5LL6f

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
b'VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ll6f00
5A2Qb 5IT9b 5LL6f 3J7A4 3J81b 3J80b 5FLXb 3JAMb
chains in the Genus database with same CATH superfamily
3NH5A 1FDOA 2QKDA 5T64A 3JAMb 2J6AA 4A3DI 1QVFZ 3M3YI 2P3YA 3G6E1 1W2BZ 1K9M1 3HOWI 4NBAA 1VQMZ 1Z02A 1ML8A 3QWUA 2OOXB 1KD12 3CC71 1YHQZ 4QTTA 2QREB 1YJ9Z 1QXFA 1TWGI 2QLVB 2V8KA 1QYPA 3CD61 3G71Z 4Y52I 1TWAI 3J81b 4E33A 4A3LI 1TWCI 4BY1I 1AA6A 3H0GI 3D2LA 1RO4A 5IP9I 2B63I 4BBRI 3HKZA 4A3JI 2NVTI 3GKQA 2QEXZ 2KPIA 4A93I 4NB9A 2NAPA 2R6MA 2HU9A 3CCU1 3RZOI 1ZB9A 4BBSI 4BXXI 3H3VJ 3S2HI 1KQSZ 3CCM1 2Q51A 5T6BA 3F3FC 3VTNA 1TWHI 2W04A 2G2KA 3CCS1 4DK1A 1X0TA 1VQ7Z 1VQO1 1Q7Y1 1YUKA 3D9XA 3G4SZ 1VQ41 3S1RI 1YIT1 1NJI2 2JA6I 3CCE1 2H85A 3CCL1 4NB8A 3IX0A 1JJ2Y 3OW2Y 1WJ2A 3IR7A 3CCSZ 1VQOZ 2GTHA 2O53A 2OTL1 2R7ZI 1VQ4Z 1YITZ 2RPRA 1L1OC 5D1OA 2JIRA 4E2WA 2RT9A 3CCEZ 2GTIA 4BY7I 2YADA 1I50I 3HOZI 2PMZA 3CCJ1 1K731 1VQ61 5FLXf 2QRDB 1QVFY 5A2Qb 4A3KI 1S721 2LEXA 1W2BY 1M902 4QTUA 2WAQA 1VQKZ 3F3PC 1JJ2Z 1K83I 1TWFI 3BG0B 4NBGA 1R9TI 1QF8A 2E2II 3I551 1P9NA 4E2XA 1Y8CA 3S2DI 1KC81 1YJNZ 3VMIA 1S72Z 2JIOA 4RVFA 3HOUI 1Z01A 4A3EI 3CMA1 3CCQ1 4Y7NI 4MONA 2VPZA 2IZ3A 1WW9A 1KQSY 1M1K2 2ZAEB 1Y1WI 3CXCZ 1LQLA 3VB9A 4A3CI 1VQP1 4MXUA 2DE5A 3CC41 1VQ81 2PK7A 2E9HA 3TDHB 1YIJ1 3LUSA 2Y0SA 3G6EZ 2R92I 3CC21 2IV2X 2NVYI 3CC7Z 4NBFA 3FQQA 1TFIA 3CD6Z 1NP6A 4A3II 3CME1 1SFOI 1YI21 2E2HI 3CCR1 2QR1B 3EERA 4NBHA 4DGLA 3EEDA 3S1NI 2E7ZA 1N8R2 1YUAA 2YU9I 1Q7Y2 2RHBA 3J80f 4E31A 3FKII 3S17I 5IT9f 2JUBA 4CL1A 3J81f 3CCUZ 2DE6A 2K3RA 4A3MI 3ESWA 1VQ51 3CMEZ 1YI2Z 3GTQI 3CCMZ 2KI7B 1USPA 1Q821 1Y1VI 2VPXA 2PM9A 4AYBA 1I3QI 1WZNA 4RVHA 5FLXb 3S14I 1FDIA 4E32A 1ZB8A 1S7MA 1Q16A 3CCLZ 2AYDA 4HGYA 4NBDA 1X3WA 3GTMS 3S16I 2V8JA 3I4NI 3S15I 3CCV1 2OOYB 2OTLZ 3HOXI 1Q812 