5LL6f

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ll6f00
5IT9b 3JAMb 5LL6f 3J7A4 3J80b 3J81b 5A2Qb 5FLXb
chains in the Genus database with same CATH superfamily
1YI2Z 3GTJI 4BY1I 1VQ7Z 2JA8I 5A2Qf 5IP7I 1VQ71 2P28A 1Z01A 2O53A 2E7ZA 3K7AI 4E32A 4E2YA 4A3KI 2JR6A 1YHQZ 1YHQ1 3I4NI 4E2ZA 1WZNA 2JMOA 2KI7B 1Z02A 3IX0A 4A3GI 4AYBA 1VQLZ 1ZB9A 1RO2A 1VQL1 1Y1VI 1VQ5Z 2V8IA 4MD7A 1VQ51 1X0TA 4NBEA 2QLVB 3CCMZ 1N2FA 1Y1VS 2JIOA 3CCQZ 3CCQ1 1K9M2 3S2HI 2RHBA 4A3II 2Q51A 3D6WA 3S1NI 3JAMb 1K8A2 2GU2A 3J7A4 3NFZA 3I55Z 1Z03A 3I551 3H0GI 1KD11 3CCJZ 2JA6I 3CCJ1 2V3VA 1Q861 1K731 1Q811 2NVYI 4MXUA 4A3BI 2R7ZI 2V45A 2AKLA 3S15I 3GCFA 3ESWA 5FLMI 2YADA 3VMIA 2OOXB 2IV2X 3GKQA 4CL1A 4S1TA 2YU9I 3S1RI 1TFIA 1YITZ 1VQ9Z 1M1K2 1YIT1 1VQ91 2H85A 1L1OC 3JAMf 3CMAZ 1LQLA 3CMA1 1X3WA 5FLXb 4DGLA 3HOYI 4E2XA 2LEXA 3U50C 2QA4Z 2QA41 4HH4A 1K9M1 1I6HI 3PO2I 1RLYA 3G4SZ 2PMZA 3G4S1 4RVHA 1NJI2 4NBHA 5C4XI 1X3ZA 2IZ3A 3VMHA 3HOUI 2E2JI 3GTKI 1M902 1FDIA 4E33A 1RQFA 2V8KA 4X6AI 3GTPI 4RVFA 2NVQI 2RT9A 2VPYA 4NH1C 1WCMI 1VQKZ 1Q16A 2P3YA 1VQK1 4NBGA 1YI21 1Q822 4NBAA 5FLXf 2V8JA 1KQSZ 2JIMA 3NDIA 1QF8A 4EWCA 1W2BZ 2QR1B 5T64A 4BY7I 1JWHC 4NOZA 1M1K1 3CCRZ 3CCR1 4Y52I 1QVFZ 1WIIA 1TWAI 3GTMI 3OW2Z 4MD8A 4A3CI 2ZAEB 1TWHI 3GTMS 2NVXI 1SFOI 1TWFI 3FQQA 2VPZA 2OTLZ 3RZDI 2OTL1 2PM9A 3CCM1 1QVGY 1RO4A 2QKDA 3PO3I 4A3FI 2QRDB 1RNIA 5T6BA 3CCVZ 3CCV1 4NB9A 3PO3S 3IFUA 1NJI1 3J81b 1WJ2A 4QTTA 1Y8CA 1QYPA 1QXFA 4A3MI 1VQMZ 2QEXZ 1VQM1 1N8R1 2QEX1 2DE5A 3CPWZ 3VTNA 4MRIA 3NH5A 1I3QI 2J6AA 3H3VJ 1Y1WI 2WAQA 2DE6A 2VPXA 5D1OB 3NH4A 3GTLI 2IZ4A 4E31A 2HF1A 2R92I 1KRLA 3S14I 5C44I 1WW9A 2JNYA 1USPB 3CD6Z 2M48A 2AYDA 4A3EI 3J81f 2VPWA 3S2DI 2OTJZ 2QRCB 5CM2M 2OTJ1 4XX2A 3TE5B 3J80f 4BBRI 2JIQA 1JJ2Z 3P5JB 2WB1A 2JIRA 3I4MI 4NBCA 2K3RA 3CXCZ 3QWUA 3IR7A 2E2HI 5T67A 2VUMI 1YUAA 1VQ4Z 1VQ41 