5LL6f

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ll6f00
3J81b 3JAMb 5IT9b 3J80b 3J7A4 5A2Qb 5LL6f 5FLXb
chains in the Genus database with same CATH superfamily
2GTHA 5CM2M 3HKZA 5A2Qb 3H0GI 2NVYI 3GCFA 3S1NI 1TWAI 1Z01A 3I4NI 1Z02A 3IR7A 1ZB8A 1LQLA 3CCQZ 1Q822 3PO2I 2RT9A 2QEXZ 1VQ6Z 1SFOI 2R7ZI 1VQO1 3NDJA 3EERA 2JUBA 1N8R2 1QF8A 4RVDA 2OTL1 1RLYA 2H85A 3G4S1 2G2KA 3S15I 1Q862 3PO3I 1VQLZ 3CC71 4RS4A 3CCU1 1Y1VI 2OOXB 2JMOA 3M3YI 5T6BA 2OZKA 4AYBA 2PM9A 4NBDA 1YJN1 3U50C 1QXFA 2JIPA 4QTTA 5IP7I 3S2HI 2PMZA 1K9M2 1YHQZ 2VF1A 1VQ81 1VQKZ 3J81f 1W2BY 3IF8A 2GTIA 1M901 3GTMI 3G71Z 4RV9A 1VQ5Z 2JA5I 4RVFA 3G6EZ 1TWHI 1Q7Y1 2E2HI 1VQ4Z 2DE6A 3S16I 3CCQ1 5C3EI 2DE7A 4NBCA 1VQ61 3CXCY 3NH8A 2VPYA 3LUSA 3VMGA 2K5RA 4RVGA 4HGZA 2O53A 1RQFA 2W04A 4A3FI 2QRDB 1FDIA 2YADA 3IX0A 3EEDA 5D1PA 2VPWA 1USPB 3GTJI 4RVHA 3BG1B 3CC2Z 1Y1WI 1VQL1 2V45A 3HOZI 4MD9A 3F3FC 1YJNZ 3I551 1ML8A 2RHBA 3MONA 3HOUI 3CXCZ 2OOYB 4HGYA 4DGLA 1ZH1A 2E2JI 3F3PC 1YJ9Z 3S2DI 5IP9I 5C4JI 2K3RA 1YHQ1 1M902 2P3YA 3OW2Z 4BBSI 2V8JA 1QYPA 1K8A1 1K83I 1Q7Y2 4A93I 2F4MA 3S17I 1VQK1 4NBEA 4NBFA 5D1OB 3G711 1QVGZ 3RZDI 1VQ51 2JIRA 5FLMI 4A3LI 2VPXA 3G6E1 2E9HA 1VQ41 1AA6A 3S1QI 2AKLA 3CCSZ 5A2Qf 1WIIA 2IZ4A 3CQZI 1KC81 1Q16A 4NBBA 3BG0B 4TNUA 2HU9A 1DL6A 1P9NA 1X3ZA 2QREB 3Q87A 2VUMI 4MXUA 3GTOI 4DK1A 1KQSZ 2IZ3A 3CC21 3I55Z 1YUKA 4Y7NI 1YIT1 3KIHA 4CL1A 3NFZA 1K8A2 2GU2A 1KRLA 2PK7A 3M4OI 1YJ91 4E2YA 4A3BI 1ZB9A 4X6AI 3CC4Z 3H3VJ 2ZAEB 3P5JB 4MONA 5IT9b 3CCMZ 1YJWZ 3CCEZ 4E2ZA 2QRCB 1JWHC 2Q51A 2P28A 4A3KI 3FQQA 1X3WA 1X0TA 1KC82 2IV2X 3GTKI 4NBGA 2DE5A 2J6AA 4NB9A 1USPA 1VQPZ 3NH5A 3D6WA 4S1TA 3CCS1 2B63I 3GKQA 3TDHB 1FDOA 3CD6Z 3S1MI 4MH4A 4A3II 3D2LA 1WW9A 1YIJZ 3OW2Y 3NH4A 1RO4A 2WB1A 3KIFA 4A3CI 1VQNZ 4EWCA 1JJ2Z 2RPRA 4HH4A 3GTQI 4BXXI 4XX2A 3I4MI 1S72Z 3J80b 2VPZA 1I6HI 1YITZ 