1VQL1 4MD8A 3GCFA 5IP7I 3CXCY 4DQYB 5CM2M 4NH1C 2JIPA 1PFTA 3NDIA 2VUGA 1KRLA 1Q862 2JNYA 5FLMI 2VPYA 2F4OA 3CCJZ 3FQMA 2M48A 2JA8I 1VQ6Z 2Q4ZA 2BJOA 4X6AI 2OTJ1 1K8A1 1RO2A 3CQZI 4MRIA 3MZKB 1M901 3NH4A 1RQFA 1VQ91 3MONA 2EGTA 2IZ4A 4NBCA 1K9M2 4MH4A 2F4MA 5D1PA 3GTMI 3D6WA 3I55Z 3GTJI 1Z03A 1SIWA 2R93I 2O4HA 4MD9A 1VLAA 2NVQI 2OZKA 3GTKI 3CMAZ 4NFRA 3PO2I 2RBLA 3G711 1VQ9Z 3RZDI 1I6HI 1WIIA 5C4JI 4S1TA 5D1OB 3CCQZ 3CPWY 3I07A 3VMGA 1RNIA 2HF1A 2VF1A 2DE7A 1Y1VS 2QEX1 4A3FI 3J80b 3U50C 1VQPZ 1M1K1 2JIQA 5IT9b 1KD11 2LFUA 4EWCA 4MD7A 2GU2A 3CC4Z 1VQ8Z 3JAMf 2JR6A 1YIJZ 1RO0A 3CC2Z 3Q87A 3MZLB 3VMHA 5LL6f 1JWHC 2V45A 1VQ71 3GTOI 3G4S1 5C3EI 3PO3S 4RS4A 3CPWZ 4E30A 2NVXI 2I3CA 4RVGA 3NDJA 3CCRZ 3NH8A 1Q822 2W03A 2WB1A 3HOVI 2JA7I 1WCMI 3M4OI 2VUMI 4E2ZA 1N8R1 5C4XI 4E2YA 2V8IA 2QA41 1VQN1 4RVDA 4HH4A 2QRCB 4TNUA 1NJI1 3K7AI 1QVGY 3IF8A 1VQ5Z 3KIHA 2LIYA 3BG1B 2K5RA 1K732 3GTLI 3I561 5T67A 1N2FA 3HOYI 4A3GI 4NOZA 3S1QI 4A3BI 3I4MI 2QA4Z 3NFZA 3PO3I 1X3ZA 1VQNZ 1VQK1 2P28A 3S1MI 2V3VA 1NUIA 3GTGI 1ZH1A 2JMOA 3I56Z 3J7A4 2JIMA 3IFUA 1KC82 3TE5B 1K8A2 1YJW1 1YJN1 3CCVZ 2VPWA 2RIQA 5AN9F 1VQLZ 1RLYA 1QVGZ 4RV9A 1Q811 4HGZA 3OW2Z 3GTPI 2AKLA 4NBEA 4NBBA 1Q861 5C44I 2E2JI 4XX2A 1YJWZ 1VQM1 5A2Qf 2OTJZ 1DL6A 1USPB 3T4NB 1YHQ1 2JA5I 2M6NA 2JS4A 1YJ91 3KIFA 3P5JB
chains in the Genus database with same CATH topology
3NH5A 2QKDA 5T64A 3JAMb 2J6AA 4A3DI 1QVFZ 3M3YI 2P3YA 3G6E1 1W2BZ 1K9M1 3HOWI 4NBAA 1VQMZ 1Z02A 1ML8A 3QWUA 2OOXB 1KD12 3CC71 1YHQZ 4QTTA 2QREB 1YJ9Z 1TWGI 2QLVB 2V8KA 1QYPA 3CD61 3G71Z 4Y52I 1TWAI 3J81b 4E33A 4A3LI 1TWCI 4BY1I 3H0GI 1RO4A 5IP9I 2B63I 4BBRI 3HKZA 4A3JI 2NVTI 3GKQA 2QEXZ 2KPIA 4A93I 4NB9A 2R6MA 2HU9A 3CCU1 3RZOI 1ZB9A 4BBSI 4BXXI 3H3VJ 3S2HI 1KQSZ 3CCM1 2Q51A 5T6BA 3F3FC 3VTNA 1TWHI 2W04A 2G2KA 3CCS1 4DK1A 1X0TA 1VQ7Z 1VQO1 1Q7Y1 1YUKA 3D9XA 3G4SZ 