1Y1VI

Refined rna polymerase ii-tfiis complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vI02
4NBCA 2DE5A 3H0GI 4A3II 5IP9I 3S14I 3S1QI 3HOYI 4A3FI 1USPA 4BY7I 3S1RI 2JA6I 1TWCI 4A3BI 2E2HI 2J6AA 1RO4A 5C4JI 3S1MI 2JNYA 2K5RA 3RZDI 3HOXI 3D6WA 2B63I 1RLYA 3EERA 3VMGA 4BBSI 2R92I 4BBRI 3GTLI 3S15I 1VLAA 1I50I 4NBBA 4XX2A 2NVXI 4BY1I 3I07A 2JA8I 1I6HI 5FLMI 1K83I 1X3ZA 3HOUI 2R7ZI 3K7AI 2NVTI 2JA7I 4A93I 2YU9I 3GTGI 3HOZI 3I4NI 4A3JI 3GCFA 4A3GI 1LQLA 4A3CI 1Y1VS 5CM2M 3H3VJ 4Y7NI 3CQZI 4NOZA 4NBHA 3GTPI 3GTOI 3GTMS 1I3QI 2NVQI 3S17I 2DE6A 4X6AI 1TWFI 2JR6A 5C3EI 1Y1WI 3VMHA 2BJOA 1SFOI 3M4OI 1DL6A 4A3EI 4A3DI 4Y52I 1QYPA 1USPB 4QTTA 5IP7I 3GTQI 4A3LI 3HOVI 2E2JI 2F4OA 4BXXI 1TWHI 1ZB8A 4NB9A 4QTUA 3GTJI 2DE7A 4NBDA 1TWAI 3S16I 4A3KI 2PK7A 2AKLA 3GTKI 3VMIA 1WCMI 2F4MA 2E2II 1ZB9A 4NB8A 3S1NI 2HF1A 3ESWA 1N2FA 2RBLA 2KPIA 3M3YI 2P3YA 1X3WA 3GKQA 1YUAA 4NBEA 3PO2I 4MH4A 4NBAA 4NBFA 3I4MI 1Y1VI 5C44I 1R9TI 1TFIA 3Q87A 3RZOI 3GTMI 2R93I 2NVYI 3PO3S 2JA5I 2JS4A 4A3MI 3S2HI 3FKII 3VB9A 1PFTA 4NBGA 2VUMI 1L1OC 3S2DI 1NUIA 1WW9A 3U50C 3PO3I 1ML8A 5C4XI 1TWGI 3LUSA 3HOWI
chains in the Genus database with same CATH superfamily
5T64A 2JIPA 3CD61 1TWCI 3CCEZ 4EWCA 2E2HI 2J6AA 3CMEZ 3NFZA 1Q811 5C4JI 1Z02A 4RVFA 3D6WA 1RLYA 3J80f 3VMGA 2QEX1 2QLVB 4BBRI 4E2ZA 3S15I 1I50I 4XX2A 4BY1I 3MZLB 2YADA 2O53A 4E30A 3IF8A 1Q822 2JMOA 3CCR1 1I6HI 3J81b 3CPWZ 3D2LA 3I55Z 2RT9A 3CCQZ 3TE5B 1WIIA 2V8JA 4A3JI 4MRIA 4A3CI 3H3VJ 1VQ7Z 3S17I 4E33A 4NBHA 3CCE1 3GTMS 1I3QI 5D1OB 4X6AI 3CME1 2QRCB 4Y52I 1QYPA 4QTTA 5IP7I 3J7A4 3NDIA 4QTUA 5A2Qb 3GTJI 2E2II 4S1TA 1W2BY 3FQQA 1YITZ 1N2FA 2W03A 3NH4A 2QRDB 2E7ZA 2P3YA 3I551 1YUAA 3PO2I 5D1PA 3CCQ1 1Q821 1Q862 1VQ4Z 4NBAA 2GTHA 1VQ6Z 1JJ2Z 1TFIA 1VQ8Z 1YJW1 4MD9A 1VQ71 2G2KA 4A3MI 3CC4Z 4NBGA 1S7MA 2VUMI 3U50C 1ML8A 3G4S1 1TWGI 3LUSA 4NBCA 1P9NA 5D1OA 4A3II 5IP9I 1QF8A 3S14I 3J81f 3IFUA 3CCMZ 4A3FI 3HOYI 5T6BA 1YIT1 2M48A 1FDOA 3MONA 2O4HA 3S1MI 1VQ41 2JNYA 2K5RA 3RZDI 1QVFY 1VQ61 4TNUA 1VQ5Z 1VQ81 4DK1A 2R92I 1Q861 5A2Qf 4DQYB 2VPYA 3CC41 2QA4Z 2IV2X 1YI2Z 1Q16A 5FLMI 1K83I 1X3ZA 2JUBA 2HU9A 2QREB 3K7AI 2JA7I 4A93I 1YUKA 3TDHB 