2NVTI

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvtI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvtI02
3PO3S 3PO2I 2JA5I 4MH4A 1ZB8A 3I4NI 1N2FA 3HOWI 3D6WA 2PK7A 5IP9I 1YUAA 5CM2M 5C4XI 1Y1VI 3GTLI 2R93I 3CQZI 3S1NI 5FLMI 4A3JI 3VB9A 1R9TI 2JA6I 2JA8I 1USPB 2E2HI 1Y1VS 2JR6A 4A3MI 2HF1A 2NVXI 3S1QI 5C4JI 3GTOI 4XX2A 4BXXI 2E2II 3S15I 2J6AA 3RZDI 2E2JI 3GTKI 4NBEA 1L1OC 3S1MI 4NBGA 2R7ZI 1RO4A 4A3DI 3H3VJ 4NBAA 4BBRI 1TWFI 1ML8A 3Q87A 2P3YA 3HOUI 3HOZI 2JS4A 2DE5A 1ZB9A 1X3WA 3HOYI 3GTMI 4A3FI 2RBLA 4NBFA 5C44I 1WW9A 4NBHA 3U50C 3RZOI 4A3CI 4Y52I 1NUIA 3K7AI 1TFIA 4A3BI 3GTMS 3GTGI 3VMHA 1TWGI 4A3II 4A3KI 4QTTA 4BY7I 3I4MI 3GCFA 1WCMI 3M3YI 3S17I 3ESWA 3S2HI 4Y7NI 3GTPI 4NBDA 5IP7I 1LQLA 4BY1I 1X3ZA 2F4OA 1USPA 2NVQI 3S2DI 1K83I 2NVYI 4NB9A 3GTQI 3I07A 2DE7A 3HOXI 4BBSI 1TWHI 1TWAI 1VLAA 4A3LI 4A93I 3VMIA 2VUMI 4NB8A 3LUSA 1I50I 2JA7I 2K5RA 4NBBA 3H0GI 3M4OI 3EERA 3S14I 3S1RI 2F4MA 4A3EI 4NOZA 1I6HI 3VMGA 1QYPA 5C3EI 1Y1WI 3GKQA 1PFTA 2AKLA 1RLYA 4QTUA 2DE6A 1SFOI 1TWCI 2NVTI 2KPIA 2YU9I 3S16I 2BJOA 3PO3I 2JNYA 2R92I 2B63I 4X6AI 3FKII 4NBCA 4A3GI 1DL6A 1I3QI 3GTJI 3HOVI
chains in the Genus database with same CATH superfamily
2Y0SA 1SIWA 2JA5I 3I4NI 3D6WA 1QVFY 2PK7A 5IP9I 1NJI1 3VTNA 1YUAA 1M902 1VQ71 2R93I 2JA8I 3JAMf 2NVXI 5A2Qf 1YITZ 3CC21 3CD61 2KI7B 2ZAEB 3GTKI 3MONA 1S7MA 4NBGA 4E2WA 1YI2Z 1VQPZ 3FQQA 3I55Z 1ML8A 3NH5A 3Q87A 3HOUI 3OW2Y 3CC7Z 1ZB9A 1YJNZ 2GTIA 1KC82 3HOYI 2Q4ZA 5C44I 4NBHA 3U50C 1M1K2 4Y52I 1TFIA 2W04A 3CC4Z 4EWCA 3CCRZ 2QEX1 4A3II 2HU9A 1RO0A 4QTTA 1JJ2Z 4RVFA 1WCMI 3M3YI 3S17I 3S2HI 3TDHB 4BY1I 1X3ZA 1USPA 1K83I 1AA6A 1Q811 1NJI2 4NB9A 1Q822 2QA4Z 1TWHI 2V8KA 1KQSY 2P28A 2OOYB 3CCQZ 1Z03A 4MD7A 4MXUA 4NBBA 1K9M1 3NDJA 1K732 1W2BY 1YUKA 5C3EI 2OOXB 3MZKB 3G4S1 4QTUA 3G711 2QLVB 1VQOZ 2KPIA 3S16I 2H85A 3MZLB 4A3GI 3GTJI 3CCLZ 3J80b 4MH4A 1ZB8A 1VQ4Z 4DQYB 3I56Z 1KD11 2IV2X 1Y1VI 2E9HA 2RIQA 3IF8A 3KIFA 1YIT1 2OTLZ 3CCJZ 2O4HA 1YJ9Z 3VB9A 1R9TI 5LL6f 1RQFA 1USPB 2E2HI 5IT9b 3GTOI 3S15I 3CCVZ 1VQP1 1YI21 3RZDI 2E2JI 3S1MI 3I551 1KRLA 2E7ZA 3J81f 2JUBA 2R7ZI 3CC71 1RO4A 1Q861 2K3RA 4A3DI 1YJN1 3G6EZ 4BBRI 4HGZA 