2NVTI

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvtI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvtI02
5IP7I 3H3VJ 3U50C 3PO2I 2R93I 4NBDA 3VMGA 1TWFI 3HOVI 5C4XI 1K83I 1QYPA 1VLAA 3RZOI 5C3EI 3S1MI 3S2DI 3H0GI 3D6WA 3PO3I 2YU9I 1YUAA 4A3BI 4XX2A 2PK7A 4BXXI 1DL6A 4BY1I 3EERA 4A3LI 3HOYI 3S16I 4NOZA 3HOZI 3GTPI 3S1QI 1USPB 2RBLA 4NBBA 4NBHA 3I4MI 3LUSA 2JS4A 3S14I 4MH4A 4X6AI 4NBGA 4A3MI 3HOUI 3CQZI 3K7AI 2NVQI 1NUIA 3ESWA 4NBAA 2NVXI 1N2FA 3S17I 2K5RA 3VMIA 4NBFA 2J6AA 4BY7I 3GTJI 3GKQA 2E2HI 1SFOI 2AKLA 1X3ZA 3GTMS 2R7ZI 3VB9A 4A93I 1R9TI 3FKII 1Y1VS 5C44I 4NBEA 3GCFA 2JA6I 2NVTI 3M3YI 2BJOA 3GTMI 4NB9A 2JA7I 1PFTA 1TWAI 4Y7NI 1Y1WI 1I6HI 1Y1VI 3Q87A 4QTTA 1I50I 2DE5A 1ZB8A 2HF1A 5CM2M 4A3DI 2JA8I 2B63I 3HOXI 2E2JI 4Y52I 2NVYI 4NB8A 5FLMI 2JR6A 4A3CI 1WCMI 4QTUA 2R92I 3HOWI 3S15I 2DE7A 4NBCA 4A3JI 1ML8A 1RLYA 2F4MA 1USPA 1I3QI 4A3KI 3S1RI 3S2HI 2P3YA 4A3II 3GTGI 2DE6A 3I4NI 2VUMI 3PO3S 4A3EI 1L1OC 3RZDI 3GTKI 4A3FI 3M4OI 1TWGI 1TWCI 3S1NI 3GTQI 5C4JI 1ZB9A 4BBSI 1RO4A 1LQLA 1WW9A 2F4OA 2JA5I 5IP9I 1TFIA 1X3WA 3I07A 3VMHA 4A3GI 4BBRI 3GTLI 2KPIA 2JNYA 3GTOI 1TWHI 2E2II
chains in the Genus database with same CATH superfamily
3H3VJ 3JAMf 3U50C 3PO2I 2R93I 4RV9A 1RQFA 3G4SZ 5T67A 2VPXA 4E33A 2LFUA 3EEDA 3OW2Z 2Q4ZA 3TDHB 4A3BI 2PK7A 3HOYI 1Q7Y1 3IFUA 3S16I 3S1QI 3CCJ1 1W2BY 2RBLA 4NBBA 4E31A 3BG0B 3G6E1 3I561 3HOUI 1ZH1A 3CQZI 1YIJZ 3K7AI 1VQPZ 3G4S1 4NBAA 1Y8CA 2JIRA 3J81b 1RNIA 1M901 3GTJI 4E2ZA 2AYDA 1Q7Y2 3VB9A 4A93I 1Y1VS 3VTNA 3KIHA 2JA6I 3GTMI 2JUBA 1Y1WI 1I6HI 3MZLB 2RT9A 3NDJA 1QVGZ 1YIJ1 2JIMA 4TNUA 3QWUA 1VQP1 2HF1A 3HOXI 2E2JI 1M902 2NVYI 3CCRZ 2PMZA 3OW2Y 3CXCY 4RVGA 2GTHA 3HOWI 3NH4A 2QA4Z 4A3JI 1ML8A 2F4MA 1K731 1I3QI 4E2XA 3S1RI 1YUKA 3J7A4 1L1OC 2VPWA 4A3FI 3M4OI 1TWGI 1VQ6Z 2OOYB 3J80f 3CCSZ 3CCR1 1RO2A 4MD7A 2JIQA 2QA41 1Q811 1NJI1 2JMOA 3CC7Z 5IP7I 5D1OB 1VQKZ 4RS4A 1Q821 3CMEZ 1VQ8Z 1QVGY 1JJ2Z 1Q862 2GTIA 1VQ61 3CCS1 3S1MI 3S2DI 4NH1C 3PO3I 1YITZ 2RIQA 1YUAA 1K8A1 4S1TA 1M1K1 2Q51A 3HOZI 2V3VA 2IZ4A 4NBHA 4X6AI 4NBGA 3CC71 2VPYA 1Q822 1VQK1 2OOXB 3CME1 3ESWA 1VQ81 1N2FA 3FQMA 3S17I 1VQLZ 2V8KA 3CCEZ 1VQ5Z 2PM9A 