3GCFA 4A3GI 2IZ4A 1LQLA 4MXUA 2V8IA 1Y1VS 5CM2M 1AA6A 3CC2Z 3IR7A 3GTOI 1YHQZ 1TWFI 1FDIA 1WJ2A 2OOYB 4RVHA 3M4OI 4A3DI 2IZ3A 1KD12 4A3LI 3JAMf 3KIFA 2EGTA 1YJ9Z 2F4OA 4BXXI 4NB9A 2VPXA 2OZKA 2QR1B 2DE7A 4NBDA 1TWAI 3S16I 4A3KI 1VQ51 2PK7A 4E2WA 1WCMI 3CCJZ 2F4MA 3HKZA 2JIQA 3G6EZ 1QVGZ 2QA41 1YI21 2HF1A 3ESWA 2WAQA 2KPIA 3M3YI 2Q51A 1X3WA 4NBEA 2RIQA 5C44I 3RZOI 3MZKB 3GTMI 1Q7Y1 4E2XA 2JA5I 3CC21 2OTJZ 3BG0B 1YHQ1 3S2DI 3FQMA 3VTNA 1YJ91 4E31A 1NJI1 1K8A2 2VPWA 1K9M2 3HOWI 2E9HA 1KD11 1VQKZ 1KQSZ 1JJ2Y 3S1QI 3CCJ1 3F3PC 4BY7I 3G6E1 2JIOA 4A3BI 2LEXA 3T4NB 1VQNZ 3JAMb 1RO4A 3NH5A 2K3RA 1W2BZ 2LFUA 2B63I 4BBSI 3GTLI 1VLAA 3CXCZ 2OTJ1 4NBBA 2NVXI 4HGYA 4E32A 1RQFA 3I07A 3OW2Y 2JA8I 2LIYA 3HOUI 2ZAEB 1VQOZ 1SIWA 2YU9I 3GTGI 1M901 1VQK1 3HOZI 1VQPZ 1K8A1 3CC7Z 1K9M1 4CL1A 3G71Z 4Y7NI 2V45A 4NOZA 2NVQI 1K731 5C3EI 1VQN1 1USPB 4HGZA 2E2JI 1QXFA 1TWHI 1VQ9Z 2Y0SA 5T67A 1YJNZ 2AKLA 3GTKI 1YIJZ 1Q7Y2 1VQMZ 4RV9A 1X0TA 3BG1B 3S1NI 3CCM1 1QVFZ 1Y8CA 1N8R1 2AYDA 1NJI2 3CMAZ 1VQO1 1Y1VI 1VQP1 1R9TI 3Q87A 1Z03A 4NFRA 4NH1C 3CC71 1RO0A 3G711 3CPWY 2NVYI 5LL6f 1M1K1 2Q4ZA 3I56Z 2OTLZ 1PFTA 2P28A 5IT9b 1L1OC 1QVGY 3P5JB 1WW9A 1RNIA 2VPZA 4HH4A 1WZNA 2PMZA 3CCVZ 1KRLA 1VQ91 2DE5A 3H0GI 4MONA 1YJN1 1YIJ1 1USPA 3D9XA 1VQM1 1NP6A 3S1RI 2R6MA 2JA6I 4E2YA 2RHBA 4AYBA 2VUGA 1ZH1A 2WB1A 2RPRA 3CMA1 1YJWZ 5FLXb 3NH8A 1M902 3HOXI 1S72Z 1JWHC 3EERA 1KQSY 3I561 2OTL1 1RO2A 3IX0A 3G4SZ 3CCSZ 1K732 2JIMA 3CCUZ 3CCV1 2NAPA 2QKDA 2GU2A 2R7ZI 2NVTI 2VF1A 2OOXB 4RS4A 3I4NI 2GTIA 4MD7A 2KI7B 3KIHA 3CQZI 3GTPI 3CXCY 1KC82 2DE6A 2JR6A 1Y1WI 3VMHA 2BJOA 1SFOI 1DL6A 4A3EI 4MD8A 1N8R2 3CCLZ 3J80b 3GTQI 3HOVI 1VQLZ 1ZB8A 5IT9f 2M6NA 1S721 4RVGA 4RVDA 3VMIA 4DGLA 3CD6Z 2PM9A 1M1K2 2V3VA 1ZB9A 4NB8A 1Q812 3CCS1 3QWUA 2I3CA 2RBLA 3CCU1 3GKQA 4MH4A 4NBFA 3I4MI 3EEDA 2W04A 2V8KA 2QEXZ 2R93I 3OW2Z 2H85A 3PO3S 2JS4A 5FLXf 3S2HI 3FKII 3VB9A 1NUIA 3CCL1 3PO3I 1Z01A 3CCRZ 3F3FC 5C4XI 1KC81 3NDJA 1VQL1 2JIRA 5AN9F
chains in the Genus database with same CATH topology