1K9M2 2WAQA 2JS4A 2RPRA 5A2Qb 3GTMI 4A3FI 1YIJZ 2V8IA 2PMZA 3CC41 1YJWZ 3CCR1 1WW9A 5T64A 1Z01A 3J7A4 1VQKZ 3GTGI 3CCM1 3VMHA 4E33A 4A3KI 4BY7I 3I4MI 2QR1B 3GTPI 2QA41 2VPWA 2NVQI 5D1PA 3CCEZ 4E32A 3CCQ1 2LEXA 1KD12 3F3FC 1N8R1 1WIIA 4A3LI 4A93I 3KIHA 2O53A 3M4OI 1QVGZ 3P5JB 1VQ5Z 2F4MA 4NOZA 1W2BZ 1VQO1 1I6HI 1QYPA 3BG1B 4MD8A 5FLXf 2QREB 2G2KA 2V45A 2V3VA 1Q862 2Q51A 2WB1A 1TWCI 2NVTI 2YU9I 2QRDB 2AYDA 3CMEZ 3CCL1 1VQ6Z 3PO3I 2JNYA 2B63I 4X6AI 1ZH1A 1DL6A 2VF1A 3CCUZ 4RVGA 1I3QI 2VPZA 3I561 1Q7Y1 3TE5B 1N2FA 2OTL1 3HOWI 3CCJ1 3CPWZ 1YJ91 5CM2M 2V8JA 5C4XI 1Y8CA 2I3CA 3CQZI 1VQ8Z 3S1NI 3CMAZ 2LFUA 5FLMI 3CCV1 4MRIA 4E2ZA 1Y1VS 2JR6A 5C4JI 2W03A 3NH8A 2E2II 2J6AA 4MONA 3IR7A 3G6E1 2JIOA 4NBEA 1M901 1JJ2Y 3NFZA 1Q16A 2GTHA 3HKZA 5D1OA 1QVFZ 1YIJ1 1YJW1 3HOZI 4DK1A 1VQLZ 4RVHA 1X3WA 2VPYA 1VQNZ 2OTJZ 3CCSZ 1VQK1 2RBLA 1Q812 5AN9F 4A3CI 2RT9A 3J81b 4A3BI 3GTMS 4MD9A 3F3PC 1TWGI 3CCE1 1KC81 4HH4A 4NBDA 1RO2A 2NVYI 1M1K1 4DGLA 3D2LA 3OW2Z 1RNIA 3JAMb 3I07A 3GTQI 1WZNA 3HOXI 4BBSI 4RVDA 1WJ2A 3NDIA 1VLAA 2VUMI 1VQ51 3LUSA 1I50I 1K8A1 2K5RA 3H0GI 3S14I 4E30A 3CXCY 1Y1WI 1Q821 3GKQA 1PFTA 3CME1 2AKLA 1VQ61 4CL1A 3QWUA 1VQMZ 1QF8A 1Z02A 5D1OB 1VQ9Z 3NH4A 1SFOI 3FQMA 3CCU1 3IFUA 2R92I 3FKII 3T4NB 1K731 1YHQZ 4NFRA 1KQSZ 2JIQA 3HOVI 3PO3S 2LIYA 3PO2I 5T67A 1S72Z 4RS4A 1VQ81 5FLXb 3CMA1 4S1TA 4AYBA 2RHBA 3GTLI 2JIRA 2JMOA 5T6BA 4A3JI 2VUGA 2JA6I 1VQ7Z 4A3MI 2HF1A 3S1QI 4XX2A 4BXXI 1JWHC 2R6MA 2JIPA 1VQ41 1NP6A 1L1OC 3CC2Z 3CD6Z 4RV9A 1VQL1 1K8A2 3H3VJ 2M6NA 3CCMZ 4NBAA 1VQN1 1TWFI 2GU2A 2OTJ1 3CCS1 2P3YA 2DE5A 4E2XA 4NBFA 3RZOI 3D9XA 1NUIA 2QKDA 3K7AI 1QVGY 1N8R2 1FDIA 1QXFA 3GCFA 1X0TA 3ESWA 2M48A 4Y7NI 2NAPA 5IP7I 1LQLA 2QEXZ 2F4OA 2VPXA 2JIMA 3S2DI 2DE7A 1FDOA 1TWAI 2IZ3A 2OZKA 3VMIA 4NB8A 2JA7I 2PM9A 1P9NA 3EERA 3BG0B 4E2YA 3J80f 4NH1C 3S1RI 1VQM1 2IZ4A 2QRCB 4A3EI 3CXCZ 1VQ91 3CPWY 3VMGA 3IX0A 4E31A 1RLYA 1Q7Y2 2DE6A 1YHQ1 4HGYA 2BJOA 4TNUA 2YADA 2EGTA 3G4SZ 4NBCA 1S721 3G71Z 5IT9f 3EEDA
chains in the Genus database with same CATH topology