3CCQ1 4MD9A 4BY7I 1K8A2 1YIT1 5IT9f 1M1K2 1SFOI 1FDIA 3CPWZ 1KC81 3IX0A 3GCFA 1VQNZ 2NVTI 3D2LA 3F3FC 4NB9A 2JA7I 1TWAI 3CCLZ 4Y7NI 3IR7A 1Y1VI 5D1OA 3Q87A 2DE5A 1X0TA 2JIPA 2RHBA 4NB8A 1VQL1 3CCE1 1VQ51 1VQ4Z 1KC82 3S15I 4RVDA 2DE7A 4AYBA 4NBCA 5FLXf 1VQN1 4A3KI 1YJ9Z 3CCL1 3GTKI 2W03A 3CCMZ 1JWHC 1ZB9A 4BBSI 2VPZA 1RO4A 1VQ41 3MONA 1Z01A 2IZ3A 1LQLA 1WW9A 2QEXZ 1QF8A 2JA5I 2V45A 5IP9I 3I07A 2GU2A 3VMHA 3I55Z 4E2WA 2I3CA 3GTLI 2JNYA 3GTOI 1TWHI 3G71Z 2E2II 1KRLA 3KIFA 1YJ91 4NBDA 3CMAZ 1YI2Z 3VMGA 1KQSZ 1TWFI 4EWCA 3HOVI 5C4XI 1K83I 1QYPA 1VLAA 3HKZA 1P9NA 1Q861 3H0GI 3D6WA 2YU9I 3CD6Z 4XX2A 4BXXI 2EGTA 2RPRA 2QEX1 2LEXA 3JAMb 3I551 3I4MI 3LUSA 2JS4A 1WIIA 2M6NA 2OTJZ 4MH4A 4DGLA 1Z02A 5T64A 3G711 3T4NB 1WZNA 4MD8A 3CMA1 1YI21 2Y0SA 2JIOA 1VQMZ 2LIYA 3VMIA 5IT9b 2J6AA 3CC2Z 3GKQA 3CD61 1K9M2 2G2KA 2V8IA 1AA6A 4HGZA 2OTLZ 3FKII 2QKDA 5C44I 2E9HA 2BJOA 4QTTA 4A3DI 5CM2M 3NFZA 1VQM1 2K3RA 3P5JB 5FLMI 3IF8A 1FDOA 4A3CI 2O4HA 3NH5A 4QTUA 3CC21 2E7ZA 4MONA 2O53A 3CCUZ 1QXFA 2VF1A 5LL6f 2IV2X 3F3PC 2P3YA 5A2Qf 3NH8A 1RO0A 2W04A 3I4NI 3PO3S 3S1NI 3GTQI 1VQOZ 1JJ2Y 2YADA 3CXCZ 1S72Z 4E2YA 2F4OA 3CCU1 1KD12 3MZKB 4DK1A 4E32A 2HU9A 1VQ7Z 2WAQA 3FQQA 4E30A 3J80b 1YJWZ 3RZOI 1VQO1 4RVHA 4CL1A 4NFRA 4MXUA 5C3EI 1S721 2M48A 1DL6A 3CCVZ 4BY1I 3EERA 4A3LI 4HH4A 4NOZA 3GTPI 3CPWY 4DQYB 1USPB 1SIWA 2VUGA 3S14I 1VQ71 2R6MA 4A3MI 5D1PA 1Q16A 2NVQI 1NUIA 4HGYA 2NVXI 1YJW1 3D9XA 2K5RA 4NBFA 3CCM1 2QREB 1N8R1 1QVFZ 3BG1B 2E2HI 3CCV1 2AKLA 1X3ZA 2WB1A 3GTMS 3J81f 2R7ZI 1K9M1 1R9TI 2V8JA 4NBEA 3M3YI 1PFTA 1VQ9Z 1NP6A 3NDIA 1I50I 1ZB8A 5T6BA 1YHQZ 2JA8I 2B63I 1YJNZ 4Y52I 2JR6A 1N8R2 2QRDB 1WCMI 2QR1B 2R92I 2OZKA 5A2Qb 1K732 1W2BZ 1RLYA 3CC4Z 4MRIA 1USPA 2KI7B 3S2HI 2OTJ1 4A3II 3GTGI 2P28A 1VQ91 2DE6A 4A3EI 3RZDI 1TWCI 1KQSY 3TE5B 2H85A 5C4JI 2QRCB 1YHQ1 2QLVB 3CCQZ 1YJN1 1S7MA 1Q812 1Z03A 1NJI2 1QVFY 4RVFA 1TFIA 1X3WA 5FLXb 2ZAEB 2NAPA 1WJ2A 4A3GI 3CCJZ 4BBRI 5AN9F 2KPIA 3CC41 2OTL1 3G6EZ 2VUMI 3I56Z 1KD11
chains in the Genus database with same CATH topology