3HOVI 2RIQA 3NDJA 4NB8A 3D9XA 1Q7Y2 1K8A1 3G6EZ 3G6E1 4QTUA 2F4OA 2JIPA 5C4JI 3VMGA 5D1PA 1S72Z 1S721 3FQMA 4E2WA 1SIWA 3GTOI 2NAPA 3S1QI 2R6MA 3CXCY 4A3JI 3MONA 2W04A 3NH8A 2F4MA 3CC2Z 1KD12 1R9TI 3CC21 4DK1A 3CMEZ 3CME1 1ZH1A 3EEDA 3IF8A 1K732 1Q812 2QREB 3GTGI 3BG0B 4BXXI 3KIHA 3Q87A 2G2KA 5IT9b 2BJOA 1KC82 3BG1B 4RS4A 4MONA 4A3DI 2JUBA 4E30A 3HOZI 3MZKB 4HGYA 4Y7NI 2I3CA 1VQOZ 3D2LA 1VQO1 1KQSY 2K5RA 3TDHB 1NP6A 3CQZI 3S17I 1W2BY 3MZLB 3J80b 3HOXI 1Q7Y1 2JS4A 1RO0A 1S7MA 2LFUA 1M901 1YJWZ 4NBFA 1QVFY 1YJW1 3EERA 1VQPZ 3GTQI 1ML8A 1VQP1 3OW2Y 3RZOI 3T4NB 2NVTI 1I50I 1Q821 5IT9f 3FKII 1DL6A 2PK7A 1PFTA 3M3YI 2KPIA 3HKZA 4A3LI 2E2II 1VQ6Z 2HU9A 1VQ61 1VLAA 2DE7A 4RV9A 5AN9F 3I56Z 3LUSA 3I561 2Q4ZA 4TNUA 3CD61 1P9NA 1TWCI 2RBLA 4MD9A 1YIJZ 1TWGI 1YIJ1 2E9HA 3S16I 2OZKA 1KC81 1YJNZ 4HGZA 3CPWY 1YJN1 2JA5I 3F3PC 2B63I 3CCSZ 3I07A 4BBSI 3CCS1 1FDOA 3G71Z 1K83I 3G711 1VQNZ 1VQN1 4NBDA 2VF1A 1NUIA 2EGTA 3F3FC 2VUGA 3VB9A 5IP9I 3CCLZ 3M4OI 5A2Qb 2OOYB 3CCL1 3CC4Z 5C3EI 5LL6f 2M6NA 3CC41 3CCUZ 3CCEZ 3CCU1 4NBBA 2R93I 3CCE1 2O4HA 3CC7Z 4RVGA 3CC71 3KIFA 3HOWI 5D1OA 2GTHA 1VQ8Z 1AA6A 1JJ2Y 1VQ81 1YUKA 2W03A 4RVDA 4A93I 4MH4A 2JA7I 2GTIA 1ZB8A 1USPA 3S1MI 1YJ9Z 2RPRA 1YJ91 1N8R2 2Y0SA 2LIYA 4NFRA 1Q862 4DQYB 1QVGZ
chains in the Genus database with same CATH topology
1YI2Z 3GTJI 4BY1I 1VQ7Z 2JA8I 5A2Qf 5IP7I 1VQ71 2P28A 1Z01A 2O53A 3K7AI 4E32A 4E2YA 4A3KI 2JR6A 1YHQZ 1YHQ1 3I4NI 4E2ZA 2JMOA 2KI7B 1Z02A 3IX0A 4A3GI 4AYBA 1VQLZ 1ZB9A 1RO2A 1VQL1 1Y1VI 1VQ5Z 2V8IA 4MD7A 1VQ51 1X0TA 4NBEA 2QLVB 3CCMZ 1N2FA 1Y1VS 3CCQZ 3CCQ1 1K9M2 3S2HI 2RHBA 4A3II 2Q51A 3D6WA 3S1NI 3JAMb 1K8A2 2GU2A 3J7A4 3NFZA 3I55Z 1Z03A 3I551 3H0GI 1KD11 3CCJZ 2JA6I 3CCJ1 1Q861 1K731 1Q811 2NVYI 4MXUA 4A3BI 2R7ZI 2AKLA 3S15I 3GCFA 3ESWA 5FLMI 2YADA 3VMIA 2OOXB 3GKQA 4CL1A 4S1TA 2YU9I 3S1RI 1TFIA 