2Y0SA 2JA5I 3I4NI 3D6WA 1QVFY 2PK7A 5IP9I 1NJI1 3VTNA 1YUAA 1M902 1VQ71 2R93I 2JA8I 3JAMf 2NVXI 5A2Qf 1YITZ 3CC21 3CD61 2KI7B 2ZAEB 3GTKI 3MONA 1S7MA 4NBGA 4E2WA 1YI2Z 1VQPZ 3FQQA 3I55Z 1ML8A 3NH5A 3Q87A 3HOUI 3OW2Y 3CC7Z 1ZB9A 1YJNZ 2GTIA 1KC82 3HOYI 2Q4ZA 5C44I 4NBHA 3U50C 1M1K2 4Y52I 1TFIA 2W04A 3CC4Z 4EWCA 3CCRZ 2QEX1 4A3II 2HU9A 1RO0A 4QTTA 1JJ2Z 4RVFA 1WCMI 3M3YI 3S17I 3S2HI 3TDHB 4BY1I 1X3ZA 1USPA 1K83I 1Q811 1NJI2 4NB9A 1Q822 2QA4Z 1TWHI 2V8KA 1KQSY 2P28A 2OOYB 3CCQZ 1Z03A 4MD7A 4MXUA 4NBBA 1K9M1 3NDJA 1K732 1W2BY 1YUKA 5C3EI 2OOXB 3MZKB 3G4S1 4QTUA 3G711 2QLVB 1VQOZ 2KPIA 3S16I 2H85A 3MZLB 4A3GI 3GTJI 3CCLZ 3J80b 4MH4A 1ZB8A 1VQ4Z 4DQYB 3I56Z 1KD11 1Y1VI 2E9HA 2RIQA 3IF8A 3KIFA 1YIT1 2OTLZ 3CCJZ 2O4HA 1YJ9Z 3VB9A 1R9TI 5LL6f 1RQFA 1USPB 2E2HI 5IT9b 3GTOI 3S15I 3CCVZ 1VQP1 1YI21 3RZDI 2E2JI 3S1MI 3I551 1KRLA 3J81f 2JUBA 2R7ZI 3CC71 1RO4A 1Q861 2K3RA 4A3DI 1YJN1 3G6EZ 4BBRI 4HGZA 1K9M2 2WAQA 2JS4A 2RPRA 5A2Qb 3GTMI 4A3FI 1YIJZ 2V8IA 2PMZA 3CC41 1YJWZ 3CCR1 1WW9A 5T64A 1Z01A 3J7A4 1VQKZ 3GTGI 3CCM1 3VMHA 4E33A 4A3KI 4BY7I 3I4MI 2QR1B 3GTPI 2QA41 2NVQI 5D1PA 3CCEZ 4E32A 3CCQ1 1KD12 3F3FC 1N8R1 1WIIA 4A3LI 4A93I 3KIHA 2O53A 3M4OI 1QVGZ 3P5JB 1VQ5Z 2F4MA 4NOZA 1W2BZ 1VQO1 1I6HI 1QYPA 3BG1B 4MD8A 5FLXf 2QREB 2G2KA 1Q862 2Q51A 2WB1A 1TWCI 2NVTI 2YU9I 2QRDB 3CMEZ 3CCL1 1VQ6Z 3PO3I 2JNYA 2B63I 4X6AI 1ZH1A 1DL6A 2VF1A 3CCUZ 4RVGA 1I3QI 3I561 1Q7Y1 3TE5B 1N2FA 2OTL1 3HOWI 3CCJ1 3CPWZ 1YJ91 5CM2M 2V8JA 5C4XI 2I3CA 3CQZI 1VQ8Z 3S1NI 3CMAZ 2LFUA 5FLMI 3CCV1 4MRIA 4E2ZA 1Y1VS 2JR6A 5C4JI 2W03A 3NH8A 2E2II 2J6AA 4MONA 3G6E1 1M901 4NBEA 1JJ2Y 3NFZA 2GTHA 3HKZA 5D1OA 1QVFZ 1YIJ1 1YJW1 3HOZI 4DK1A 1VQLZ 4RVHA 1X3WA 1VQNZ 2OTJZ 3CCSZ 1VQK1 2RBLA 1Q812 5AN9F 4A3CI 2RT9A 3J81b 4A3BI 3GTMS 4MD9A 3F3PC 1TWGI 3CCE1 1KC81 4HH4A 4NBDA 1RO2A 2NVYI 1M1K1 4DGLA 3OW2Z 1RNIA 3JAMb 3I07A 3GTQI 3HOXI 4BBSI 4RVDA 3NDIA 1VLAA 2VUMI 1VQ51 3LUSA 1I50I 1K8A1 2K5RA 3H0GI 3S14I 4E30A 3CXCY 1Y1WI 1Q821 3GKQA 1PFTA 3CME1 2AKLA 1VQ61 4CL1A 3QWUA 1VQMZ 1QF8A 1Z02A 5D1OB 1VQ9Z 3NH4A 1SFOI 3FQMA 3CCU1 3IFUA 2R92I 3FKII 3T4NB 1K731 1YHQZ 4NFRA 1KQSZ 3HOVI 3PO3S 2LIYA 3PO2I 5T67A 1S72Z 4RS4A 1VQ81 5FLXb 3CMA1 4S1TA 4AYBA 2RHBA 3GTLI 2JMOA 5T6BA 4A3JI 2VUGA 2JA6I 1VQ7Z 4A3MI 2HF1A 3S1QI 4XX2A 4BXXI 1JWHC 