5T64A 3CD61 1TWCI 3CCEZ 4EWCA 2E2HI 2J6AA 3CMEZ 3NFZA 1Q811 5C4JI 1Z02A 4RVFA 3D6WA 1RLYA 3J80f 3VMGA 2QEX1 2QLVB 4BBRI 4E2ZA 3S15I 1I50I 4XX2A 4BY1I 3MZLB 2YADA 2O53A 4E30A 3IF8A 1Q822 2JMOA 3CCR1 1I6HI 3J81b 3CPWZ 3I55Z 2RT9A 3CCQZ 3TE5B 1WIIA 2V8JA 4A3JI 4MRIA 4A3CI 3H3VJ 1VQ7Z 3S17I 4E33A 4NBHA 3CCE1 3GTMS 1I3QI 5D1OB 4X6AI 3CME1 2QRCB 4Y52I 1QYPA 4QTTA 5IP7I 3J7A4 3NDIA 4QTUA 5A2Qb 3GTJI 2E2II 4S1TA 1W2BY 3FQQA 1YITZ 1N2FA 2W03A 3NH4A 2QRDB 2P3YA 3I551 1YUAA 3PO2I 5D1PA 3CCQ1 1Q821 1Q862 1VQ4Z 4NBAA 2GTHA 1VQ6Z 1JJ2Z 1TFIA 1VQ8Z 1YJW1 4MD9A 1VQ71 2G2KA 4A3MI 3CC4Z 4NBGA 1S7MA 2VUMI 3U50C 1ML8A 3G4S1 1TWGI 3LUSA 4NBCA 1P9NA 5D1OA 4A3II 5IP9I 1QF8A 3S14I 3J81f 3IFUA 3CCMZ 4A3FI 3HOYI 5T6BA 1YIT1 2M48A 3MONA 2O4HA 3S1MI 1VQ41 2JNYA 2K5RA 3RZDI 1QVFY 1VQ61 4TNUA 1VQ5Z 1VQ81 4DK1A 2R92I 1Q861 5A2Qf 4DQYB 3CC41 2QA4Z 1YI2Z 5FLMI 1K83I 1X3ZA 2JUBA 2HU9A 2QREB 3K7AI 2JA7I 4A93I 1YUKA 3TDHB 3GCFA 4A3GI 2IZ4A 1LQLA 4MXUA 2V8IA 1Y1VS 5CM2M 3CC2Z 3GTOI 1YHQZ 1TWFI 2OOYB 4RVHA 3M4OI 4A3DI 2IZ3A 1KD12 4A3LI 3JAMf 3KIFA 2EGTA 1YJ9Z 2F4OA 4BXXI 4NB9A 2OZKA 2QR1B 2DE7A 4NBDA 1TWAI 3S16I 4A3KI 1VQ51 2PK7A 4E2WA 1WCMI 3CCJZ 2F4MA 3HKZA 3G6EZ 1QVGZ 2QA41 1YI21 2HF1A 3ESWA 2WAQA 2KPIA 3M3YI 2Q51A 1X3WA 4NBEA 2RIQA 5C44I 3RZOI 3MZKB 3GTMI 1Q7Y1 4E2XA 2JA5I 3CC21 2OTJZ 3BG0B 1YHQ1 3S2DI 3FQMA 3VTNA 1YJ91 4E31A 1NJI1 1K8A2 1K9M2 3HOWI 2E9HA 1KD11 1VQKZ 1KQSZ 1JJ2Y 3S1QI 3CCJ1 3F3PC 4BY7I 3G6E1 4A3BI 3T4NB 1VQNZ 3JAMb 1RO4A 3NH5A 2K3RA 1W2BZ 2LFUA 2B63I 4BBSI 3GTLI 1VLAA 3CXCZ 2OTJ1 4NBBA 2NVXI 4HGYA 4E32A 1RQFA 3I07A 3OW2Y 2JA8I 2LIYA 3HOUI 2ZAEB 1VQOZ 2YU9I 3GTGI 1M901 1VQK1 3HOZI 1VQPZ 1K8A1 3CC7Z 1K9M1 4CL1A 3G71Z 4Y7NI 4NOZA 2NVQI 1K731 5C3EI 1VQN1 1USPB 4HGZA 2E2JI 1TWHI 1VQ9Z 2Y0SA 5T67A 1YJNZ 2AKLA 3GTKI 1YIJZ 1Q7Y2 1VQMZ 4RV9A 1X0TA 3BG1B 3S1NI 3CCM1 1QVFZ 1N8R1 1NJI2 3CMAZ 1VQO1 1Y1VI 1VQP1 1R9TI 3Q87A 1Z03A 4NFRA 4NH1C 3CC71 1RO0A 3G711 3CPWY 2NVYI 5LL6f 1M1K1 2Q4ZA 3I56Z 2OTLZ 1PFTA 2P28A 5IT9b 1L1OC 1QVGY 3P5JB 1WW9A 1RNIA 4HH4A 2PMZA 3CCVZ 1KRLA 1VQ91 2DE5A 3H0GI 4MONA 1YJN1 1YIJ1 1USPA 3D9XA 1VQM1 1NP6A 3S1RI 2R6MA 2JA6I 4E2YA 2RHBA 4AYBA 2VUGA 1ZH1A 2WB1A 2RPRA 3CMA1 1YJWZ 5FLXb 3NH8A 1M902 3HOXI 1S72Z 1JWHC 3EERA 1KQSY 3I561 2OTL1 1RO2A 3IX0A 3G4SZ 3CCSZ 1K732 3CCUZ 3CCV1 2QKDA 