2YU9I 3FQMA 1QVGY 4QTUA 5LL6f 5D1OA 3VB9A 3TE5B 1YI2Z 1KD11 2M6NA 2M48A 1RO2A 3CC41 3CCLZ 2RBLA 1VQ9Z 2V3VA 1QVFZ 1WZNA 3HOYI 3CCM1 4Y52I 3CCJZ 2R93I 1YJW1 3JAMb 3CCE1 1M1K1 4NOZA 2BJOA 2QR1B 3MZLB 2JA6I 2V8KA 2JA8I 4BY1I 4MD8A 3K7AI 2Q4ZA 3VMIA 3GTPI 3JAMf 1KQSY 1VQMZ 2V8IA 3FKII 3I56Z 1VQP1 2AYDA 2QLVB 1TWCI 5T64A 3HOXI 3CD61 3VTNA 3ESWA 2QKDA 1PFTA 3CMAZ 3GTGI 3VMHA 3I07A 1YIJ1 2NVXI 5T67A 4E30A 2R92I 3MZKB 1VQ7Z 1VQN1 3CPWY 1L1OC 2VUGA 3HOWI 1S721 1K731 2O4HA 3CCVZ 2R6MA 1KD12 4A3DI 2NVTI 2OTJZ 3S1RI 2W03A 2LFUA 1WJ2A 1YUAA 2E7ZA 4NH1C 3J7A4 1M1K2 2LIYA 4NBAA 1NUIA 1YI21 5AN9F 3PO3S 2JIQA 4E33A 1Q811 4E31A 3CCL1 1VQ91 3HOVI 1Y1VS 3IFUA 3CPWZ 1Z03A 3CCJ1 4A3EI 1I50I 2JS4A 4A3MI 5IT9f 4BY7I 2QA4Z 1JJ2Y 4E2WA 2JA7I 3RZOI 4NBHA 2JNYA 3J81b 3CCR1 3S14I 1VQM1 2F4OA 1TWFI 1VLAA 3I561 1NP6A 3CMEZ 4E2XA 5FLXb 3T4NB 4NB8A 1NJI1 5C44I 3GTMS 3CMA1 1K732 3NDIA 5FLXf 1QVFY 4A3GI 2E2II 1VQ71 4MD7A 5C4XI 1VQOZ 2QEX1 2NAPA 1S7MA 1N2FA 2WAQA 2OTLZ 1RO0A 1SIWA 1Q821 3CCV1 1Y8CA 1TWGI 1Q812 2RIQA 4BBRI 3QWUA 3G4SZ 1W2BZ 2OTJ1 3J80f 2Y0SA 4E32A 1N8R1 2KI7B 3CC7Z 3CCUZ 2NVQI 1R9TI 1TFIA 4MRIA 4DQYB 1Q861 2EGTA 2KPIA 4NFRA 1WCMI 1RNIA 3CCRZ 2QA41 3GTLI 2JR6A 1I3QI 2I3CA 1NJI2 3D9XA 1VQ8Z 2JIMA 4A3JI 2JIOA 1K9M1 2HF1A 3CME1 2LEXA
chains in the Genus database with same CATH topology
2GTHA 5CM2M 3HKZA 5A2Qb 3H0GI 2NVYI 3GCFA 3S1NI 1TWAI 1Z01A 3I4NI 1Z02A 1ZB8A 1LQLA 3CCQZ 1Q822 3PO2I 2RT9A 2QEXZ 1VQ6Z 1SFOI 2R7ZI 1VQO1 3NDJA 3EERA 2JUBA 1N8R2 1QF8A 4RVDA 2OTL1 1RLYA 2H85A 3G4S1 2G2KA 3S15I 1Q862 3PO3I 1VQLZ 3CC71 4RS4A 3CCU1 1Y1VI 2OOXB 2JMOA 3M3YI 5T6BA 2OZKA 4AYBA 2PM9A 4NBDA 1YJN1 3U50C 4QTTA 5IP7I 3S2HI 2PMZA 1K9M2 1YHQZ 2VF1A 1VQ81 1VQKZ 3J81f 1W2BY 3IF8A 2GTIA 1M901 3GTMI 3G71Z 4RV9A 1VQ5Z 2JA5I 4RVFA 3G6EZ 1TWHI 1Q7Y1 2E2HI 1VQ4Z 2DE6A 3S16I 3CCQ1 5C3EI 2DE7A 