1QF8 A;  3NFZ A;  1VQO 1;  5IT9 b;  2NVY I;  2JIQ A;  1YJN Z;  2OOX B;  3MZK B;  3F3P C;  1K73 1;  3GTL I;  3CCL 1;  3G71 Z;  3G6E 1;  1KQS Z;  2OTJ Z;  1TFI A;  3K7A I;  1YJW 1;  4RVD A;  3OW2 Y;  1ZB8 A;  2R92 I;  4A3B I;  1W2B Y;  1YUK A;  2QRC B;  5T6B A;  1VQN Z;  4RV9 A;  3TE5 B;  3M3Y I;  4A3G I;  3CPW Y;  3CCS 1;  2VF1 A;  3IR7 A;  1M1K 1;  5AN9 F;  4A3J I;  2BJO A;  3D9X A;  4MH4 A;  3J81 b;  1TWF I;  1KD1 2;  3I07 A;  2JA5 I;  2QKD A;  2H85 A;  5A2Q b;  1NJI 1;  3I56 Z;  3I4M I;  3H0G I;  1DL6 A;  3CD6 Z;  2Y0S A;  3FQQ A;  3NH5 A;  2R7Z I;  3S1M I;  3G71 1;  3J80 b;  1KRL A;  2OTJ 1;  2NVQ I;  1Y1V S;  1KQS Y;  1JWH C;  3Q87 A;  1I50 I;  2P28 A;  2IV2 X;  2VPW A;  1R9T I;  3BG1 B;  2GTH A;  3MZL B;  2K5R A;  2QR1 B;  2F4M A;  5C4J I;  3VB9 A;  2NVX I;  4NOZ A;  1Q7Y 1;  3BG0 B;  3CQZ I;  2JUB A;  4NBD A;  1VQP Z;  2QA4 1;  1WJ2 A;  3VMH A;  1I3Q I;  4BBR I;  2JNY A;  1WII A;  2GU2 A;  3CC2 Z;  3LUS A;  2E2H I;  1VQ5 1;  3GTK I;  2LIY A;  4NBE A;  4RVH A;  2IZ3 A;  1ZH1 A;  2VPY A;  3U50 C;  2VUG A;  3RZD I;  5D1O B;  2G2K A;  3I56 1;  3CMA Z;  1I6H I;  2WB1 A;  3CD6 1;  3H3V J;  3GTQ I;  4E32 A;  3CCL Z;  1Z03 A;  3NDI A;  3G6E Z;  3CCU 1;  1Q82 2;  2V8I A;  1TWG I;  1KC8 2;  4A3I I;  5D1O A;  1YJW Z;  2P3Y A;  5LL6 f;  4Y52 I;  1X3W A;  1VQP 1;  2LFU A;  4A3M I;  3CCS Z;  4NB9 A;  1QYP A;  3PO2 I;  4A3D I;  2O4H A;  3VMG A;  1N8R 2;  2QRD B;  1KD1 1;  4MRI A;  2YU9 I;  1K9M 1;  3CMA 1;  3S17 I;  3NH8 A;  4XX2 A;  2E2J I;  1YJ9 Z;  2DE6 A;  2W03 A;  3IF8 A;  1VQK Z;  2IZ4 A;  4RVG A;  2PMZ A;  1VQ8 Z;  3ESW A;  4MD9 A;  1RLY A;  1S72 1;  1RO0 A;  1WW9 A;  2QA4 Z;  4CL1 A;  3CCV 1;  2E9H A;  1ZB9 A;  1Z02 A;  2HU9 A;  3VMI A;  1VQ5 Z;  1VQ9 1;  2JIP A;  2NAP A;  3CCQ Z;  3HOU I;  3CCR Z;  2DE7 A;  2PM9 A;  3TDH B;  5T67 A;  1YIT Z;  1LQL A;  4NBC A;  3G4S Z;  1Q86 2;  1TWH I;  4NBA A;  3S15 I;  1Q81 2;  4E30 A;  1QVF Y;  2GTI A;  1YJ9 1;  1Q82 1;  4MON A;  4NBG A;  1VQK 1;  4BBS I;  2VUM I;  3CCU Z;  2M6N A;  4NFR A;  1KC8 1;  2AKL A;  2RT9 A;  4QTT A;  3CXC Z;  1VQ8 1;  3S16 I;  1USP B;  2F4O A;  5C3E I;  1Q16 A;  4BY1 I;  2JMO A;  2QRE B;  2I3C A;  2O53 A;  3CCQ 1;  3S1Q I;  3P5J B;  3S2D I;  4TNU A;  3HOV I;  2R6M A;  3EED A;  3S1R I;  1USP A;  5FLX f;  4A3C I;  1X3Z A;  3CCR 1;  1YIT 1;  2K3R A;  2JR6 A;  1VQ4 Z;  3G4S 1;  1VLA A;  1K8A 2;  2ZAE B;  3HOW I;  4HGZ A;  3FKI I;  1M90 2;  3S2H I;  3NH4 A; 