2GU2A 2R7ZI 2NVTI 2VF1A 2OOXB 4RS4A 3I4NI 2GTIA 4MD7A 2KI7B 3KIHA 3CQZI 3GTPI 3CXCY 1KC82 2DE6A 2JR6A 1Y1WI 3VMHA 2BJOA 1SFOI 1DL6A 4A3EI 4MD8A 1N8R2 3CCLZ 3J80b 3GTQI 3HOVI 1VQLZ 1ZB8A 5IT9f 2M6NA 1S721 4RVGA 4RVDA 3VMIA 4DGLA 3CD6Z 2PM9A 1M1K2 1ZB9A 4NB8A 1Q812 3CCS1 3QWUA 2I3CA 2RBLA 3CCU1 3GKQA 4MH4A 4NBFA 3I4MI 3EEDA 2W04A 2V8KA 2QEXZ 2R93I 3OW2Z 2H85A 3PO3S 2JS4A 5FLXf 3S2HI 3FKII 3VB9A 1NUIA 3CCL1 3PO3I 1Z01A 3CCRZ 3F3FC 5C4XI 1KC81 3NDJA 1VQL1 5AN9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBC A;  2DE5 A;  3H0G I;  4A3I I;  5IP9 I;  3S14 I;  3S1Q I;  3HOY I;  4A3F I;  1USP A;  4BY7 I;  3S1R I;  2JA6 I;  1TWC I;  4A3B I;  2E2H I;  2J6A A;  1RO4 A;  5C4J I;  3S1M I;  2JNY A;  2K5R A;  3RZD I;  3HOX I;  3D6W A;  2B63 I;  1RLY A;  3EER A;  3VMG A;  4BBS I;  2R92 I;  4BBR I;  3GTL I;  3S15 I;  1VLA A;  1I50 I;  4NBB A;  4XX2 A;  2NVX I;  4BY1 I;  3I07 A;  2JA8 I;  1I6H I;  5FLM I;  1K83 I;  1X3Z A;  3HOU I;  2R7Z I;  3K7A I;  2NVT I;  2JA7 I;  4A93 I;  2YU9 I;  3GTG I;  3HOZ I;  3I4N I;  4A3J I;  3GCF A;  4A3G I;  1LQL A;  4A3C I;  1Y1V S;  5CM2 M;  3H3V J;  4Y7N I;  3CQZ I;  4NOZ A;  4NBH A;  3GTP I;  3GTO I;  3GTM S;  1I3Q I;  2NVQ I;  3S17 I;  2DE6 A;  4X6A I;  1TWF I;  2JR6 A;  5C3E I;  1Y1W I;  3VMH A;  2BJO A;  1SFO I;  3M4O I;  1DL6 A;  4A3E I;  4A3D I;  4Y52 I;  1QYP A;  1USP B;  4QTT A;  5IP7 I;  3GTQ I;  4A3L I;  3HOV I;  2E2J I;  2F4O A;  4BXX I;  1TWH I;  1ZB8 A;  4NB9 A;  4QTU A;  3GTJ I;  2DE7 A;  4NBD A;  1TWA I;  3S16 I;  4A3K I;  2PK7 A;  2AKL A;  3GTK I;  3VMI A;  1WCM I;  2F4M A;  2E2I I;  1ZB9 A;  4NB8 A;  3S1N I;  2HF1 A;  3ESW A;  1N2F A;  2RBL A;  2KPI A;  3M3Y I;  2P3Y A;  1X3W A;  3GKQ A;  1YUA A;  4NBE A;  3PO2 I;  4MH4 A;  4NBA A;  4NBF A;  3I4M I;  1Y1V I;  5C44 I;  1R9T I;  1TFI A;  3Q87 A;  3RZO I;  3GTM I;  2R93 I;  2NVY I;  3PO3 S;  2JA5 I;  2JS4 A;  4A3M I;  3S2H I;  3FKI I;  3VB9 A;  1PFT A;  4NBG A;  2VUM I;  1L1O C;  3S2D I;  1NUI A;  1WW9 A;  3U50 C;  3PO3 I;  1ML8 A;  5C4X I;  1TWG I;  3LUS A;  3HOW I; 
#chains in the Genus database with same CATH topology