1YITZ 1VQ9Z 1M1K2 1YIT1 1VQ91 2H85A 1L1OC 3JAMf 3CMAZ 1LQLA 3CMA1 1X3WA 5FLXb 4DGLA 3HOYI 4E2XA 3U50C 2QA4Z 2QA41 4HH4A 1K9M1 1I6HI 3PO2I 1RLYA 3G4SZ 2PMZA 3G4S1 4RVHA 1NJI2 4NBHA 5C4XI 1X3ZA 2IZ3A 3VMHA 3HOUI 2E2JI 3GTKI 1M902 4E33A 1RQFA 2V8KA 4X6AI 3GTPI 4RVFA 2NVQI 2RT9A 4NH1C 1WCMI 1VQKZ 2P3YA 1VQK1 4NBGA 1YI21 1Q822 4NBAA 5FLXf 2V8JA 1KQSZ 3NDIA 1QF8A 4EWCA 1W2BZ 2QR1B 5T64A 4BY7I 1JWHC 4NOZA 1M1K1 3CCRZ 3CCR1 4Y52I 1QVFZ 1WIIA 1TWAI 3GTMI 3OW2Z 4MD8A 4A3CI 2ZAEB 1TWHI 3GTMS 2NVXI 1SFOI 1TWFI 3FQQA 2OTLZ 3RZDI 2OTL1 2PM9A 3CCM1 1QVGY 1RO4A 2QKDA 3PO3I 4A3FI 2QRDB 1RNIA 5T6BA 3CCVZ 3CCV1 4NB9A 3PO3S 3IFUA 1NJI1 3J81b 4QTTA 1QYPA 4A3MI 1VQMZ 2QEXZ 1VQM1 1N8R1 2QEX1 2DE5A 3CPWZ 3VTNA 4MRIA 3NH5A 1I3QI 2J6AA 3H3VJ 1Y1WI 2WAQA 2DE6A 5D1OB 3NH4A 3GTLI 2IZ4A 4E31A 2HF1A 2R92I 1KRLA 3S14I 5C44I 1WW9A 2JNYA 1USPB 3CD6Z 2M48A 4A3EI 3J81f 3S2DI 2OTJZ 2QRCB 5CM2M 2OTJ1 4XX2A 3TE5B 3J80f 4BBRI 1JJ2Z 3P5JB 2WB1A 3I4MI 4NBCA 2K3RA 3CXCZ 3QWUA 2E2HI 5T67A 2VUMI 1YUAA 1VQ4Z 1VQ41 3HOVI 2RIQA 3NDJA 4NB8A 3D9XA 1Q7Y2 1K8A1 3G6EZ 3G6E1 4QTUA 2F4OA 5C4JI 3VMGA 5D1PA 1S72Z 1S721 3FQMA 4E2WA 3GTOI 3S1QI 2R6MA 3CXCY 4A3JI 3MONA 2W04A 3NH8A 2F4MA 3CC2Z 1KD12 1R9TI 3CC21 4DK1A 3CMEZ 3CME1 1ZH1A 3EEDA 3IF8A 1K732 1Q812 2QREB 3GTGI 3BG0B 4BXXI 3KIHA 3Q87A 2G2KA 5IT9b 2BJOA 1KC82 3BG1B 4RS4A 4MONA 4A3DI 2JUBA 4E30A 3HOZI 3MZKB 4HGYA 4Y7NI 2I3CA 1VQOZ 1VQO1 1KQSY 2K5RA 3TDHB 1NP6A 3CQZI 3S17I 1W2BY 3MZLB 3J80b 3HOXI 1Q7Y1 2JS4A 1RO0A 1S7MA 2LFUA 1M901 1YJWZ 4NBFA 1QVFY 1YJW1 3EERA 1VQPZ 3GTQI 1ML8A 1VQP1 3OW2Y 3RZOI 3T4NB 2NVTI 1I50I 1Q821 5IT9f 3FKII 1DL6A 2PK7A 1PFTA 3M3YI 2KPIA 3HKZA 4A3LI 2E2II 1VQ6Z 2HU9A 1VQ61 1VLAA 2DE7A 4RV9A 5AN9F 3I56Z 3LUSA 3I561 2Q4ZA 4TNUA 3CD61 1P9NA 1TWCI 2RBLA 4MD9A 1YIJZ 1TWGI 1YIJ1 2E9HA 3S16I 2OZKA 1KC81 1YJNZ 4HGZA 3CPWY 1YJN1 2JA5I 3F3PC 2B63I 