1VQ41 3S1RI 1YIT1 1NJI2 2JA6I 3CCE1 2H85A 3CCL1 4NB8A 3IX0A 1JJ2Y 3OW2Y 3CCSZ 1VQOZ 2GTHA 2O53A 2OTL1 2R7ZI 1VQ4Z 1YITZ 2RPRA 1L1OC 5D1OA 4E2WA 2RT9A 3CCEZ 2GTIA 4BY7I 2YADA 1I50I 3HOZI 2PMZA 3CCJ1 1K731 1VQ61 5FLXf 2QRDB 1QVFY 5A2Qb 4A3KI 1S721 1W2BY 1M902 4QTUA 2WAQA 1VQKZ 3F3PC 1JJ2Z 1K83I 1TWFI 3BG0B 4NBGA 1R9TI 1QF8A 2E2II 3I551 1P9NA 4E2XA 3S2DI 1KC81 1YJNZ 3VMIA 1S72Z 4RVFA 3HOUI 1Z01A 4A3EI 3CMA1 3CCQ1 4Y7NI 4MONA 2IZ3A 1WW9A 1KQSY 1M1K2 2ZAEB 1Y1WI 3CXCZ 1LQLA 3VB9A 4A3CI 1VQP1 4MXUA 2DE5A 3CC41 1VQ81 2PK7A 2E9HA 3TDHB 1YIJ1 3LUSA 2Y0SA 3G6EZ 2R92I 3CC21 2NVYI 3CC7Z 4NBFA 3FQQA 1TFIA 3CD6Z 1NP6A 4A3II 3CME1 1SFOI 1YI21 2E2HI 3CCR1 2QR1B 3EERA 4NBHA 4DGLA 3EEDA 3S1NI 1N8R2 1YUAA 2YU9I 1Q7Y2 2RHBA 3J80f 4E31A 3FKII 3S17I 5IT9f 2JUBA 4CL1A 3J81f 3CCUZ 2DE6A 2K3RA 4A3MI 3ESWA 1VQ51 3CMEZ 1YI2Z 3GTQI 3CCMZ 2KI7B 1USPA 1Q821 1Y1VI 2PM9A 4AYBA 1I3QI 4RVHA 5FLXb 3S14I 4E32A 1ZB8A 1S7MA 3CCLZ 4HGYA 4NBDA 1X3WA 3GTMS 3S16I 2V8JA 3I4NI 3S15I 3CCV1 2OOYB 2OTLZ 3HOXI 1Q812 1VQL1 4MD8A 3GCFA 5IP7I 3CXCY 4DQYB 5CM2M 4NH1C 1PFTA 3NDIA 2VUGA 1KRLA 1Q862 2JNYA 5FLMI 2F4OA 3CCJZ 3FQMA 2M48A 2JA8I 1VQ6Z 2Q4ZA 2BJOA 4X6AI 2OTJ1 1K8A1 1RO2A 3CQZI 4MRIA 3MZKB 1M901 3NH4A 1RQFA 1VQ91 3MONA 2EGTA 2IZ4A 4NBCA 1K9M2 4MH4A 2F4MA 5D1PA 3GTMI 3D6WA 3I55Z 3GTJI 1Z03A 2R93I 2O4HA 4MD9A 1VLAA 2NVQI 2OZKA 3GTKI 3CMAZ 4NFRA 3PO2I 2RBLA 3G711 1VQ9Z 3RZDI 1I6HI 1WIIA 5C4JI 4S1TA 5D1OB 3CCQZ 3CPWY 3I07A 3VMGA 1RNIA 2HF1A 2VF1A 2DE7A 1Y1VS 2QEX1 4A3FI 3J80b 3U50C 1VQPZ 1M1K1 5IT9b 1KD11 2LFUA 4EWCA 4MD7A 2GU2A 3CC4Z 1VQ8Z 3JAMf 2JR6A 1YIJZ 1RO0A 3CC2Z 3Q87A 3MZLB 3VMHA 5LL6f 1JWHC 1VQ71 3GTOI 3G4S1 5C3EI 3PO3S 4RS4A 3CPWZ 4E30A 2NVXI 2I3CA 4RVGA 3NDJA 3CCRZ 3NH8A 1Q822 2W03A 2WB1A 3HOVI 2JA7I 1WCMI 3M4OI 2VUMI 4E2ZA 1N8R1 5C4XI 4E2YA 2V8IA 2QA41 1VQN1 4RVDA 4HH4A 2QRCB 4TNUA 1NJI1 3K7AI 