2R6MA 1VQ41 1NP6A 1L1OC 3CC2Z 3CD6Z 4RV9A 1VQL1 1K8A2 3H3VJ 2M6NA 3CCMZ 4NBAA 1VQN1 1TWFI 2GU2A 2OTJ1 3CCS1 2P3YA 2DE5A 4E2XA 4NBFA 3RZOI 3D9XA 1NUIA 2QKDA 3K7AI 1QVGY 1N8R2 3GCFA 1X0TA 3ESWA 2M48A 4Y7NI 2QEXZ 5IP7I 1LQLA 2F4OA 3S2DI 2DE7A 1TWAI 2IZ3A 2OZKA 3VMIA 4NB8A 2JA7I 2PM9A 1P9NA 3EERA 3BG0B 4E2YA 3J80f 4NH1C 3S1RI 1VQM1 2IZ4A 1VQ91 2QRCB 3CXCZ 4A3EI 3CPWY 3VMGA 3IX0A 4E31A 1RLYA 1Q7Y2 2DE6A 1YHQ1 4HGYA 2BJOA 4TNUA 2YADA 2EGTA 3G4SZ 4NBCA 1S721 3G71Z 5IT9f 3EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 S;  3PO2 I;  2JA5 I;  4MH4 A;  1ZB8 A;  3I4N I;  1N2F A;  3HOW I;  3D6W A;  2PK7 A;  5IP9 I;  1YUA A;  5CM2 M;  5C4X I;  1Y1V I;  3GTL I;  2R93 I;  3CQZ I;  3S1N I;  5FLM I;  4A3J I;  3VB9 A;  1R9T I;  2JA6 I;  2JA8 I;  1USP B;  2E2H I;  1Y1V S;  2JR6 A;  4A3M I;  2HF1 A;  2NVX I;  3S1Q I;  5C4J I;  3GTO I;  4XX2 A;  4BXX I;  2E2I I;  3S15 I;  2J6A A;  3RZD I;  2E2J I;  3GTK I;  4NBE A;  1L1O C;  3S1M I;  4NBG A;  2R7Z I;  1RO4 A;  4A3D I;  3H3V J;  4NBA A;  4BBR I;  1TWF I;  1ML8 A;  3Q87 A;  2P3Y A;  3HOU I;  3HOZ I;  2JS4 A;  2DE5 A;  1ZB9 A;  1X3W A;  3HOY I;  3GTM I;  4A3F I;  2RBL A;  4NBF A;  5C44 I;  1WW9 A;  4NBH A;  3U50 C;  3RZO I;  4A3C I;  4Y52 I;  1NUI A;  3K7A I;  1TFI A;  4A3B I;  3GTM S;  3GTG I;  3VMH A;  1TWG I;  4A3I I;  4A3K I;  4QTT A;  4BY7 I;  3I4M I;  3GCF A;  1WCM I;  3M3Y I;  3S17 I;  3ESW A;  3S2H I;  4Y7N I;  3GTP I;  4NBD A;  5IP7 I;  1LQL A;  4BY1 I;  1X3Z A;  2F4O A;  1USP A;  2NVQ I;  3S2D I;  1K83 I;  2NVY I;  4NB9 A;  3GTQ I;  3I07 A;  2DE7 A;  3HOX I;  4BBS I;  1TWH I;  1TWA I;  1VLA A;  4A3L I;  4A93 I;  3VMI A;  2VUM I;  4NB8 A;  3LUS A;  1I50 I;  2JA7 I;  2K5R A;  4NBB A;  3H0G I;  3M4O I;  3EER A;  3S14 I;  3S1R I;  2F4M A;  4A3E I;  4NOZ A;  1I6H I;  3VMG A;  1QYP A;  5C3E I;  1Y1W I;  3GKQ A;  1PFT A;  2AKL A;  1RLY A;  4QTU A;  2DE6 A;  1SFO I;  1TWC I;  2NVT I;  2KPI A;  2YU9 I;  3S16 I;  2BJO A;  3PO3 I;  2JNY A;  2R92 I;  2B63 I;  4X6A I;  3FKI I;  4NBC A;  4A3G I;  1DL6 A;  1I3Q I;  3GTJ I;  3HOV I; 
#chains in the Genus database with same CATH topology