3CCSZ 3I07A 4BBSI 3CCS1 3G71Z 1K83I 3G711 1VQNZ 1VQN1 4NBDA 2VF1A 1NUIA 2EGTA 3F3FC 2VUGA 3VB9A 5IP9I 3CCLZ 3M4OI 5A2Qb 2OOYB 3CCL1 3CC4Z 5C3EI 5LL6f 2M6NA 3CC41 3CCUZ 3CCEZ 3CCU1 4NBBA 2R93I 3CCE1 2O4HA 3CC7Z 4RVGA 3CC71 3KIFA 3HOWI 5D1OA 2GTHA 1VQ8Z 1VQ81 1JJ2Y 1YUKA 2W03A 4RVDA 4A93I 4MH4A 2JA7I 2GTIA 1ZB8A 1USPA 3S1MI 1YJ9Z 2RPRA 1YJ91 1N8R2 2Y0SA 2LIYA 4NFRA 1Q862 4DQYB 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  3JAM b;  5LL6 f;  3J7A 4;  3J80 b;  3J81 b;  5A2Q b;  5FLX b; 
#chains in the Genus database with same CATH topology
 1YI2 Z;  3GTJ I;  4BY1 I;  1VQ7 Z;  2JA8 I;  5A2Q f;  5IP7 I;  1VQ7 1;  2P28 A;  1Z01 A;  2O53 A;  2E7Z A;  3K7A I;  4E32 A;  4E2Y A;  4A3K I;  2JR6 A;  1YHQ Z;  1YHQ 1;  3I4N I;  4E2Z A;  1WZN A;  2JMO A;  2KI7 B;  1Z02 A;  3IX0 A;  4A3G I;  4AYB A;  1VQL Z;  1ZB9 A;  1RO2 A;  1VQL 1;  1Y1V I;  1VQ5 Z;  2V8I A;  4MD7 A;  1VQ5 1;  1X0T A;  4NBE A;  2QLV B;  3CCM Z;  1N2F A;  1Y1V S;  2JIO A;  3CCQ Z;  3CCQ 1;  1K9M 2;  3S2H I;  2RHB A;  4A3I I;  2Q51 A;  3D6W A;  3S1N I;  3JAM b;  1K8A 2;  2GU2 A;  3J7A 4;  3NFZ A;  3I55 Z;  1Z03 A;  3I55 1;  3H0G I;  1KD1 1;  3CCJ Z;  2JA6 I;  3CCJ 1;  2V3V A;  1Q86 1;  1K73 1;  1Q81 1;  2NVY I;  4MXU A;  4A3B I;  2R7Z I;  2V45 A;  2AKL A;  3S15 I;  3GCF A;  3ESW A;  5FLM I;  2YAD A;  3VMI A;  2OOX B;  2IV2 X;  3GKQ A;  4CL1 A;  4S1T A;  2YU9 I;  3S1R I;  1TFI A;  1YIT Z;  1VQ9 Z;  1M1K 2;  1YIT 1;  1VQ9 1;  2H85 A;  1L1O C;  3JAM f;  3CMA Z;  1LQL A;  3CMA 1;  1X3W A;  5FLX b;  4DGL A;  3HOY I;  4E2X A;  2LEX A;  3U50 C;  2QA4 Z;  2QA4 1;  4HH4 A;  1K9M 1;  1I6H I;  3PO2 I;  1RLY A;  3G4S Z;  2PMZ A;  3G4S 1;  4RVH A;  1NJI 2;  4NBH A;  5C4X I;  1X3Z A;  2IZ3 A;  3VMH A;  3HOU I;  2E2J I;  3GTK I;  1M90 2;  1FDI A;  4E33 A;  1RQF A;  2V8K A;  4X6A I;  3GTP I;  4RVF A;  2NVQ I;  