3H3VJ 3JAMf 3U50C 3PO2I 2R93I 4RV9A 1RQFA 3G4SZ 5T67A 4E33A 2LFUA 3EEDA 3OW2Z 2Q4ZA 3TDHB 4A3BI 2PK7A 3HOYI 1Q7Y1 3IFUA 3S16I 3S1QI 3CCJ1 1W2BY 2RBLA 4NBBA 4E31A 3BG0B 3G6E1 3I561 3HOUI 1ZH1A 3CQZI 1YIJZ 3K7AI 1VQPZ 3G4S1 4NBAA 3J81b 1RNIA 1M901 3GTJI 4E2ZA 1Q7Y2 3VB9A 4A93I 1Y1VS 3VTNA 3KIHA 2JA6I 3GTMI 2JUBA 1Y1WI 1I6HI 3MZLB 2RT9A 3NDJA 1QVGZ 1YIJ1 4TNUA 3QWUA 1VQP1 2HF1A 3HOXI 2E2JI 1M902 2NVYI 3CCRZ 2PMZA 3OW2Y 3CXCY 4RVGA 2GTHA 3HOWI 3NH4A 2QA4Z 4A3JI 1ML8A 2F4MA 1K731 1I3QI 4E2XA 3S1RI 1YUKA 3J7A4 1L1OC 4A3FI 3M4OI 1TWGI 1VQ6Z 2OOYB 3J80f 3CCSZ 3CCR1 1RO2A 4MD7A 2QA41 1Q811 1NJI1 2JMOA 3CC7Z 5IP7I 5D1OB 1VQKZ 4RS4A 1Q821 3CMEZ 1VQ8Z 1QVGY 1JJ2Z 1Q862 2GTIA 1VQ61 3CCS1 3S1MI 3S2DI 4NH1C 3PO3I 1YITZ 2RIQA 1YUAA 1K8A1 4S1TA 1M1K1 2Q51A 3HOZI 2IZ4A 4NBHA 4X6AI 4NBGA 3CC71 1Q822 1VQK1 2OOXB 3CME1 3ESWA 1VQ81 1N2FA 3FQMA 3S17I 1VQLZ 2V8KA 3CCEZ 1VQ5Z 2PM9A 3CCQ1 4MD9A 4BY7I 1K8A2 1YIT1 5IT9f 1M1K2 1SFOI 3CPWZ 1KC81 3IX0A 3GCFA 1VQNZ 2NVTI 3F3FC 4NB9A 2JA7I 1TWAI 3CCLZ 4Y7NI 1Y1VI 5D1OA 3Q87A 2DE5A 1X0TA 2RHBA 4NB8A 1VQL1 3CCE1 1VQ51 1VQ4Z 1KC82 3S15I 4RVDA 2DE7A 4AYBA 4NBCA 5FLXf 1VQN1 4A3KI 1YJ9Z 3CCL1 3GTKI 2W03A 3CCMZ 1JWHC 1ZB9A 4BBSI 1VQ41 1RO4A 3MONA 1Z01A 2IZ3A 1LQLA 1WW9A 2QEXZ 1QF8A 2JA5I 5IP9I 3I07A 2GU2A 3VMHA 3I55Z 4E2WA 2I3CA 3GTLI 2JNYA 3GTOI 1TWHI 3G71Z 2E2II 1KRLA 3KIFA 1YJ91 4NBDA 3CMAZ 1YI2Z 3VMGA 1KQSZ 1TWFI 4EWCA 3HOVI 5C4XI 1K83I 1QYPA 1VLAA 3HKZA 1P9NA 1Q861 3H0GI 3D6WA 2YU9I 3CD6Z 4XX2A 4BXXI 2EGTA 2RPRA 2QEX1 3JAMb 3I551 3I4MI 3LUSA 2JS4A 1WIIA 2M6NA 2OTJZ 4MH4A 4DGLA 1Z02A 5T64A 3G711 3T4NB 4MD8A 3CMA1 1YI21 2Y0SA 1VQMZ 2LIYA 3VMIA 5IT9b 2J6AA 3CC2Z 3GKQA 3CD61 1K9M2 2G2KA 2V8IA 4HGZA 2OTLZ 3FKII 2QKDA 5C44I 2E9HA 2BJOA 4QTTA 4A3DI 5CM2M 3NFZA 1VQM1 2K3RA 3P5JB 5FLMI 3IF8A 4A3CI 2O4HA 3NH5A 4QTUA 3CC21 4MONA 2O53A 3CCUZ 2VF1A 5LL6f 3F3PC 2P3YA 5A2Qf 3NH8A 1RO0A 2W04A 3I4NI 3PO3S 3S1NI 3GTQI 1VQOZ 1JJ2Y 2YADA 3CXCZ 1S72Z 4E2YA 2F4OA 3CCU1 1KD12 3MZKB 4DK1A 4E32A 2HU9A 1VQ7Z 2WAQA 3FQQA 4E30A 3J80b 1YJWZ 3RZOI 1VQO1 4RVHA 4CL1A 4NFRA 4MXUA 5C3EI 1S721 2M48A 1DL6A 3CCVZ 4BY1I 3EERA 4A3LI 4HH4A 4NOZA 3GTPI 3CPWY 4DQYB 1USPB 2VUGA 3S14I 1VQ71 2R6MA 4A3MI 5D1PA 2NVQI 1NUIA 4HGYA 2NVXI 1YJW1 3D9XA 2K5RA 4NBFA 3CCM1 2QREB 1N8R1 1QVFZ 3BG1B 2E2HI 