4NBCA 1VQ61 3CXCY 3NH8A 3LUSA 3VMGA 2K5RA 4RVGA 4HGZA 2O53A 1RQFA 2W04A 4A3FI 2QRDB 2YADA 3IX0A 3EEDA 5D1PA 1USPB 3GTJI 4RVHA 3BG1B 3CC2Z 1Y1WI 1VQL1 3HOZI 4MD9A 3F3FC 1YJNZ 3I551 1ML8A 2RHBA 3MONA 3HOUI 3CXCZ 2OOYB 4HGYA 4DGLA 1ZH1A 2E2JI 3F3PC 1YJ9Z 3S2DI 5IP9I 5C4JI 2K3RA 1YHQ1 1M902 2P3YA 3OW2Z 4BBSI 2V8JA 1QYPA 1K8A1 1K83I 1Q7Y2 4A93I 2F4MA 3S17I 1VQK1 4NBEA 4NBFA 5D1OB 3G711 1QVGZ 3RZDI 1VQ51 5FLMI 4A3LI 3G6E1 2E9HA 1VQ41 3S1QI 2AKLA 3CCSZ 5A2Qf 1WIIA 2IZ4A 3CQZI 1KC81 4NBBA 3BG0B 4TNUA 2HU9A 1DL6A 1P9NA 1X3ZA 2QREB 3Q87A 2VUMI 4MXUA 3GTOI 4DK1A 1KQSZ 2IZ3A 3CC21 3I55Z 1YUKA 4Y7NI 1YIT1 3KIHA 4CL1A 3NFZA 1K8A2 2GU2A 1KRLA 2PK7A 3M4OI 1YJ91 4E2YA 4A3BI 1ZB9A 4X6AI 3CC4Z 3H3VJ 2ZAEB 3P5JB 4MONA 5IT9b 3CCMZ 1YJWZ 3CCEZ 4E2ZA 2QRCB 1JWHC 2Q51A 2P28A 4A3KI 3FQQA 1X3WA 1X0TA 1KC82 3GTKI 4NBGA 2DE5A 2J6AA 4NB9A 1USPA 1VQPZ 3NH5A 3D6WA 4S1TA 3CCS1 2B63I 3GKQA 3TDHB 3CD6Z 3S1MI 4MH4A 4A3II 1WW9A 1YIJZ 3OW2Y 3NH4A 1RO4A 2WB1A 3KIFA 4A3CI 1VQNZ 4EWCA 1JJ2Z 2RPRA 4HH4A 3GTQI 4BXXI 4XX2A 3I4MI 1S72Z 3J80b 1I6HI 1YITZ 2YU9I 3FQMA 1QVGY 4QTUA 5LL6f 5D1OA 3VB9A 3TE5B 1YI2Z 1KD11 2M6NA 2M48A 1RO2A 3CC41 3CCLZ 2RBLA 1VQ9Z 1QVFZ 3HOYI 3CCM1 4Y52I 3CCJZ 2R93I 1YJW1 3JAMb 3CCE1 1M1K1 4NOZA 2BJOA 2QR1B 3MZLB 2JA6I 2V8KA 2JA8I 4BY1I 4MD8A 3K7AI 2Q4ZA 3VMIA 3GTPI 3JAMf 1KQSY 1VQMZ 2V8IA 3FKII 3I56Z 1VQP1 2QLVB 1TWCI 5T64A 3HOXI 3CD61 3VTNA 3ESWA 2QKDA 1PFTA 3CMAZ 3GTGI 3VMHA 3I07A 1YIJ1 2NVXI 5T67A 4E30A 2R92I 3MZKB 1VQ7Z 1VQN1 3CPWY 1L1OC 2VUGA 3HOWI 1S721 1K731 2O4HA 3CCVZ 2R6MA 1KD12 4A3DI 2NVTI 2OTJZ 3S1RI 2W03A 2LFUA 1YUAA 4NH1C 3J7A4 1M1K2 2LIYA 4NBAA 1NUIA 1YI21 5AN9F 3PO3S 4E33A 1Q811 4E31A 3CCL1 1VQ91 3HOVI 1Y1VS 3IFUA 3CPWZ 1Z03A 3CCJ1 4A3EI 1I50I 2JS4A 4A3MI 5IT9f 4BY7I 2QA4Z 1JJ2Y 4E2WA 2JA7I 3RZOI 4NBHA 2JNYA 3J81b 3CCR1 3S14I 1VQM1 2F4OA 1TWFI 1VLAA 