#chains in the Genus database with same CATH homology
 3CXC Y;  3CC4 Z;  1YIJ 1;  1JJ2 Z;  1RO2 A;  4A3F I;  3CC7 1;  4NBB A;  2OTL Z;  3RZO I;  2RIQ A;  1PFT A;  2NVT I;  1S72 Z;  2DE5 A;  4A3K I;  3CCV Z;  3S14 I;  3I4N I;  3CCJ 1;  1NUI A;  2QEX 1;  1VQ9 Z;  4BXX I;  1ML8 A;  1VQM 1;  4S1T A;  1P9N A;  1X0T A;  1Q86 1;  1VQ4 1;  3I55 Z;  1Q81 1;  1QVF Z;  1YI2 Z;  3GCF A;  2W04 A;  3GTP I;  3CME 1;  5D1P A;  2Q51 A;  4DK1 A;  4EWC A;  3CC4 1;  3T4N B;  1JJ2 Y;  4MXU A;  2OTL 1;  3FQM A;  3S1N I;  1VQ6 1;  1YUA A;  2J6A A;  1Y1V I;  1YHQ 1;  1VQ7 1;  2Q4Z A;  1S7M A;  1SFO I;  1VQL 1;  4E2Y A;  4MD7 A;  3KIH A;  3KIF A;  3CCE 1;  2RBL A;  3CCM 1;  3J7A 4;  3D6W A;  1WCM I;  4RVF A;  3IFU A;  1L1O C;  4DQY B;  3M4O I;  3J81 f;  3GTG I;  3HOY I;  3I55 1;  1K8A 1;  5C4X I;  1YI2 1;  4DGL A;  2V8J A;  2RPR A;  5A2Q f;  1M90 1;  3HOX I;  4NBF A;  4QTU A;  3JAM f;  1QVG Z;  3J80 f;  3NDJ A;  2M48 A;  1YIJ Z;  3CC7 Z;  3PO3 I;  1K9M 2;  4AYB A;  1YJN 1;  3GTM I;  3JAM b;  4E33 A;  3HOZ I;  2WAQ A;  2OZK A;  1K73 2;  4MD8 A;  4E2W A;  3IX0 A;  3VTN A;  5C44 I;  3CCJ Z;  2R93 I;  4RS4 A;  1N8R 1;  2QEX Z;  1RNI A;  1N2F A;  2YAD A;  1VQM Z;  1TWA I;  2V8K A;  4NB8 A;  2EGT A;  1VQN 1;  4NBH A;  5FLM I;  1TWC I;  3EER A;  1M1K 2;  5FLX b;  3CME Z;  4A3E I;  4E2X A;  1QVG Y;  2B63 I;  5IP9 I;  1VQO Z;  1VQ6 Z;  5T64 A;  4A93 I;  4BY7 I;  2RHB A;  1RQF A;  1YHQ Z;  1NJI 2;  1VQ7 Z;  1NP6 A;  2JA7 I;  2HF1 A;  5IP7 I;  3F3F C;  4E31 A;  1VQL Z;  1K83 I;  3MON A;  4NH1 C;  3PO3 S;  2JA6 I;  1Y1W I;  3GTM S;  2PK7 A;  3CCE Z;  4E2Z A;  3OW2 Z;  2OOY B;  3CCM Z;  3QWU A;  1W2B Z;  1Q7Y 2;  2KPI A;  4Y7N I;  3CPW Z;  3GTJ I;  5IT9 f;  2KI7 B;  4A3L I;  2E2I I;  3GKQ A;  3CC2 1;  1Z01 A;  1RO4 A;  2QLV B;  3HKZ A;  3GTO I;  2JS4 A;  5CM2 M;  4X6A I;  2JA8 I;  4HGY A;  4HH4 A;  1QF8 A;  3NFZ A;  1VQO 1;  5IT9 b;  2NVY I;  1YJN Z;  2OOX B;  3MZK B;  3F3P C;  1K73 1;  3GTL I;  3CCL 1;  3G71 Z;  3G6E 1;  1KQS Z;  2OTJ Z;  1TFI A;  3K7A I;  1YJW 