3CCV1 2AKLA 1X3ZA 2WB1A 3GTMS 3J81f 2R7ZI 1K9M1 1R9TI 2V8JA 4NBEA 3M3YI 1PFTA 1VQ9Z 1NP6A 3NDIA 1I50I 1ZB8A 5T6BA 1YHQZ 2JA8I 2B63I 1YJNZ 4Y52I 2JR6A 1N8R2 2QRDB 1WCMI 2QR1B 2R92I 2OZKA 5A2Qb 1K732 1W2BZ 1RLYA 3CC4Z 4MRIA 2KI7B 1USPA 3S2HI 2OTJ1 4A3II 3GTGI 2P28A 1VQ91 2DE6A 4A3EI 3RZDI 1TWCI 1KQSY 3TE5B 2H85A 5C4JI 2QRCB 1YHQ1 2QLVB 3CCQZ 1YJN1 1S7MA 1Q812 1Z03A 1NJI2 1QVFY 4RVFA 1TFIA 1X3WA 5FLXb 2ZAEB 4A3GI 3CCJZ 4BBRI 5AN9F 2KPIA 3CC41 2OTL1 3G6EZ 2VUMI 3I56Z 1KD11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  3H3V J;  3U50 C;  3PO2 I;  2R93 I;  4NBD A;  3VMG A;  1TWF I;  3HOV I;  5C4X I;  1K83 I;  1QYP A;  1VLA A;  3RZO I;  5C3E I;  3S1M I;  3S2D I;  3H0G I;  3D6W A;  3PO3 I;  2YU9 I;  1YUA A;  4A3B I;  4XX2 A;  2PK7 A;  4BXX I;  1DL6 A;  4BY1 I;  3EER A;  4A3L I;  3HOY I;  3S16 I;  4NOZ A;  3HOZ I;  3GTP I;  3S1Q I;  1USP B;  2RBL A;  4NBB A;  4NBH A;  3I4M I;  3LUS A;  2JS4 A;  3S14 I;  4MH4 A;  4X6A I;  4NBG A;  4A3M I;  3HOU I;  3CQZ I;  3K7A I;  2NVQ I;  1NUI A;  3ESW A;  4NBA A;  2NVX I;  1N2F A;  3S17 I;  2K5R A;  3VMI A;  4NBF A;  2J6A A;  4BY7 I;  3GTJ I;  3GKQ A;  2E2H I;  1SFO I;  2AKL A;  1X3Z A;  3GTM S;  2R7Z I;  3VB9 A;  4A93 I;  1R9T I;  3FKI I;  1Y1V S;  5C44 I;  4NBE A;  3GCF A;  2JA6 I;  2NVT I;  3M3Y I;  2BJO A;  3GTM I;  4NB9 A;  2JA7 I;  1PFT A;  1TWA I;  4Y7N I;  1Y1W I;  1I6H I;  1Y1V I;  3Q87 A;  4QTT A;  1I50 I;  2DE5 A;  1ZB8 A;  2HF1 A;  5CM2 M;  4A3D I;  2JA8 I;  2B63 I;  3HOX I;  2E2J I;  4Y52 I;  2NVY I;  4NB8 A;  5FLM I;  2JR6 A;  4A3C I;  1WCM I;  4QTU A;  2R92 I;  3HOW I;  3S15 I;  2DE7 A;  4NBC A;  4A3J I;  1ML8 A;  1RLY A;  2F4M A;  1USP A;  1I3Q I;  4A3K I;  3S1R I;  3S2H I;  2P3Y A;  4A3I I;  3GTG I;  2DE6 A;  3I4N I;  2VUM I;  3PO3 S;  4A3E I;  1L1O C;  3RZD I;  3GTK I;  4A3F I;  3M4O I;  1TWG I;  1TWC I;  3S1N I;  3GTQ I;  5C4J I;  1ZB9 A;  4BBS I;  1RO4 A;  1LQL A;  1WW9 A;  2F4O A;  2JA5 I;  5IP9 I;  1TFI A;  1X3W A;  3I07 A;  3VMH A;  4A3G I;  4BBR I;  3GTL I;  2KPI A;  2JNY A;  3GTO I;  1TWH I;  2E2I I; 
#chains in the Genus database with same CATH topology
 3H3V J;  3JAM f;  3U50 C;  3PO2 I;  2R93 I;  4RV9 A;  1RQF A;  3G4S Z;  5T67 A;  2VPX A;  4E33 A;  2LFU A;  3EED A;  3OW2 Z;  2Q4Z A;  3TDH B;  4A3B I;  2PK7 A;  3HOY I;  1Q7Y 1;  3IFU A;  3S16 I;  3S1Q I;  3CCJ 1;  1W2B Y;  2RBL A;  4NBB A;  4E31 A;  3BG0 B;  3G6E 1;  3I56 1;  3HOU I;  1ZH1 A;  3CQZ I;  1YIJ Z;  3K7A I;  1VQP Z;  3G4S 1;  4NBA A;  1Y8C A;  2JIR A;  3J81 b;  1RNI A;  1M90 1;  3GTJ I;  4E2Z A;  2AYD A;  1Q7Y 2;  3VB9 A;  4A93 I;  1Y1V S;  3VTN A;  3KIH A;  2JA6 I;  3GTM I;  2JUB A;  1Y1W I;  1I6H I;  3MZL B;  2RT9 A;  3NDJ A;  1QVG Z;  1YIJ 1;  2JIM A;  4TNU A;  3QWU A;  1VQP 1;  2HF1 A;  3HOX I;  2E2J I;  1M90 2;  2NVY I;  3CCR Z;  2PMZ A;  3OW2 Y;  3CXC Y;  4RVG A;  2GTH A;  3HOW I;  3NH4 A;  2QA4 Z;  4A3J I;  1ML8 A;  2F4M A;  1K73 1;  1I3Q I;  4E2X A;  3S1R I;  1YUK A;  3J7A 4;  1L1O C;  2VPW A;  4A3F I;  3M4O I;  1TWG I;  1VQ6 Z;  2OOY B;  3J80 f;  3CCS Z;  3CCR 1;  1RO2 A;  4MD7 A;  2JIQ A;  2QA4 1;  1Q81 1;  1NJI 1;  2JMO A;  3CC7 Z;  5IP7 I;  5D1O B;  1VQK Z;  4RS4 A;  1Q82 1;  3CME Z;  1VQ8 Z;  1QVG Y;  1JJ2 Z;  1Q86 2;  2GTI A;  1VQ6 1;  3CCS 1;  3S1M I;  3S2D I;  4NH1 C;  3PO3 I;  1YIT Z;  2RIQ A;  1YUA A;  1K8A 1;  4S1T A;  1M1K 1;  2Q51 A;  3HOZ I;  2V3V A;  2IZ4 A;  4NBH A;  4X6A I;  4NBG A;  3CC7 1;  2VPY A;  1Q82 2;  1VQK 1;  2OOX B;  3CME 1;  3ESW A;  1VQ8 1;  1N2F A;  3FQM A;  3S17 I;  1VQL Z;  2V8K A;  3CCE Z;  1VQ5 Z;  2PM9 A;  3CCQ 1;  4MD9 A;  4BY7 I;  1K8A 2;  1YIT 1;  5IT9 f;  1M1K 2;  1SFO I;  1FDI A;  3CPW Z;  1KC8 1;  3IX0 A;  3GCF A;  1VQN Z;  2NVT I;  3D2L A;  3F3F C;  4NB9 A;  2JA7 I;  1TWA I;  3CCL Z;  4Y7N I;  3IR7 A;  1Y1V I;  5D1O A;  3Q87 A;  2DE5 A;  1X0T A;  2JIP A;  2RHB A;  4NB8 A;  1VQL 1;  3CCE 1;  1VQ5 1;  1VQ4 Z;  1KC8 2;  3S15 I;  4RVD A;  2DE7 A;  4AYB A;  4NBC A;  5FLX f;  1VQN 1;  4A3K I;  1YJ9 Z;  3CCL 1;  3GTK I;  2W03 A;  3CCM Z;  1JWH C;  1ZB9 A;  4BBS I;  2VPZ A;  1RO4 A;  1VQ4 1;  3MON A;  1Z01 A;  2IZ3 A;  1LQL A;  1WW9 A;  2QEX Z;  1QF8 A;  2JA5 I;  2V45 A;  5IP9 I;  3I07 A;  2GU2 A;  3VMH A;  3I55 Z;  4E2W A;  2I3C A;  3GTL I;  2JNY A;  3GTO I;  1TWH I;  3G71 Z;  2E2I I;  1KRL A;  3KIF A;  1YJ9 1;  4NBD A;  3CMA