 5T64 A;  2JIP A;  3CD6 1;  1TWC I;  3CCE Z;  4EWC A;  2E2H I;  2J6A A;  3CME Z;  3NFZ A;  1Q81 1;  5C4J I;  1Z02 A;  4RVF A;  3D6W A;  1RLY A;  3J80 f;  3VMG A;  2QEX 1;  2QLV B;  4BBR I;  4E2Z A;  3S15 I;  1I50 I;  4XX2 A;  4BY1 I;  3MZL B;  2YAD A;  2O53 A;  4E30 A;  3IF8 A;  1Q82 2;  2JMO A;  3CCR 1;  1I6H I;  3J81 b;  3CPW Z;  3D2L A;  3I55 Z;  2RT9 A;  3CCQ Z;  3TE5 B;  1WII A;  2V8J A;  4A3J I;  4MRI A;  4A3C I;  3H3V J;  1VQ7 Z;  3S17 I;  4E33 A;  4NBH A;  3CCE 1;  3GTM S;  1I3Q I;  5D1O B;  4X6A I;  3CME 1;  2QRC B;  4Y52 I;  1QYP A;  4QTT A;  5IP7 I;  3J7A 4;  3NDI A;  4QTU A;  5A2Q b;  3GTJ I;  2E2I I;  4S1T A;  1W2B Y;  3FQQ A;  1YIT Z;  1N2F A;  2W03 A;  3NH4 A;  2QRD B;  2E7Z A;  2P3Y A;  3I55 1;  1YUA A;  3PO2 I;  5D1P A;  3CCQ 1;  1Q82 1;  1Q86 2;  1VQ4 Z;  4NBA A;  2GTH A;  1VQ6 Z;  1JJ2 Z;  1TFI A;  1VQ8 Z;  1YJW 1;  4MD9 A;  1VQ7 1;  2G2K A;  4A3M I;  3CC4 Z;  4NBG A;  1S7M A;  2VUM I;  3U50 C;  1ML8 A;  3G4S 1;  1TWG I;  3LUS A;  4NBC A;  1P9N A;  5D1O A;  4A3I I;  5IP9 I;  1QF8 A;  3S14 I;  3J81 f;  3IFU A;  3CCM Z;  4A3F I;  3HOY I;  5T6B A;  1YIT 1;  2M48 A;  1FDO A;  3MON A;  2O4H A;  3S1M I;  1VQ4 1;  2JNY A;  2K5R A;  3RZD I;  1QVF Y;  1VQ6 1;  4TNU A;  1VQ5 Z;  1VQ8 1;  4DK1 A;  2R92 I;  1Q86 1;  5A2Q f;  4DQY B;  2VPY A;  3CC4 1;  2QA4 Z;  2IV2 X;  1YI2 Z;  1Q16 A;  5FLM I;  1K83 I;  1X3Z A;  2JUB A;  2HU9 A;  2QRE B;  3K7A I;  2JA7 I;  4A93 I;  1YUK A;  3TDH B;  3GCF A;  4A3G I;  2IZ4 A;  1LQL A;  4MXU A;  2V8I A;  1Y1V S;  5CM2 M;  1AA6 A;  3CC2 Z;  3IR7 A;  3GTO I;  1YHQ Z;  1TWF I;  1FDI A;  1WJ2 A;  2OOY B;  4RVH A;  3M4O I;  4A3D I;  2IZ3 A;  1KD1 2;  4A3L I;  3JAM f;  3KIF A;  2EGT A;  1YJ9 Z;  2F4O A;  4BXX I;  4NB9 A;  2VPX A;  2OZK A;  2QR1 B;  2DE7 A;  4NBD A;  1TWA I;  3S16 I;  4A3K I;  1VQ5 1;  2PK7 A;  4E2W A;  1WCM I;  3CCJ Z;  2F4M A;  3HKZ A;  2JIQ A;  3G6E Z;  1QVG Z;  2QA4 1;  1YI2 1;  2HF1 A;  3ESW A;  2WAQ A;  2KPI A;  3M3Y I;  2Q51 A;  1X3W A;  4NBE A;  2RIQ A;  5C44 I;  3RZO I;  3MZK B;  3GTM I;  1Q7Y 1;  4E2X A;  2JA5 I;  3CC2 1;  2OTJ Z;  3BG0 B;  1YHQ 1;  3S2D I;  3FQM A;  3VTN A;  1YJ9 1;  4E31 A;  1NJI 1;  1K8A 2;  2VPW A;  1K9M 2;  3HOW