2RT9 A;  2VPY A;  4NH1 C;  1WCM I;  1VQK Z;  1Q16 A;  2P3Y A;  1VQK 1;  4NBG A;  1YI2 1;  1Q82 2;  4NBA A;  5FLX f;  2V8J A;  1KQS Z;  2JIM A;  3NDI A;  1QF8 A;  4EWC A;  1W2B Z;  2QR1 B;  5T64 A;  4BY7 I;  1JWH C;  4NOZ A;  1M1K 1;  3CCR Z;  3CCR 1;  4Y52 I;  1QVF Z;  1WII A;  1TWA I;  3GTM I;  3OW2 Z;  4MD8 A;  4A3C I;  2ZAE B;  1TWH I;  3GTM S;  2NVX I;  1SFO I;  1TWF I;  3FQQ A;  2VPZ A;  2OTL Z;  3RZD I;  2OTL 1;  2PM9 A;  3CCM 1;  1QVG Y;  1RO4 A;  2QKD A;  3PO3 I;  4A3F I;  2QRD B;  1RNI A;  5T6B A;  3CCV Z;  3CCV 1;  4NB9 A;  3PO3 S;  3IFU A;  1NJI 1;  3J81 b;  1WJ2 A;  4QTT A;  1Y8C A;  1QYP A;  1QXF A;  4A3M I;  1VQM Z;  2QEX Z;  1VQM 1;  1N8R 1;  2QEX 1;  2DE5 A;  3CPW Z;  3VTN A;  4MRI A;  3NH5 A;  1I3Q I;  2J6A A;  3H3V J;  1Y1W I;  2WAQ A;  2DE6 A;  2VPX A;  5D1O B;  3NH4 A;  3GTL I;  2IZ4 A;  4E31 A;  2HF1 A;  2R92 I;  1KRL A;  3S14 I;  5C44 I;  1WW9 A;  2JNY A;  1USP B;  3CD6 Z;  2M48 A;  2AYD A;  4A3E I;  3J81 f;  2VPW A;  3S2D I;  2OTJ Z;  2QRC B;  5CM2 M;  2OTJ 1;  4XX2 A;  3TE5 B;  3J80 f;  4BBR I;  2JIQ A;  1JJ2 Z;  3P5J B;  2WB1 A;  2JIR A;  3I4M I;  4NBC A;  2K3R A;  3CXC Z;  3QWU A;  3IR7 A;  2E2H I;  5T67 A;  2VUM I;  1YUA A;  1VQ4 Z;  1VQ4 1;  3HOV I;  2RIQ A;  3NDJ A;  4NB8 A;  3D9X A;  1Q7Y 2;  1K8A 1;  3G6E Z;  3G6E 1;  4QTU A;  2F4O A;  2JIP A;  5C4J I;  3VMG A;  5D1P A;  1S72 Z;  1S72 1;  3FQM A;  4E2W A;  1SIW A;  3GTO I;  2NAP A;  3S1Q I;  2R6M A;  3CXC Y;  4A3J I;  3MON A;  2W04 A;  3NH8 A;  2F4M A;  3CC2 Z;  1KD1 2;  1R9T I;  3CC2 1;  4DK1 A;  3CME Z;  3CME 1;  1ZH1 A;  3EED A;  3IF8 A;  1K73 2;  1Q81 2;  2QRE B;  3GTG I;  3BG0 B;  4BXX I;  3KIH A;  3Q87 A;  2G2K A;  5IT9 b;  2BJO A;  1KC8 2;  3BG1 B;  4RS4 A;  4MON A;  4A3D I;  2JUB A;  4E30 A;  3HOZ I;  3MZK B;  4HGY A;  4Y7N I;  2I3C A;  1VQO Z;  3D2L A;  1VQO 1;  