1;  4RVD A;  3OW2 Y;  1ZB8 A;  2R92 I;  4A3B I;  1W2B Y;  1YUK A;  2QRC B;  5T6B A;  1VQN Z;  4RV9 A;  3TE5 B;  3M3Y I;  4A3G I;  3CPW Y;  3CCS 1;  2VF1 A;  1M1K 1;  5AN9 F;  4A3J I;  2BJO A;  3D9X A;  4MH4 A;  3J81 b;  1TWF I;  1KD1 2;  3I07 A;  2JA5 I;  2QKD A;  2H85 A;  5A2Q b;  1NJI 1;  3I56 Z;  3I4M I;  3H0G I;  1DL6 A;  3CD6 Z;  2Y0S A;  3FQQ A;  3NH5 A;  2R7Z I;  3S1M I;  3G71 1;  3J80 b;  1KRL A;  2OTJ 1;  2NVQ I;  1Y1V S;  1KQS Y;  1JWH C;  3Q87 A;  1I50 I;  2P28 A;  1R9T I;  3BG1 B;  2GTH A;  3MZL B;  2K5R A;  2QR1 B;  2F4M A;  5C4J I;  3VB9 A;  2NVX I;  4NOZ A;  1Q7Y 1;  3BG0 B;  3CQZ I;  2JUB A;  4NBD A;  1VQP Z;  2QA4 1;  3VMH A;  1I3Q I;  4BBR I;  2JNY A;  1WII A;  2GU2 A;  3CC2 Z;  3LUS A;  2E2H I;  1VQ5 1;  3GTK I;  2LIY A;  4NBE A;  4RVH A;  2IZ3 A;  1ZH1 A;  3U50 C;  2VUG A;  3RZD I;  5D1O B;  2G2K A;  3I56 1;  3CMA Z;  1I6H I;  2WB1 A;  3CD6 1;  3H3V J;  3GTQ I;  4E32 A;  3CCL Z;  1Z03 A;  3NDI A;  3G6E Z;  3CCU 1;  1Q82 2;  2V8I A;  1TWG I;  1KC8 2;  4A3I I;  5D1O A;  1YJW Z;  2P3Y A;  5LL6 f;  4Y52 I;  1X3W A;  1VQP 1;  2LFU A;  4A3M I;  3CCS Z;  4NB9 A;  1QYP A;  3PO2 I;  4A3D I;  2O4H A;  3VMG A;  1N8R 2;  2QRD B;  1KD1 1;  4MRI A;  2YU9 I;  1K9M 1;  3CMA 1;  3S17 I;  3NH8 A;  4XX2 A;  2E2J I;  1YJ9 Z;  2DE6 A;  2W03 A;  3IF8 A;  1VQK Z;  2IZ4 A;  4RVG A;  2PMZ A;  1VQ8 Z;  3ESW A;  4MD9 A;  1RLY A;  1S72 1;  1RO0 A;  1WW9 A;  2QA4 Z;  4CL1 A;  3CCV 1;  2E9H A;  1ZB9 A;  1Z02 A;  2HU9 A;  3VMI A;  1VQ5 Z;  1VQ9 1;  3CCQ Z;  3HOU I;  2DE7 A;  3CCR Z;  2PM9 A;  3TDH B;  5T67 A;  1YIT Z;  1LQL A;  4NBC A;  3G4S Z;  1Q86 2;  1TWH I;  4NBA A;  3S15 I;  1Q81 2;  4E30 A;  1QVF Y;  2GTI A;  1YJ9 1;  1Q82 1;  4MON A;  4NBG A;  1VQK 1;  4BBS I;  2VUM I;  3CCU Z;  2M6N A;  4NFR A;  1KC8 1;  2AKL A;  2RT9 A;  4QTT A;  3CXC Z;  1VQ8 1;  3S16 I;  1USP B;  2F4O A;  5C3E I;  4BY1 I;  2JMO A;  2QRE B;  2I3C A;  2O53 A;  3CCQ 1;  3S1Q I;  3P5J B;  3S2D I;  4TNU A;  3HOV I;  2R6M A;  3EED A;  3S1R I;  1USP A;  5FLX f;  4A3C I;  1X3Z A;  3CCR 1;  1YIT 1;  2K3R A;  2JR6 A;  1VQ4 Z;  3G4S 1;  1VLA A;  1K8A 2;  2ZAE B;  3HOW I;  4HGZ A;  3FKI I;  1M90 2;  3S2H I;  3NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...