I;  2E9H A;  1KD1 1;  1VQK Z;  1KQS Z;  1JJ2 Y;  3S1Q I;  3CCJ 1;  3F3P C;  4BY7 I;  3G6E 1;  2JIO A;  4A3B I;  2LEX A;  3T4N B;  1VQN Z;  3JAM b;  1RO4 A;  3NH5 A;  2K3R A;  1W2B Z;  2LFU A;  2B63 I;  4BBS I;  3GTL I;  1VLA A;  3CXC Z;  2OTJ 1;  4NBB A;  2NVX I;  4HGY A;  4E32 A;  1RQF A;  3I07 A;  3OW2 Y;  2JA8 I;  2LIY A;  3HOU I;  2ZAE B;  1VQO Z;  1SIW A;  2YU9 I;  3GTG I;  1M90 1;  1VQK 1;  3HOZ I;  1VQP Z;  1K8A 1;  3CC7 Z;  1K9M 1;  4CL1 A;  3G71 Z;  4Y7N I;  2V45 A;  4NOZ A;  2NVQ I;  1K73 1;  5C3E I;  1VQN 1;  1USP B;  4HGZ A;  2E2J I;  1QXF A;  1TWH I;  1VQ9 Z;  2Y0S A;  5T67 A;  1YJN Z;  2AKL A;  3GTK I;  1YIJ Z;  1Q7Y 2;  1VQM Z;  4RV9 A;  1X0T A;  3BG1 B;  3S1N I;  3CCM 1;  1QVF Z;  1Y8C A;  1N8R 1;  2AYD A;  1NJI 2;  3CMA Z;  1VQO 1;  1Y1V I;  1VQP 1;  1R9T I;  3Q87 A;  1Z03 A;  4NFR A;  4NH1 C;  3CC7 1;  1RO0 A;  3G71 1;  3CPW Y;  2NVY I;  5LL6 f;  1M1K 1;  2Q4Z A;  3I56 Z;  2OTL Z;  1PFT A;  2P28 A;  5IT9 b;  1L1O C;  1QVG Y;  3P5J B;  1WW9 A;  1RNI A;  2VPZ A;  4HH4 A;  1WZN A;  2PMZ A;  3CCV Z;  1KRL A;  1VQ9 1;  2DE5 A;  3H0G I;  4MON A;  1YJN 1;  1YIJ 1;  1USP A;  3D9X A;  1VQM 1;  1NP6 A;  3S1R I;  2R6M A;  2JA6 I;  4E2Y A;  2RHB A;  4AYB A;  2VUG A;  1ZH1 A;  2WB1 A;  2RPR A;  3CMA 1;  1YJW Z;  5FLX b;  3NH8 A;  1M90 2;  3HOX I;  1S72 Z;  1JWH C;  3EER A;  1KQS Y;  3I56 1;  2OTL 1;  1RO2 A;  3IX0 A;  3G4S Z;  3CCS Z;  1K73 2;  2JIM A;  3CCU Z;  3CCV 1;  2NAP A;  2QKD A;  2GU2 A;  2R7Z I;  2NVT I;  2VF1 A;  2OOX B;  4RS4 A;  3I4N I;  2GTI A;  4MD7 A;  2KI7 B;  3KIH A;  3CQZ I;  3GTP I;  3CXC Y;  1KC8 2;  2DE6 A;  2JR6 A;  1Y1W I;  3VMH A;  2BJO A;  1SFO I;  1DL6 A;  4A3E I;  4MD8 A;  1N8R 2;  3CCL Z;  3J80 b;  3GTQ I;  3HOV I;  1VQL Z;  1ZB8 A;  5IT9 f;  2M6N A;  1S72 1;  4RVG A;  4RVD A;  3VMI A;  4DGL A;  3CD6 Z;  2PM9 A;  1M1K 2;  2V3V A;  1ZB9 A;  4NB8 A;  1Q81 2;  3CCS 1;  3QWU A;  2I3C A;  2RBL A;  3CCU 1;  3GKQ A;  4MH4 A;  4NBF A;  3I4M I;  3EED A;  2W04 A;  2V8K A;  2QEX Z;  2R93 I;  3OW2 Z;  2H85 A;  3PO3 S;  2JS4 A;  5FLX f;  3S2H I;  3FKI I;  3VB9 A;  1NUI A;  3CCL 1;  3PO3 I;  1Z01 A;  3CCR Z;  3F3F C;  5C4X I;  1KC8 1;  3NDJ A;  1VQL 1;  2JIR A;  5AN9 F; 