Z;  1YI2 Z;  3VMG A;  1KQS Z;  1TWF I;  4EWC A;  3HOV I;  5C4X I;  1K83 I;  1QYP A;  1VLA A;  3HKZ A;  1P9N A;  1Q86 1;  3H0G I;  3D6W A;  2YU9 I;  3CD6 Z;  4XX2 A;  4BXX I;  2EGT A;  2RPR A;  2QEX 1;  2LEX A;  3JAM b;  3I55 1;  3I4M I;  3LUS A;  2JS4 A;  1WII A;  2M6N A;  2OTJ Z;  4MH4 A;  4DGL A;  1Z02 A;  5T64 A;  3G71 1;  3T4N B;  1WZN A;  4MD8 A;  3CMA 1;  1YI2 1;  2Y0S A;  2JIO A;  1VQM Z;  2LIY A;  3VMI A;  5IT9 b;  2J6A A;  3CC2 Z;  3GKQ A;  3CD6 1;  1K9M 2;  2G2K A;  2V8I A;  1AA6 A;  4HGZ A;  2OTL Z;  3FKI I;  2QKD A;  5C44 I;  2E9H A;  2BJO A;  4QTT A;  4A3D I;  5CM2 M;  3NFZ A;  1VQM 1;  2K3R A;  3P5J B;  5FLM I;  3IF8 A;  1FDO A;  4A3C I;  2O4H A;  3NH5 A;  4QTU A;  3CC2 1;  2E7Z A;  4MON A;  2O53 A;  3CCU Z;  1QXF A;  2VF1 A;  5LL6 f;  2IV2 X;  3F3P C;  2P3Y A;  5A2Q f;  3NH8 A;  1RO0 A;  2W04 A;  3I4N I;  3PO3 S;  3S1N I;  3GTQ I;  1VQO Z;  1JJ2 Y;  2YAD A;  3CXC Z;  1S72 Z;  4E2Y A;  2F4O A;  3CCU 1;  1KD1 2;  3MZK B;  4DK1 A;  4E32 A;  2HU9 A;  1VQ7 Z;  2WAQ A;  3FQQ A;  4E30 A;  3J80 b;  1YJW Z;  3RZO I;  1VQO 1;  4RVH A;  4CL1 A;  4NFR A;  4MXU A;  5C3E I;  1S72 1;  2M48 A;  1DL6 A;  3CCV Z;  4BY1 I;  3EER A;  4A3L I;  4HH4 A;  4NOZ A;  3GTP I;  3CPW Y;  4DQY B;  1USP B;  1SIW A;  2VUG A;  3S14 I;  1VQ7 1;  2R6M A;  4A3M I;  5D1P A;  1Q16 A;  2NVQ I;  1NUI A;  4HGY A;  2NVX I;  1YJW 1;  3D9X A;  2K5R A;  4NBF A;  3CCM 1;  2QRE B;  1N8R 1;  1QVF Z;  3BG1 B;  2E2H I;  3CCV 1;  2AKL A;  1X3Z A;  2WB1 A;  3GTM S;  3J81 f;  2R7Z I;  1K9M 1;  1R9T I;  2V8J A;  4NBE A;  3M3Y I;  1PFT A;  1VQ9 Z;  1NP6 A;  3NDI A;  1I50 I;  1ZB8 A;  5T6B A;  1YHQ Z;  2JA8 I;  2B63 I;  1YJN Z;  4Y52 I;  2JR6 A;  1N8R 2;  2QRD B;  1WCM I;  2QR1 B;  2R92 I;  2OZK A;  5A2Q b;  1K73 2;  1W2B Z;  1RLY A;  3CC4 Z;  4MRI A;  1USP A;  2KI7 B;  3S2H I;  2OTJ 1;  4A3I I;  3GTG I;  2P28 A;  1VQ9 1;  2DE6 A;  4A3E I;  3RZD I;  1TWC I;  1KQS Y;  3TE5 B;  2H85 A;  5C4J I;  2QRC B;  1YHQ 1;  2QLV B;  3CCQ Z;  1YJN 1;  1S7M A;  1Q81 2;  1Z03 A;  1NJI 2;  1QVF Y;  4RVF A;  1TFI A;  1X3W A;  5FLX b;  2ZAE B;  2NAP A;  1WJ2 A;  4A3G I;  3CCJ Z;  4BBR I;  5AN9 F;  2KPI A;  3CC4 1;  2OTL 1;  3G6E Z;  2VUM I;  3I56 Z;  1KD1 1; 