1KQS Y;  2K5R A;  3TDH B;  1NP6 A;  3CQZ I;  3S17 I;  1W2B Y;  3MZL B;  3J80 b;  3HOX I;  1Q7Y 1;  2JS4 A;  1RO0 A;  1S7M A;  2LFU A;  1M90 1;  1YJW Z;  4NBF A;  1QVF Y;  1YJW 1;  3EER A;  1VQP Z;  3GTQ I;  1ML8 A;  1VQP 1;  3OW2 Y;  3RZO I;  3T4N B;  2NVT I;  1I50 I;  1Q82 1;  5IT9 f;  3FKI I;  1DL6 A;  2PK7 A;  1PFT A;  3M3Y I;  2KPI A;  3HKZ A;  4A3L I;  2E2I I;  1VQ6 Z;  2HU9 A;  1VQ6 1;  1VLA A;  2DE7 A;  4RV9 A;  5AN9 F;  3I56 Z;  3LUS A;  3I56 1;  2Q4Z A;  4TNU A;  3CD6 1;  1P9N A;  1TWC I;  2RBL A;  4MD9 A;  1YIJ Z;  1TWG I;  1YIJ 1;  2E9H A;  3S16 I;  2OZK A;  1KC8 1;  1YJN Z;  4HGZ A;  3CPW Y;  1YJN 1;  2JA5 I;  3F3P C;  2B63 I;  3CCS Z;  3I07 A;  4BBS I;  3CCS 1;  1FDO A;  3G71 Z;  1K83 I;  3G71 1;  1VQN Z;  1VQN 1;  4NBD A;  2VF1 A;  1NUI A;  2EGT A;  3F3F C;  2VUG A;  3VB9 A;  5IP9 I;  3CCL Z;  3M4O I;  5A2Q b;  2OOY B;  3CCL 1;  3CC4 Z;  5C3E I;  5LL6 f;  2M6N A;  3CC4 1;  3CCU Z;  3CCE Z;  3CCU 1;  4NBB A;  2R93 I;  3CCE 1;  2O4H A;  3CC7 Z;  4RVG A;  3CC7 1;  3KIF A;  3HOW I;  5D1O A;  2GTH A;  1VQ8 Z;  1AA6 A;  1JJ2 Y;  1VQ8 1;  1YUK A;  2W03 A;  4RVD A;  4A93 I;  4MH4 A;  2JA7 I;  2GTI A;  1ZB8 A;  1USP A;  3S1M I;  1YJ9 Z;  2RPR A;  1YJ9 1;  1N8R 2;  2Y0S A;  2LIY A;  4NFR A;  1Q86 2;  4DQY B;  1QVG Z; 
#chains in the Genus database with same CATH homology
 1YI2 Z;  3GTJ I;  4BY1 I;  1VQ7 Z;  2JA8 I;  5A2Q f;  5IP7 I;  1VQ7 1;  2P28 A;  1Z01 A;  2O53 A;  3K7A I;  4E32 A;  4E2Y A;  4A3K I;  2JR6 A;  1YHQ Z;  1YHQ 1;  3I4N I;  4E2Z A;  2JMO A;  2KI7 B;  1Z02 A;  3IX0 A;  4A3G I;  4AYB A;  1VQL Z;  1ZB9 A;  1RO2 A;  1VQL 1;  1Y1V I;  1VQ5 Z;  2V8I A;  4MD7 A;  1VQ5 1;  1X0T A;  4NBE A;  2QLV B;  3CCM Z;  1N2F A;  1Y1V S;  3CCQ Z;  3CCQ 1;  1K9M 2;  3S2H I;  2RHB A;  4A3I I;  2Q51 A;  3D6W A;  3S1N I;  3JAM b;  1K8A 2;  2GU2 A;  3J7A 4;  3NFZ A;  3I55 Z;  1Z03 A;  3I55 1;  3H0G I;  1KD1 1;  3CCJ Z;  2JA6 I;  3CCJ 1;  1Q86 1;  1K73 1;  1Q81 1;  2NVY I;  4MXU A;  4A3B I;  2R7Z I;  2AKL A;  3S15 I;  3GCF A;  3ESW A;  5FLM I;  2YAD A;  3VMI A;  2OOX B;  3GKQ A;  4CL1 A;  4S1T A;  2YU9 I;  3S1R I;  1TFI A;  1YIT Z;  1VQ9 Z;  1M1K 2;  1YIT 1;  1VQ9 1;  2H85 A;  1L1O C;  3JAM f;  3CMA Z;  1LQL A;  3CMA 1;  1X3W A;  5FLX b;  4DGL A;  3HOY I;  4E2X A;  3U50 C;  2QA4 Z;  2QA4 1;  4HH4 A;  1K9M 1;  1I6H I;  3PO2 I;  1RLY A;  3G4S Z;  2PMZ A;  3G4S 1;  4RVH A;  1NJI 2;  4NBH A;  5C4X I;  1X3Z A;  2IZ3 A;  3VMH A;  3HOU I;  2E2J I;  3GTK I;  1M90 2;  4E33 A;  1RQF A;  2V8K A;  4X6A I;  3GTP I;  4RVF A;  2NVQ I;  2RT9 A;  4NH1 C;  1WCM I;  1VQK Z;  2P3Y A;  1VQK 1;  4NBG A;  1YI2 1;  1Q82 2;  4NBA A;  5FLX f;  2V8J A;  1KQS Z;  3NDI A;  1QF8 A;  4EWC A;  1W2B Z;  2QR1 B;  5T64 A;  4BY7 I;  1JWH C;  4NOZ A;  1M1K 1;  3CCR Z;  3CCR 1;  4Y52 I;  1QVF Z;  1WII A;  1TWA I;  3GTM I;  3OW2 Z;  4MD8 A;  4A3C I;  2ZAE B;  1TWH I;  3GTM S;  2NVX I;  1SFO I;  1TWF I;  3FQQ A;  2OTL Z;  3RZD I;  2OTL 1;  2PM9 A;  3CCM 1;  1QVG Y;  1RO4 A;  2QKD A;  3PO3 I;  4A3F I;  2QRD B;  1RNI A;  5T6B A;  3CCV Z;  3CCV 1;  4NB9 A;  3PO3 S;  3IFU A;  1NJI 1;  3J81 b;  4QTT A;  1QYP A;  4A3M I;  1VQM Z;  2QEX Z;  1VQM 1;  1N8R 1;  2QEX 1;  2DE5 A;  3CPW Z;  3VTN A;  4MRI A;  3NH5 A;  1I3Q I;  2J6A A;  3H3V J;  1Y1W I;  2WAQ A;  2DE6 A;  5D1O B;  3NH4 A;  3GTL I;  2IZ4 A;  4E31 A;  2HF1 A;  2R92 I;  1KRL A;  3S14 I;  5C44 I;  1WW9 A;  2JNY A;  1USP B;  3CD6 Z;  2M48 A;  4A3E I;  3J81 f;  3S2D I;  2OTJ Z;  2QRC B;  5CM2 M;  2OTJ 1;  4XX2 A;  3TE5 B;  3J80 f;  4BBR I;  1JJ2 Z;  3P5J B;  2WB1 A;  3I4M I;  4NBC A;  2K3R A;  3CXC Z;  3QWU A;  2E2H I;  5T67 A;  2VUM I;  1YUA A;  1VQ4 Z;  1VQ4 1;  3HOV I;  2RIQ A;  3NDJ A;  4NB8 A;  3D9X