#chains in the Genus database with same CATH homology
 5T64 A;  3CD6 1;  1TWC I;  3CCE Z;  4EWC A;  2E2H I;  2J6A A;  3CME Z;  3NFZ A;  1Q81 1;  5C4J I;  1Z02 A;  4RVF A;  3D6W A;  1RLY A;  3J80 f;  3VMG A;  2QEX 1;  2QLV B;  4BBR I;  4E2Z A;  3S15 I;  1I50 I;  4XX2 A;  4BY1 I;  3MZL B;  2YAD A;  2O53 A;  4E30 A;  3IF8 A;  1Q82 2;  2JMO A;  3CCR 1;  1I6H I;  3J81 b;  3CPW Z;  3I55 Z;  2RT9 A;  3CCQ Z;  3TE5 B;  1WII A;  2V8J A;  4A3J I;  4MRI A;  4A3C I;  3H3V J;  1VQ7 Z;  3S17 I;  4E33 A;  4NBH A;  3CCE 1;  3GTM S;  1I3Q I;  5D1O B;  4X6A I;  3CME 1;  2QRC B;  4Y52 I;  1QYP A;  4QTT A;  5IP7 I;  3J7A 4;  3NDI A;  4QTU A;  5A2Q b;  3GTJ I;  2E2I I;  4S1T A;  1W2B Y;  3FQQ A;  1YIT Z;  1N2F A;  2W03 A;  3NH4 A;  2QRD B;  2P3Y A;  3I55 1;  1YUA A;  3PO2 I;  5D1P A;  3CCQ 1;  1Q82 1;  1Q86 2;  1VQ4 Z;  4NBA A;  2GTH A;  1VQ6 Z;  1JJ2 Z;  1TFI A;  1VQ8 Z;  1YJW 1;  4MD9 A;  1VQ7 1;  2G2K A;  4A3M I;  3CC4 Z;  4NBG A;  1S7M A;  2VUM I;  3U50 C;  1ML8 A;  3G4S 1;  1TWG I;  3LUS A;  4NBC A;  1P9N A;  5D1O A;  4A3I I;  5IP9 I;  1QF8 A;  3S14 I;  3J81 f;  3IFU A;  3CCM Z;  4A3F I;  3HOY I;  5T6B A;  1YIT 1;  2M48 A;  3MON A;  2O4H A;  3S1M I;  1VQ4 1;  2JNY A;  2K5R A;  3RZD I;  1QVF Y;  1VQ6 1;  4TNU A;  1VQ5 Z;  1VQ8 1;  4DK1 A;  2R92 I;  1Q86 1;  5A2Q f;  4DQY B;  3CC4 1;  2QA4 Z;  1YI2 Z;  5FLM I;  1K83 I;  1X3Z A;  2JUB A;  2HU9 A;  2QRE B;  3K7A I;  2JA7 I;  4A93 I;  1YUK A;  3TDH B;  3GCF A;  4A3G I;  2IZ4 A;  1LQL A;  4MXU A;  2V8I A;  1Y1V S;  5CM2 M;  3CC2 Z;  3GTO I;  1YHQ Z;  1TWF I;  2OOY B;  4RVH A;  3M4O I;  4A3D I;  2IZ3 A;  1KD1 2;  4A3L I;  3JAM f;  3KIF A;  2EGT A;  1YJ9 Z;  2F4O A;  4BXX I;  4NB9 A;  2OZK A;  2QR1 B;  2DE7 A;  4NBD A;  1TWA I;  3S16 I;  4A3K I;  1VQ5 1;  2PK7 A;  4E2W A;  1WCM I;  3CCJ Z;  2F4M A;  3HKZ A;  3G6E Z;  1QVG Z;  2QA4 1;  1YI2 1;  2HF1 A;  3ESW A;  2WAQ A;  2KPI A;  3M3Y I;  2Q51 A;  1X3W A;  4NBE A;  2RIQ A;  5C44 I;  3RZO I;  3MZK B;  3GTM I;  1Q7Y 1;  4E2X A;  2JA5 I;  3CC2 1;  2OTJ Z;  3BG0 B;  1YHQ 1;  3S2D I;  3FQM A;  3VTN A;  1YJ9 1;  4E31 A;  1NJI 1;  