1QVGY 3IF8A 1VQ5Z 3KIHA 2LIYA 3BG1B 2K5RA 1K732 3GTLI 3I561 5T67A 1N2FA 3HOYI 4A3GI 4NOZA 3S1QI 4A3BI 3I4MI 2QA4Z 3NFZA 3PO3I 1X3ZA 1VQNZ 1VQK1 2P28A 3S1MI 1NUIA 3GTGI 1ZH1A 2JMOA 3I56Z 3J7A4 3IFUA 1KC82 3TE5B 1K8A2 1YJW1 1YJN1 3CCVZ 2RIQA 5AN9F 1VQLZ 1RLYA 1QVGZ 4RV9A 1Q811 4HGZA 3OW2Z 3GTPI 2AKLA 4NBEA 4NBBA 1Q861 5C44I 2E2JI 4XX2A 1YJWZ 1VQM1 5A2Qf 2OTJZ 1DL6A 1USPB 3T4NB 1YHQ1 2JA5I 2M6NA 2JS4A 1YJ91 3KIFA 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q b;  5IT9 b;  5LL6 f;  3J7A 4;  3J81 b;  3J80 b;  5FLX b;  3JAM b; 
#chains in the Genus database with same CATH topology
 3NH5 A;  1FDO A;  2QKD A;  5T64 A;  3JAM b;  2J6A A;  4A3D I;  1QVF Z;  3M3Y I;  2P3Y A;  3G6E 1;  1W2B Z;  1K9M 1;  3HOW I;  4NBA A;  1VQM Z;  1Z02 A;  1ML8 A;  3QWU A;  2OOX B;  1KD1 2;  3CC7 1;  1YHQ Z;  4QTT A;  2QRE B;  1YJ9 Z;  1QXF A;  1TWG I;  2QLV B;  2V8K A;  1QYP A;  3CD6 1;  3G71 Z;  4Y52 I;  1TWA I;  3J81 b;  4E33 A;  4A3L I;  1TWC I;  4BY1 I;  1AA6 A;  3H0G I;  3D2L A;  1RO4 A;  5IP9 I;  2B63 I;  4BBR I;  3HKZ A;  4A3J I;  2NVT I;  3GKQ A;  2QEX Z;  2KPI A;  4A93 I;  4NB9 A;  2NAP A;  2R6M A;  2HU9 A;  3CCU 1;  3RZO I;  1ZB9 A;  4BBS I;  4BXX I;  3H3V J;  3S2H I;  1KQS Z;  3CCM 1;  2Q51 A;  5T6B A;  3F3F C;  3VTN A;  1TWH I;  2W04 A;  2G2K A;  3CCS 1;  4DK1 A;  1X0T A;  1VQ7 Z;  1VQO 1;  1Q7Y 1;  1YUK A;  3D9X A;  3G4S Z;  1VQ4 1;  3S1R I;  1YIT 1;  1NJI 2;  2JA6 I;  3CCE 1;  2H85 A;  3CCL 1;  4NB8 A;  3IX0 A;  1JJ2 Y;  3OW2 Y;  1WJ2 A;  3IR7 A;  3CCS Z;  1VQO Z;  2GTH A;  2O53 A;  2OTL 1;  2R7Z I;  1VQ4 Z;  1YIT Z;  2RPR A;  1L1O C;  5D1O A;  2JIR A;  4E2W A;  2RT9 A;  3CCE Z;  2GTI A;  4BY7 I;  2YAD A;  1I50 I;  3HOZ I;  2PMZ A;  3CCJ 1;  1K73 1;  1VQ6 1;  5FLX f;  2QRD B;  1QVF Y;  5A2Q b;  4A3K I;  1S72 1;  2LEX A;  1W2B Y;  1M90 2;  4QTU A;  2WAQ A;  1VQK Z;  3F3P