 2Y0S A;  1SIW A;  2JA5 I;  3I4N I;  3D6W A;  1QVF Y;  2PK7 A;  5IP9 I;  1NJI 1;  3VTN A;  1YUA A;  1M90 2;  1VQ7 1;  2R93 I;  2JA8 I;  3JAM f;  2NVX I;  5A2Q f;  1YIT Z;  3CC2 1;  3CD6 1;  2KI7 B;  2ZAE B;  3GTK I;  3MON A;  1S7M A;  4NBG A;  4E2W A;  1YI2 Z;  1VQP Z;  3FQQ A;  3I55 Z;  1ML8 A;  3NH5 A;  3Q87 A;  3HOU I;  3OW2 Y;  3CC7 Z;  1ZB9 A;  1YJN Z;  2GTI A;  1KC8 2;  3HOY I;  2Q4Z A;  5C44 I;  4NBH A;  3U50 C;  1M1K 2;  4Y52 I;  1TFI A;  2W04 A;  3CC4 Z;  4EWC A;  3CCR Z;  2QEX 1;  4A3I I;  2HU9 A;  1RO0 A;  4QTT A;  1JJ2 Z;  4RVF A;  1WCM I;  3M3Y I;  3S17 I;  3S2H I;  3TDH B;  4BY1 I;  1X3Z A;  1USP A;  1K83 I;  1AA6 A;  1Q81 1;  1NJI 2;  4NB9 A;  1Q82 2;  2QA4 Z;  1TWH I;  2V8K A;  1KQS Y;  2P28 A;  2OOY B;  3CCQ Z;  1Z03 A;  4MD7 A;  4MXU A;  4NBB A;  1K9M 1;  3NDJ A;  1K73 2;  1W2B Y;  1YUK A;  5C3E I;  2OOX B;  3MZK B;  3G4S 1;  4QTU A;  3G71 1;  2QLV B;  1VQO Z;  2KPI A;  3S16 I;  2H85 A;  3MZL B;  4A3G I;  3GTJ I;  3CCL Z;  3J80 b;  4MH4 A;  1ZB8 A;  1VQ4 Z;  4DQY B;  3I56 Z;  1KD1 1;  2IV2 X;  1Y1V I;  2E9H A;  2RIQ A;  3IF8 A;  3KIF A;  1YIT 1;  2OTL Z;  3CCJ Z;  2O4H A;  1YJ9 Z;  3VB9 A;  1R9T I;  5LL6 f;  1RQF A;  1USP B;  2E2H I;  5IT9 b;  3GTO I;  3S15 I;  3CCV Z;  1VQP 1;  1YI2 1;  3RZD I;  2E2J I;  3S1M I;  3I55 1;  1KRL A;  2E7Z A;  3J81 f;  2JUB A;  2R7Z I;  3CC7 1;  1RO4 A;  1Q86 1;  2K3R A;  4A3D I;  1YJN 1;  3G6E Z;  4BBR I;  4HGZ A;  1K9M 2;  2WAQ A;  2JS4 A;  2RPR A;  5A2Q b;  3GTM I;  4A3F I;  1YIJ Z;  2V8I A;  2PMZ A;  3CC4 1;  1YJW Z;  3CCR 1;  1WW9 A;  5T64 A;  1Z01 A;  3J7A 4;  1VQK Z;  3GTG I;  3CCM 1;  3VMH A;  4E33 A;  4A3K I;  4BY7 I;  3I4M I;  2QR1 B;  3GTP I;  2QA4 1;  2VPW A;  2NVQ I;  5D1P A;  3CCE Z;  4E32 A;  3CCQ 1;  2LEX A;  1KD1 2;  3F3F C;  1N8R 1;  1WII A;  4A3L I;  4A93 I;  3KIH A;  2O53 A;  3M4O I;  1QVG Z;  3P5J B;  1VQ5 Z;  2F4M A;  4NOZ A;  1W2B Z;  1VQO 1;  1I6H I;  1QYP A;  3BG1 B;  4MD8 A;  5FLX f;  2QRE B;  2G2K A;  2V45 A;  2V3V A;  1Q86 2;  2Q51 A;  2WB1 A;  1TWC I;  2NVT I;  2YU9 I;  2QRD B;  2AYD A;  3CME Z;  3CCL 1;  1VQ6 Z;  3PO3 I;  2JNY A;  2B63 I;  4X6A I;  1ZH1 A;  1DL6 A;  2VF1 A;  3CCU Z;  4RVG A;  1I3Q I;  2VPZ A;  3I56 1;  1Q7Y 1;  3TE5 B;  1N2F A;  2OTL 1;  3HOW I;  3CCJ 1;  3CPW Z;  1YJ9 1;  5CM2 M;  2V8J A;  5C4X I;  1Y8C A;  2I3C A;  3CQZ I;  1VQ8 Z;  3S1N I;  3CMA Z;  2LFU A;  5FLM I;  3CCV 1;  4MRI A;  4E2Z A;  1Y1V S;  2JR6 A;  5C4J I;  2W03 A;  3NH8 A;  2E2I I;  2J6A A;  4MON A;  3IR7 A;  3G6E 1;  2JIO A;  4NBE A;  1M90 1;  1JJ2 Y;  3NFZ A;  1Q16 A;  2GTH A;  3HKZ A;  5D1O A;  1QVF Z;  1YIJ 1;  1YJW 1;  3HOZ I;  4DK1 A;  1VQL Z;  4RVH A;  1X3W A;  2VPY A;  1VQN Z;  2OTJ Z;  3CCS Z;  1VQK 1;  2RBL A;  1Q81 2;  5AN9 F;  4A3C I;  2RT9 A;  3J81 b;  4A3B I;  3GTM S;  4MD9 A;  3F3P C;  1TWG I;  3CCE 1;  1KC8 1;  4HH4 A;  4NBD A;  1RO2 A;  2NVY I;  1M1K 1;  4DGL A;  3D2L A;  3OW2 Z;  1RNI A;  3JAM b;  3I07 A;  3GTQ I;  1WZN A;  3HOX I;  4BBS I;  4RVD A;  1WJ2 A;  3NDI A;  1VLA A;  2VUM I;  1VQ5 1;  3LUS A;  1I50 I;  1K8A 1;  2K5R A;  3H0G I;  3S14 I;  4E30 A;  3CXC Y;  1Y1W I;  1Q82 1;  3GKQ A;  1PFT A;  3CME 1;  2AKL A;  1VQ6 1;  4CL1 A;  3QWU A;  1VQM Z;  1QF8 A;  1Z02 A;  5D1O B;  1VQ9 Z;  3NH4 A;  1SFO I;  3FQM A;  3CCU 1;  3IFU A;  2R92 I;  3FKI I;  3T4N B;  1K73 1;  1YHQ Z;  4NFR A;  1KQS Z;  2JIQ A;  3HOV I;  3PO3 S;  2LIY A;  3PO2 I;  5T67 A;  1S72 Z;  4RS4 A;  1VQ8 1;  5FLX b;  3CMA 1;  4S1T A;  4AYB A;  2RHB A;  3GTL I;  2JIR A;  2JMO A;  5T6B A;  4A3J I;  2VUG A;  2JA6 I;  1VQ7 Z;  4A3M I;  2HF1 A;  3S1Q I;  4XX2 A;  4BXX I;  1JWH C;  2R6M A;  2JIP A;  1VQ4 1;  1NP6 A;  1L1O C;  3CC2 Z;  3CD6 Z;  4RV9 A;  1VQL 1;  1K8A 2;  3H3V J;  2M6N A;  3CCM Z;  4NBA A;  1VQN 1;  1TWF I;  2GU2 A;  2OTJ 1;  3CCS 1;  2P3Y A;  2DE5 A;  4E2X A;  4NBF A;  3RZO I;  3D9X A;  1NUI A;  2QKD A;  3K7A I;  1QVG Y;  1N8R 2;  1FDI A;  1QXF A;  3GCF A;  1X0T A;  3ESW A;  2M48 A;  4Y7N I;  2NAP A;  5IP7 I;  1LQL A;  2QEX Z;  2F4O A;  2VPX A;  2JIM A;  3S2D I;  2DE7 A;  1FDO A;  1TWA I;  2IZ3 A;  2OZK A;  3VMI A;  4NB8 A;  2JA7 I;  2PM9 A;  1P9N A;  3EER A;  3BG0 B;  4E2Y A;  3J80 f;  4NH1 C;  3S1R I;  1VQM 1;  2IZ4 A;  2QRC B;  4A3E I;  3CXC Z;  1VQ9 1;  3CPW Y;  3VMG A;  3IX0 A;  4E31 A;  1RLY A;  1Q7Y 2;  2DE6 A;  1YHQ 1;  4HGY A;  2BJO A;  4TNU A;  2YAD A;  2EGT A;  3G4S Z;  4NBC A;  1S72 1;  3G71 Z;  5IT9 f;  3EED A; 
#chains in the Genus database with same CATH homology
 2Y0S A;  2JA5 I;  3I4N I;  3D6W A;  1QVF Y;  2PK7 A;  5IP9 I;  1NJI 1;  3VTN A;  1YUA A;  1M90 2;  1VQ7 1;  2R93 I;  2JA8 I;  3JAM f;  2NVX I;  5A2Q f;  1YIT Z;  3CC2 1;  3CD6 1;  2KI7 B;  2ZAE B;  3GTK I;  3MON A;  1S7M A;  4NBG A;  4E2W A;  1YI2 Z;  1VQP Z;  3FQQ A;  3I55 Z;  1ML8 A;  3NH5 A;  3Q87 A;  3HOU I;  3OW2 Y;  3CC7 Z;  1ZB9 A;  1YJN Z;  2GTI A;  1KC8 2;  3HOY I;  2Q4Z A;  5C44 I;  4NBH A;  3U50 C;  1M1K 2;  4Y52 I;  1TFI A;  2W04 A;  3CC4 Z;  4EWC A;  3CCR Z;  2QEX 1;  4A3I I;  2HU9 A;  1RO0 A;  4QTT A;  1JJ2 Z;  4RVF A;  1WCM I;  3M3Y I;  3S17 I;  3S2H I;  3TDH B;  4BY1 I;  1X3Z A;  1USP A;  1K83 I;  1Q81 1;  1NJI 2;  4NB9 A;  1Q82 2;  2QA4 Z;  1TWH I;  2V8K A;  1KQS Y;  2P28 A;  2OOY B;  3CCQ Z;  1Z03 A;  4MD7 A;  4MXU A;  4NBB A;  1K9M 1;  3NDJ A;  1K73 2;  1W2B Y;  1YUK A;  5C3E I;  2OOX B;  3MZK B;  3G4S 1;  4QTU A;  3G71 1;  2QLV B;  1VQO Z;  2KPI A;  3S16 I;  2H85 A;  3MZL B;  4A3G I;  3GTJ I;  3CCL Z;  3J80 b;  4MH4 A;  1ZB8 A;  1VQ4 Z;  4DQY B;  3I56 Z;  1KD1 1;  1Y1V I;  2E9H A;  2RIQ A;  3IF8 A;  3KIF A;  1YIT 1;  2OTL Z;  3CCJ Z;  2O4H A;  1YJ9 Z;  3VB9 A;  1R9T I;  5LL6 f;  1RQF A;  1USP B;  2E2H I;  5IT9 b;  3GTO I;  3S15 I;  3CCV Z;  1VQP 1;  1YI2 1;  3RZD I;  2E2J I;  3S1M I;  3I55 1;  1KRL A;  3J81 f;  2JUB A;  2R7Z I;  3CC7 1;  1RO4 A;  1Q86 1;  2K3R A;  4A3D I;  1YJN 1;  3G6E Z;  4BBR I;  4HGZ A;  1K9M 2;  2WAQ A;  2JS4 A;  2RPR A;  5A2Q b;  3GTM I;  4A3F I;  1YIJ Z;  2V8I A;  2PMZ A;  3CC4 1;  1YJW Z;  3CCR 1;  1WW9 A;  5T64 A;  1Z01 A;  3J7A 4;  1VQK Z;  3GTG I;  3CCM 1;  3VMH A;  4E33 A;  4A3K I;  4BY7 I;  3I4M I;  2QR1 B;  3GTP I;  2QA4 1;  2NVQ I;  5D1P A;  3CCE Z;  4E32 A;  3CCQ 1;  1KD1 2;  3F3F C;  1N8R 1;  1WII A;  4A3L I;  4A93 I;  3KIH A;  2O53 A;  3M4O I;  1QVG Z;  3P5J B;  1VQ5 Z;  2F4M A;  4NOZ A;  1W2B Z;  1VQO 1;  1I6H I;  1QYP A;  3BG1 B;  4MD8 A;  5FLX f;  2QRE B;  2G2K A;  1Q86 2;  2Q51 A;  2WB1 A;  1TWC I;  2NVT I;  2YU9 I;  2QRD B;  3CME Z;  3CCL 1;  1VQ6 Z;  3PO3 I;  2JNY A;  2B63 I;  4X6A