A;  1Q7Y 2;  1K8A 1;  3G6E Z;  3G6E 1;  4QTU A;  2F4O A;  5C4J I;  3VMG A;  5D1P A;  1S72 Z;  1S72 1;  3FQM A;  4E2W A;  3GTO I;  3S1Q I;  2R6M A;  3CXC Y;  4A3J I;  3MON A;  2W04 A;  3NH8 A;  2F4M A;  3CC2 Z;  1KD1 2;  1R9T I;  3CC2 1;  4DK1 A;  3CME Z;  3CME 1;  1ZH1 A;  3EED A;  3IF8 A;  1K73 2;  1Q81 2;  2QRE B;  3GTG I;  3BG0 B;  4BXX I;  3KIH A;  3Q87 A;  2G2K A;  5IT9 b;  2BJO A;  1KC8 2;  3BG1 B;  4RS4 A;  4MON A;  4A3D I;  2JUB A;  4E30 A;  3HOZ I;  3MZK B;  4HGY A;  4Y7N I;  2I3C A;  1VQO Z;  1VQO 1;  1KQS Y;  2K5R A;  3TDH B;  1NP6 A;  3CQZ I;  3S17 I;  1W2B Y;  3MZL B;  3J80 b;  3HOX I;  1Q7Y 1;  2JS4 A;  1RO0 A;  1S7M A;  2LFU A;  1M90 1;  1YJW Z;  4NBF A;  1QVF Y;  1YJW 1;  3EER A;  1VQP Z;  3GTQ I;  1ML8 A;  1VQP 1;  3OW2 Y;  3RZO I;  3T4N B;  2NVT I;  1I50 I;  1Q82 1;  5IT9 f;  3FKI I;  1DL6 A;  2PK7 A;  1PFT A;  3M3Y I;  2KPI A;  3HKZ A;  4A3L I;  2E2I I;  1VQ6 Z;  2HU9 A;  1VQ6 1;  1VLA A;  2DE7 A;  4RV9 A;  5AN9 F;  3I56 Z;  3LUS A;  3I56 1;  2Q4Z A;  4TNU A;  3CD6 1;  1P9N A;  1TWC I;  2RBL A;  4MD9 A;  1YIJ Z;  1TWG I;  1YIJ 1;  2E9H A;  3S16 I;  2OZK A;  1KC8 1;  1YJN Z;  4HGZ A;  3CPW Y;  1YJN 1;  2JA5 I;  3F3P C;  2B63 I;  3CCS Z;  3I07 A;  4BBS I;  3CCS 1;  3G71 Z;  1K83 I;  3G71 1;  1VQN Z;  1VQN 1;  4NBD A;  2VF1 A;  1NUI A;  2EGT A;  3F3F C;  2VUG A;  3VB9 A;  5IP9 I;  3CCL Z;  3M4O I;  5A2Q b;  2OOY B;  3CCL 1;  3CC4 Z;  5C3E I;  5LL6 f;  2M6N A;  3CC4 1;  3CCU Z;  3CCE Z;  3CCU 1;  4NBB A;  2R93 I;  3CCE 1;  2O4H A;  3CC7 Z;  4RVG A;  3CC7 1;  3KIF A;  3HOW I;  5D1O A;  2GTH A;  1VQ8 Z;  1VQ8 1;  1JJ2 Y;  1YUK A;  2W03 A;  4RVD A;  4A93 I;  4MH4 A;  2JA7 I;  2GTI A;  1ZB8 A;  1USP A;  3S1M I;  1YJ9 Z;  2RPR A;  1YJ9 1;  1N8R 2;  2Y0S A;  2LIY A;  4NFR A;  1Q86 2;  4DQY B;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...