C;  1JJ2 Z;  1K83 I;  1TWF I;  3BG0 B;  4NBG A;  1R9T I;  1QF8 A;  2E2I I;  3I55 1;  1P9N A;  4E2X A;  1Y8C A;  3S2D I;  1KC8 1;  1YJN Z;  3VMI A;  1S72 Z;  2JIO A;  4RVF A;  3HOU I;  1Z01 A;  4A3E I;  3CMA 1;  3CCQ 1;  4Y7N I;  4MON A;  2VPZ A;  2IZ3 A;  1WW9 A;  1KQS Y;  1M1K 2;  2ZAE B;  1Y1W I;  3CXC Z;  1LQL A;  3VB9 A;  4A3C I;  1VQP 1;  4MXU A;  2DE5 A;  3CC4 1;  1VQ8 1;  2PK7 A;  2E9H A;  3TDH B;  1YIJ 1;  3LUS A;  2Y0S A;  3G6E Z;  2R92 I;  3CC2 1;  2IV2 X;  2NVY I;  3CC7 Z;  4NBF A;  3FQQ A;  1TFI A;  3CD6 Z;  1NP6 A;  4A3I I;  3CME 1;  1SFO I;  1YI2 1;  2E2H I;  3CCR 1;  2QR1 B;  3EER A;  4NBH A;  4DGL A;  3EED A;  3S1N I;  2E7Z A;  1N8R 2;  1YUA A;  2YU9 I;  1Q7Y 2;  2RHB A;  3J80 f;  4E31 A;  3FKI I;  3S17 I;  5IT9 f;  2JUB A;  4CL1 A;  3J81 f;  3CCU Z;  2DE6 A;  2K3R A;  4A3M I;  3ESW A;  1VQ5 1;  3CME Z;  1YI2 Z;  3GTQ I;  3CCM Z;  2KI7 B;  1USP A;  1Q82 1;  1Y1V I;  2VPX A;  2PM9 A;  4AYB A;  1I3Q I;  1WZN A;  4RVH A;  5FLX b;  3S14 I;  1FDI A;  4E32 A;  1ZB8 A;  1S7M A;  1Q16 A;  3CCL Z;  2AYD A;  4HGY A;  4NBD A;  1X3W A;  3GTM S;  3S16 I;  2V8J A;  3I4N I;  3S15 I;  3CCV 1;  2OOY B;  2OTL Z;  3HOX I;  1Q81 2;  1VQL 1;  4MD8 A;  3GCF A;  5IP7 I;  3CXC Y;  4DQY B;  5CM2 M;  4NH1 C;  2JIP A;  1PFT A;  3NDI A;  2VUG A;  1KRL A;  1Q86 2;  2JNY A;  5FLM I;  2VPY A;  2F4O A;  3CCJ Z;  3FQM A;  2M48 A;  2JA8 I;  1VQ6 Z;  2Q4Z A;  2BJO A;  4X6A I;  2OTJ 1;  1K8A 1;  1RO2 A;  3CQZ I;  4MRI A;  3MZK B;  1M90 1;  3NH4 A;  1RQF A;  1VQ9 1;  3MON A;  2EGT A;  2IZ4 A;  4NBC A;  1K9M 2;  4MH4 A;  2F4M A;  5D1P A;  3GTM I;  3D6W A;  3I55 Z;  3GTJ I;  1Z03 A;  1SIW A;  2R93 I;  2O4H A;  4MD9 A;  1VLA A;  2NVQ I;  2OZK A;  3GTK I;  3CMA Z;  4NFR A;  3PO2 I;  2RBL A;  3G71 1;  1VQ9 Z;  3RZD I;  1I6H I;  1WII A;  5C4J I;  4S1T A;  5D1O B;  3CCQ Z;  3CPW Y;  3I07 