I;  1ZH1 A;  1DL6 A;  2VF1 A;  3CCU Z;  4RVG A;  1I3Q I;  3I56 1;  1Q7Y 1;  3TE5 B;  1N2F A;  2OTL 1;  3HOW I;  3CCJ 1;  3CPW Z;  1YJ9 1;  5CM2 M;  2V8J A;  5C4X I;  2I3C A;  3CQZ I;  1VQ8 Z;  3S1N I;  3CMA Z;  2LFU A;  5FLM I;  3CCV 1;  4MRI A;  4E2Z A;  1Y1V S;  2JR6 A;  5C4J I;  2W03 A;  3NH8 A;  2E2I I;  2J6A A;  4MON A;  3G6E 1;  1M90 1;  4NBE A;  1JJ2 Y;  3NFZ A;  2GTH A;  3HKZ A;  5D1O A;  1QVF Z;  1YIJ 1;  1YJW 1;  3HOZ I;  4DK1 A;  1VQL Z;  4RVH A;  1X3W A;  1VQN Z;  2OTJ Z;  3CCS Z;  1VQK 1;  2RBL A;  1Q81 2;  5AN9 F;  4A3C I;  2RT9 A;  3J81 b;  4A3B I;  3GTM S;  4MD9 A;  3F3P C;  1TWG I;  3CCE 1;  1KC8 1;  4HH4 A;  4NBD A;  1RO2 A;  2NVY I;  1M1K 1;  4DGL A;  3OW2 Z;  1RNI A;  3JAM b;  3I07 A;  3GTQ I;  3HOX I;  4BBS I;  4RVD A;  3NDI A;  1VLA A;  2VUM I;  1VQ5 1;  3LUS A;  1I50 I;  1K8A 1;  2K5R A;  3H0G I;  3S14 I;  4E30 A;  3CXC Y;  1Y1W I;  1Q82 1;  3GKQ A;  1PFT A;  3CME 1;  2AKL A;  1VQ6 1;  4CL1 A;  3QWU A;  1VQM Z;  1QF8 A;  1Z02 A;  5D1O B;  1VQ9 Z;  3NH4 A;  1SFO I;  3FQM A;  3CCU 1;  3IFU A;  2R92 I;  3FKI I;  3T4N B;  1K73 1;  1YHQ Z;  4NFR A;  1KQS Z;  3HOV I;  3PO3 S;  2LIY A;  3PO2 I;  5T67 A;  1S72 Z;  4RS4 A;  1VQ8 1;  5FLX b;  3CMA 1;  4S1T A;  4AYB A;  2RHB A;  3GTL I;  2JMO A;  5T6B A;  4A3J I;  2VUG A;  2JA6 I;  1VQ7 Z;  4A3M I;  2HF1 A;  3S1Q I;  4XX2 A;  4BXX I;  1JWH C;  2R6M A;  1VQ4 1;  1NP6 A;  1L1O C;  3CC2 Z;  3CD6 Z;  4RV9 A;  1VQL 1;  1K8A 2;  3H3V J;  2M6N A;  3CCM Z;  4NBA A;  1VQN 1;  1TWF I;  2GU2 A;  2OTJ 1;  3CCS 1;  2P3Y A;  2DE5 A;  4E2X A;  4NBF A;  3RZO I;  3D9X A;  1NUI A;  2QKD A;  3K7A I;  1QVG Y;  1N8R 2;  3GCF A;  1X0T A;  3ESW A;  2M48 A;  4Y7N I;  2QEX Z;  5IP7 I;  1LQL A;  2F4O A;  3S2D I;  2DE7 A;  1TWA I;  2IZ3 A;  2OZK A;  3VMI A;  4NB8 A;  2JA7 I;  2PM9 A;  1P9N A;  3EER A;  3BG0 B;  4E2Y A;  3J80 f;  4NH1 C;  3S1R I;  1VQM 1;  2IZ4 A;  1VQ9 1;  2QRC B;  3CXC Z;  4A3E I;  3CPW Y;  3VMG A;  3IX0 A;  4E31 A;  1RLY A;  1Q7Y 2;  2DE6 A;  1YHQ 1;  4HGY A;  2BJO A;  4TNU A;  2YAD A;  2EGT A;  3G4S Z;  4NBC A;  1S72 1;  3G71 Z;  5IT9 f;  3EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...