#chains in the Genus database with same CATH homology
 3H3V J;  3JAM f;  3U50 C;  3PO2 I;  2R93 I;  4RV9 A;  1RQF A;  3G4S Z;  5T67 A;  4E33 A;  2LFU A;  3EED A;  3OW2 Z;  2Q4Z A;  3TDH B;  4A3B I;  2PK7 A;  3HOY I;  1Q7Y 1;  3IFU A;  3S16 I;  3S1Q I;  3CCJ 1;  1W2B Y;  2RBL A;  4NBB A;  4E31 A;  3BG0 B;  3G6E 1;  3I56 1;  3HOU I;  1ZH1 A;  3CQZ I;  1YIJ Z;  3K7A I;  1VQP Z;  3G4S 1;  4NBA A;  3J81 b;  1RNI A;  1M90 1;  3GTJ I;  4E2Z A;  1Q7Y 2;  3VB9 A;  4A93 I;  1Y1V S;  3VTN A;  3KIH A;  2JA6 I;  3GTM I;  2JUB A;  1Y1W I;  1I6H I;  3MZL B;  2RT9 A;  3NDJ A;  1QVG Z;  1YIJ 1;  4TNU A;  3QWU A;  1VQP 1;  2HF1 A;  3HOX I;  2E2J I;  1M90 2;  2NVY I;  3CCR Z;  2PMZ A;  3OW2 Y;  3CXC Y;  4RVG A;  2GTH A;  3HOW I;  3NH4 A;  2QA4 Z;  4A3J I;  1ML8 A;  2F4M A;  1K73 1;  1I3Q I;  4E2X A;  3S1R I;  1YUK A;  3J7A 4;  1L1O C;  4A3F I;  3M4O I;  1TWG I;  1VQ6 Z;  2OOY B;  3J80 f;  3CCS Z;  3CCR 1;  1RO2 A;  4MD7 A;  2QA4 1;  1Q81 1;  1NJI 1;  2JMO A;  3CC7 Z;  5IP7 I;  5D1O B;  1VQK Z;  4RS4 A;  1Q82 1;  3CME Z;  1VQ8 Z;  1QVG Y;  1JJ2 Z;  1Q86 2;  2GTI A;  1VQ6 1;  3CCS 1;  3S1M I;  3S2D I;  4NH1 C;  3PO3 I;  1YIT Z;  2RIQ A;  1YUA A;  1K8A 1;  4S1T A;  1M1K 1;  2Q51 A;  3HOZ I;  2IZ4 A;  4NBH A;  4X6A I;  4NBG A;  3CC7 1;  1Q82 2;  1VQK 1;  2OOX B;  3CME 1;  3ESW A;  1VQ8 1;  1N2F A;  3FQM A;  3S17 I;  1VQL Z;  2V8K A;  3CCE Z;  1VQ5 Z;  2PM9 A;  3CCQ 1;  4MD9 A;  4BY7 I;  1K8A 2;  1YIT 1;  5IT9 f;  1M1K 2;  1SFO I;  3CPW Z;  1KC8 1;  3IX0 A;  3GCF A;  1VQN Z;  2NVT I;  3F3F C;  4NB9 A;  2JA7 I;  1TWA I;  3CCL Z;  4Y7N I;  1Y1V I;  5D1O A;  3Q87 A;  2DE5 A;  1X0T A;  2RHB A;  4NB8 A;  1VQL 1;  3CCE 1;  1VQ5 1;  1VQ4 Z;  1KC8 2;  3S15 I;  4RVD A;  2DE7 A;  4AYB A;  4NBC A;  5FLX f;  1VQN 1;  4A3K I;  1YJ9 Z;  3CCL 1;  3GTK I;  2W03 A;  3CCM Z;  1JWH C;  1ZB9 A;  4BBS I;  1VQ4 1;  1RO4 A;  3MON A;  1Z01 A;  2IZ3 A;  1LQL A;  1WW9 A;  2QEX Z;  1QF8 A;  2JA5 I;  5IP9 I;  3I07 A;  2GU2 A;  3VMH A;  3I55 Z;  4E2W A;  2I3C A;  3GTL I;  2JNY A;  3GTO I;  1TWH I;  3G71 Z;  2E2I I;  1KRL A;  3KIF A;  1YJ9 1;  4NBD A;  