1K8A 2;  1K9M 2;  3HOW I;  2E9H A;  1KD1 1;  1VQK Z;  1KQS Z;  1JJ2 Y;  3S1Q I;  3CCJ 1;  3F3P C;  4BY7 I;  3G6E 1;  4A3B I;  3T4N B;  1VQN Z;  3JAM b;  1RO4 A;  3NH5 A;  2K3R A;  1W2B Z;  2LFU A;  2B63 I;  4BBS I;  3GTL I;  1VLA A;  3CXC Z;  2OTJ 1;  4NBB A;  2NVX I;  4HGY A;  4E32 A;  1RQF A;  3I07 A;  3OW2 Y;  2JA8 I;  2LIY A;  3HOU I;  2ZAE B;  1VQO Z;  2YU9 I;  3GTG I;  1M90 1;  1VQK 1;  3HOZ I;  1VQP Z;  1K8A 1;  3CC7 Z;  1K9M 1;  4CL1 A;  3G71 Z;  4Y7N I;  4NOZ A;  2NVQ I;  1K73 1;  5C3E I;  1VQN 1;  1USP B;  4HGZ A;  2E2J I;  1TWH I;  1VQ9 Z;  2Y0S A;  5T67 A;  1YJN Z;  2AKL A;  3GTK I;  1YIJ Z;  1Q7Y 2;  1VQM Z;  4RV9 A;  1X0T A;  3BG1 B;  3S1N I;  3CCM 1;  1QVF Z;  1N8R 1;  1NJI 2;  3CMA Z;  1VQO 1;  1Y1V I;  1VQP 1;  1R9T I;  3Q87 A;  1Z03 A;  4NFR A;  4NH1 C;  3CC7 1;  1RO0 A;  3G71 1;  3CPW Y;  2NVY I;  5LL6 f;  1M1K 1;  2Q4Z A;  3I56 Z;  2OTL Z;  1PFT A;  2P28 A;  5IT9 b;  1L1O C;  1QVG Y;  3P5J B;  1WW9 A;  1RNI A;  4HH4 A;  2PMZ A;  3CCV Z;  1KRL A;  1VQ9 1;  2DE5 A;  3H0G I;  4MON A;  1YJN 1;  1YIJ 1;  1USP A;  3D9X A;  1VQM 1;  1NP6 A;  3S1R I;  2R6M A;  2JA6 I;  4E2Y A;  2RHB A;  4AYB A;  2VUG A;  1ZH1 A;  2WB1 A;  2RPR A;  3CMA 1;  1YJW Z;  5FLX b;  3NH8 A;  1M90 2;  3HOX I;  1S72 Z;  1JWH C;  3EER A;  1KQS Y;  3I56 1;  2OTL 1;  1RO2 A;  3IX0 A;  3G4S Z;  3CCS Z;  1K73 2;  3CCU Z;  3CCV 1;  2QKD A;  2GU2 A;  2R7Z I;  2NVT I;  2VF1 A;  2OOX B;  4RS4 A;  3I4N I;  2GTI A;  4MD7 A;  2KI7 B;  3KIH A;  3CQZ I;  3GTP I;  3CXC Y;  1KC8 2;  2DE6 A;  2JR6 A;  1Y1W I;  3VMH A;  2BJO A;  1SFO I;  1DL6 A;  4A3E I;  4MD8 A;  1N8R 2;  3CCL Z;  3J80 b;  3GTQ I;  3HOV I;  1VQL Z;  1ZB8 A;  5IT9 f;  2M6N A;  1S72 1;  4RVG A;  4RVD A;  3VMI A;  4DGL A;  3CD6 Z;  2PM9 A;  1M1K 2;  1ZB9 A;  4NB8 A;  1Q81 2;  3CCS 1;  3QWU A;  2I3C A;  2RBL A;  3CCU 1;  3GKQ A;  4MH4 A;  4NBF A;  3I4M I;  3EED A;  2W04 A;  2V8K A;  2QEX Z;  2R93 I;  3OW2 Z;  2H85 A;  3PO3 S;  2JS4 A;  5FLX f;  3S2H I;  3FKI I;  3VB9 A;  1NUI A;  3CCL 1;  3PO3 I;  1Z01 A;  3CCR Z;  3F3F C;  5C4X I;  1KC8 1;  3NDJ A;  1VQL 1;  5AN9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...