A;  3VMG A;  1RNI A;  2HF1 A;  2VF1 A;  2DE7 A;  1Y1V S;  2QEX 1;  4A3F I;  3J80 b;  3U50 C;  1VQP Z;  1M1K 1;  2JIQ A;  5IT9 b;  1KD1 1;  2LFU A;  4EWC A;  4MD7 A;  2GU2 A;  3CC4 Z;  1VQ8 Z;  3JAM f;  2JR6 A;  1YIJ Z;  1RO0 A;  3CC2 Z;  3Q87 A;  3MZL B;  3VMH A;  5LL6 f;  1JWH C;  2V45 A;  1VQ7 1;  3GTO I;  3G4S 1;  5C3E I;  3PO3 S;  4RS4 A;  3CPW Z;  4E30 A;  2NVX I;  2I3C A;  4RVG A;  3NDJ A;  3CCR Z;  3NH8 A;  1Q82 2;  2W03 A;  2WB1 A;  3HOV I;  2JA7 I;  1WCM I;  3M4O I;  2VUM I;  4E2Z A;  1N8R 1;  5C4X I;  4E2Y A;  2V8I A;  2QA4 1;  1VQN 1;  4RVD A;  4HH4 A;  2QRC B;  4TNU A;  1NJI 1;  3K7A I;  1QVG Y;  3IF8 A;  1VQ5 Z;  3KIH A;  2LIY A;  3BG1 B;  2K5R A;  1K73 2;  3GTL I;  3I56 1;  5T67 A;  1N2F A;  3HOY I;  4A3G I;  4NOZ A;  3S1Q I;  4A3B I;  3I4M I;  2QA4 Z;  3NFZ A;  3PO3 I;  1X3Z A;  1VQN Z;  1VQK 1;  2P28 A;  3S1M I;  2V3V A;  1NUI A;  3GTG I;  1ZH1 A;  2JMO A;  3I56 Z;  3J7A 4;  2JIM A;  3IFU A;  1KC8 2;  3TE5 B;  1K8A 2;  1YJW 1;  1YJN 1;  3CCV Z;  2VPW A;  2RIQ A;  5AN9 F;  1VQL Z;  1RLY A;  1QVG Z;  4RV9 A;  1Q81 1;  4HGZ A;  3OW2 Z;  3GTP I;  2AKL A;  4NBE A;  4NBB A;  1Q86 1;  5C44 I;  2E2J I;  4XX2 A;  1YJW Z;  1VQM 1;  5A2Q f;  2OTJ Z;  1DL6 A;  1USP B;  3T4N B;  1YHQ 1;  2JA5 I;  2M6N A;  2JS4 A;  1YJ9 1;  3KIF A;  3P5J B; 
#chains in the Genus database with same CATH homology
 3NH5 A;  2QKD A;  5T64 A;  3JAM b;  2J6A A;  4A3D I;  1QVF Z;  3M3Y I;  2P3Y A;  3G6E 1;  1W2B Z;  1K9M 1;  3HOW I;  4NBA A;  1VQM Z;  1Z02 A;  1ML8 A;  3QWU A;  2OOX B;  1KD1 2;  3CC7 1;  1YHQ Z;  4QTT A;  2QRE B;  1YJ9 Z;  1TWG I;  2QLV B;  2V8K A;  1QYP A;  3CD6 1;  3G71 Z;  4Y52 I;  1TWA I;  3J81 b;  4E33 A;  4A3L I;  1TWC I;  4BY1 I;  3H0G I;  1RO4 A;  5IP9 I;  2B63 I;  4BBR I;  3HKZ A;  4A3J I;  2NVT I;  3GKQ A;  2QEX Z;  2KPI A;  4A93 I;  4NB9 A;  2R6M A;  2HU9 