3CMA Z;  1YI2 Z;  3VMG A;  1KQS Z;  1TWF I;  4EWC A;  3HOV I;  5C4X I;  1K83 I;  1QYP A;  1VLA A;  3HKZ A;  1P9N A;  1Q86 1;  3H0G I;  3D6W A;  2YU9 I;  3CD6 Z;  4XX2 A;  4BXX I;  2EGT A;  2RPR A;  2QEX 1;  3JAM b;  3I55 1;  3I4M I;  3LUS A;  2JS4 A;  1WII A;  2M6N A;  2OTJ Z;  4MH4 A;  4DGL A;  1Z02 A;  5T64 A;  3G71 1;  3T4N B;  4MD8 A;  3CMA 1;  1YI2 1;  2Y0S A;  1VQM Z;  2LIY A;  3VMI A;  5IT9 b;  2J6A A;  3CC2 Z;  3GKQ A;  3CD6 1;  1K9M 2;  2G2K A;  2V8I A;  4HGZ A;  2OTL Z;  3FKI I;  2QKD A;  5C44 I;  2E9H A;  2BJO A;  4QTT A;  4A3D I;  5CM2 M;  3NFZ A;  1VQM 1;  2K3R A;  3P5J B;  5FLM I;  3IF8 A;  4A3C I;  2O4H A;  3NH5 A;  4QTU A;  3CC2 1;  4MON A;  2O53 A;  3CCU Z;  2VF1 A;  5LL6 f;  3F3P C;  2P3Y A;  5A2Q f;  3NH8 A;  1RO0 A;  2W04 A;  3I4N I;  3PO3 S;  3S1N I;  3GTQ I;  1VQO Z;  1JJ2 Y;  2YAD A;  3CXC Z;  1S72 Z;  4E2Y A;  2F4O A;  3CCU 1;  1KD1 2;  3MZK B;  4DK1 A;  4E32 A;  2HU9 A;  1VQ7 Z;  2WAQ A;  3FQQ A;  4E30 A;  3J80 b;  1YJW Z;  3RZO I;  1VQO 1;  4RVH A;  4CL1 A;  4NFR A;  4MXU A;  5C3E I;  1S72 1;  2M48 A;  1DL6 A;  3CCV Z;  4BY1 I;  3EER A;  4A3L I;  4HH4 A;  4NOZ A;  3GTP I;  3CPW Y;  4DQY B;  1USP B;  2VUG A;  3S14 I;  1VQ7 1;  2R6M A;  4A3M I;  5D1P A;  2NVQ I;  1NUI A;  4HGY A;  2NVX I;  1YJW 1;  3D9X A;  2K5R A;  4NBF A;  3CCM 1;  2QRE B;  1N8R 1;  1QVF Z;  3BG1 B;  2E2H I;  3CCV 1;  2AKL A;  1X3Z A;  2WB1 A;  3GTM S;  3J81 f;  2R7Z I;  1K9M 1;  1R9T I;  2V8J A;  4NBE A;  3M3Y I;  1PFT A;  1VQ9 Z;  1NP6 A;  3NDI A;  1I50 I;  1ZB8 A;  5T6B A;  1YHQ Z;  2JA8 I;  2B63 I;  1YJN Z;  4Y52 I;  2JR6 A;  1N8R 2;  2QRD B;  1WCM I;  2QR1 B;  2R92 I;  2OZK A;  5A2Q b;  1K73 2;  1W2B Z;  1RLY A;  3CC4 Z;  4MRI A;  2KI7 B;  1USP A;  3S2H I;  2OTJ 1;  4A3I I;  3GTG I;  2P28 A;  1VQ9 1;  2DE6 A;  4A3E I;  3RZD I;  1TWC I;  1KQS Y;  3TE5 B;  2H85 A;  5C4J I;  2QRC B;  1YHQ 1;  2QLV B;  3CCQ Z;  1YJN 1;  1S7M A;  1Q81 2;  1Z03 A;  1NJI 2;  1QVF Y;  4RVF A;  1TFI A;  1X3W A;  5FLX b;  2ZAE B;  4A3G I;  3CCJ Z;  4BBR I;  5AN9 F;  2KPI A;  3CC4 1;  2OTL 1;  3G6E Z;  2VUM I;  3I56 Z;  1KD1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...