A;  3CCU 1;  3RZO I;  1ZB9 A;  4BBS I;  4BXX I;  3H3V J;  3S2H I;  1KQS Z;  3CCM 1;  2Q51 A;  5T6B A;  3F3F C;  3VTN A;  1TWH I;  2W04 A;  2G2K A;  3CCS 1;  4DK1 A;  1X0T A;  1VQ7 Z;  1VQO 1;  1Q7Y 1;  1YUK A;  3D9X A;  3G4S Z;  1VQ4 1;  3S1R I;  1YIT 1;  1NJI 2;  2JA6 I;  3CCE 1;  2H85 A;  3CCL 1;  4NB8 A;  3IX0 A;  1JJ2 Y;  3OW2 Y;  3CCS Z;  1VQO Z;  2GTH A;  2O53 A;  2OTL 1;  2R7Z I;  1VQ4 Z;  1YIT Z;  2RPR A;  1L1O C;  5D1O A;  4E2W A;  2RT9 A;  3CCE Z;  2GTI A;  4BY7 I;  2YAD A;  1I50 I;  3HOZ I;  2PMZ A;  3CCJ 1;  1K73 1;  1VQ6 1;  5FLX f;  2QRD B;  1QVF Y;  5A2Q b;  4A3K I;  1S72 1;  1W2B Y;  1M90 2;  4QTU A;  2WAQ A;  1VQK Z;  3F3P C;  1JJ2 Z;  1K83 I;  1TWF I;  3BG0 B;  4NBG A;  1R9T I;  1QF8 A;  2E2I I;  3I55 1;  1P9N A;  4E2X A;  3S2D I;  1KC8 1;  1YJN Z;  3VMI A;  1S72 Z;  4RVF A;  3HOU I;  1Z01 A;  4A3E I;  3CMA 1;  3CCQ 1;  4Y7N I;  4MON A;  2IZ3 A;  1WW9 A;  1KQS Y;  1M1K 2;  2ZAE B;  1Y1W I;  3CXC Z;  1LQL A;  3VB9 A;  4A3C I;  1VQP 1;  4MXU A;  2DE5 A;  3CC4 1;  1VQ8 1;  2PK7 A;  2E9H A;  3TDH B;  1YIJ 1;  3LUS A;  2Y0S A;  3G6E Z;  2R92 I;  3CC2 1;  2NVY I;  3CC7 Z;  4NBF A;  3FQQ A;  1TFI A;  3CD6 Z;  1NP6 A;  4A3I I;  3CME 1;  1SFO I;  1YI2 1;  2E2H I;  3CCR 1;  2QR1 B;  3EER A;  4NBH A;  4DGL A;  3EED A;  3S1N I;  1N8R 2;  1YUA A;  2YU9 I;  1Q7Y 2;  2RHB A;  3J80 f;  4E31 A;  3FKI I;  3S17 I;  5IT9 f;  2JUB A;  4CL1 A;  3J81 f;  3CCU Z;  2DE6 A;  2K3R A;  4A3M I;  3ESW A;  1VQ5 1;  3CME Z;  1YI2 Z;  3GTQ I;  3CCM Z;  2KI7 B;  1USP A;  1Q82 1;  1Y1V I;  2PM9 A;  4AYB A;  1I3Q I;  4RVH A;  5FLX b;  3S14 I;  4E32 A;  1ZB8 A;  1S7M A;  3CCL Z;  4HGY A;  4NBD A;  1X3W A;  3GTM S;  3S16 I;  2V8J A;  3I4N I;  3S15 I;  3CCV 1;  2OOY B;  2OTL Z;  3HOX I;  1Q81 2;  1VQL 1;  4MD8 A;  3GCF A;  5IP7 I;  3CXC Y;  4DQY B;  5CM2 M;  4NH1 C;  1PFT A;  3NDI A;  2VUG A;  1KRL A;  1Q86 2;  2JNY A;  5FLM I;  2F4O A;  3CCJ Z;  3FQM A;  2M48 A;  2JA8 I;  1VQ6 Z;  2Q4Z A;  2BJO A;  4X6A I;  2OTJ 1;  1K8A 1;  1RO2 A;  3CQZ I;  4MRI A;  3MZK B;  1M90 1;  3NH4 A;  1RQF A;  1VQ9 1;  3MON A;  2EGT A;  2IZ4 A;  4NBC A;  1K9M 2;  4MH4 A;  2F4M A;  5D1P A;  3GTM I;  3D6W A;  3I55 Z;  3GTJ I;  1Z03 A;  2R93 I;  2O4H A;  4MD9 A;  1VLA A;  2NVQ I;  2OZK A;  3GTK I;  3CMA Z;  4NFR A;  3PO2 I;  2RBL A;  3G71 1;  1VQ9 Z;  3RZD I;  1I6H I;  1WII A;  5C4J I;  4S1T A;  5D1O B;  3CCQ Z;  3CPW Y;  3I07 A;  3VMG A;  1RNI A;  2HF1 A;  2VF1 A;  2DE7 A;  1Y1V S;  2QEX 1;  4A3F I;  3J80 b;  3U50 C;  1VQP Z;  1M1K 1;  5IT9 b;  1KD1 1;  2LFU A;  4EWC A;  4MD7 A;  2GU2 A;  3CC4 Z;  1VQ8 Z;  3JAM f;  2JR6 A;  1YIJ Z;  1RO0 A;  3CC2 Z;  3Q87 A;  3MZL B;  3VMH A;  5LL6 f;  1JWH C;  1VQ7 1;  3GTO I;  3G4S 1;  5C3E I;  3PO3 S;  4RS4 A;  3CPW Z;  4E30 A;  2NVX I;  2I3C A;  4RVG A;  3NDJ A;  3CCR Z;  3NH8 A;  1Q82 2;  2W03 A;  2WB1 A;  3HOV I;  2JA7 I;  1WCM I;  3M4O I;  2VUM I;  4E2Z A;  1N8R 1;  5C4X I;  4E2Y A;  2V8I A;  2QA4 1;  1VQN 1;  4RVD A;  4HH4 A;  2QRC B;  4TNU A;  1NJI 1;  3K7A I;  1QVG Y;  3IF8 A;  1VQ5 Z;  3KIH A;  2LIY A;  3BG1 B;  2K5R A;  1K73 2;  3GTL I;  3I56 1;  5T67 A;  1N2F A;  3HOY I;  4A3G I;  4NOZ A;  3S1Q I;  4A3B I;  3I4M I;  2QA4 Z;  3NFZ A;  3PO3 I;  1X3Z A;  1VQN Z;  1VQK 1;  2P28 A;  3S1M I;  1NUI A;  3GTG I;  1ZH1 A;  2JMO A;  3I56 Z;  3J7A 4;  3IFU A;  1KC8 2;  3TE5 B;  1K8A 2;  1YJW 1;  1YJN 1;  3CCV Z;  2RIQ A;  5AN9 F;  1VQL Z;  1RLY A;  1QVG Z;  4RV9 A;  1Q81 1;  4HGZ A;  3OW2 Z;  3GTP I;  2AKL A;  4NBE A;  4NBB A;  1Q86 1;  5C44 I;  2E2J I;  4XX2 A;  1YJW Z;  1VQM 1;  5A2Q f;  2OTJ Z;  1DL6 A;  1USP B;  3T4N B;  1YHQ 1;  2JA5 I;  2M6N A;  2JS4 A;  1YJ9 1;  3KIF A;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...