3I561 1NP6A 3CMEZ 4E2XA 5FLXb 3T4NB 4NB8A 1NJI1 5C44I 3GTMS 3CMA1 1K732 3NDIA 5FLXf 1QVFY 4A3GI 2E2II 1VQ71 4MD7A 5C4XI 1VQOZ 2QEX1 1S7MA 1N2FA 2WAQA 2OTLZ 1RO0A 1Q821 3CCV1 1TWGI 1Q812 2RIQA 4BBRI 3QWUA 3G4SZ 1W2BZ 2OTJ1 3J80f 2Y0SA 4E32A 1N8R1 2KI7B 3CC7Z 3CCUZ 2NVQI 1R9TI 1TFIA 4MRIA 4DQYB 1Q861 2EGTA 2KPIA 4NFRA 1WCMI 1RNIA 3CCRZ 2QA41 3GTLI 2JR6A 1I3QI 2I3CA 1NJI2 3D9XA 1VQ8Z 4A3JI 1K9M1 2HF1A 3CME1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 b;  3JAM b;  5IT9 b;  3J80 b;  3J7A 4;  5A2Q b;  5LL6 f;  5FLX b; 
#chains in the Genus database with same CATH topology
 2GTH A;  5CM2 M;  3HKZ A;  5A2Q b;  3H0G I;  2NVY I;  3GCF A;  3S1N I;  1TWA I;  1Z01 A;  3I4N I;  1Z02 A;  3IR7 A;  1ZB8 A;  1LQL A;  3CCQ Z;  1Q82 2;  3PO2 I;  2RT9 A;  2QEX Z;  1VQ6 Z;  1SFO I;  2R7Z I;  1VQO 1;  3NDJ A;  3EER A;  2JUB A;  1N8R 2;  1QF8 A;  4RVD A;  2OTL 1;  1RLY A;  2H85 A;  3G4S 1;  2G2K A;  3S15 I;  1Q86 2;  3PO3 I;  1VQL Z;  3CC7 1;  4RS4 A;  3CCU 1;  1Y1V I;  2OOX B;  2JMO A;  3M3Y I;  5T6B A;  2OZK A;  4AYB A;  2PM9 A;  4NBD A;  1YJN 1;  3U50 C;  1QXF A;  2JIP A;  4QTT A;  5IP7 I;  3S2H I;  2PMZ A;  1K9M 2;  1YHQ Z;  2VF1 A;  1VQ8 1;  1VQK Z;  3J81 f;  1W2B Y;  3IF8 A;  2GTI A;  1M90 1;  3GTM I;  3G71 Z;  4RV9 A;  1VQ5 Z;  2JA5 I;  4RVF A;  3G6E Z;  1TWH I;  1Q7Y 1;  2E2H I;  1VQ4 Z;  2DE6 A;  3S16 I;  3CCQ 1;  5C3E I;  2DE7 A;  4NBC A;  1VQ6 1;  3CXC Y;  3NH8 A;  2VPY A;  3LUS A;  3VMG A;  2K5R A;  4RVG A;  4HGZ A;  2O53 A;  1RQF A;  2W04 A;  4A3F I;  2QRD B;  1FDI A;  2YAD A;  3IX0 A;  3EED A;  5D1P A;  2VPW A;  1USP B;  3GTJ I;  4RVH A;  3BG1 B;  3CC2 Z;  1Y1W I;  1VQL 1;  2V45 A;  3HOZ I;  4MD9 A;  3F3F C;  1YJN Z;  3I55 1;  1ML8 A;  2RHB A;  3MON A;  3HOU I;  3CXC Z;  2OOY B;  4HGY A;  4DGL A;  1ZH1 A;  2E2J I;  3F3P C;  1YJ9 Z;  3S2D I;  5IP9 I;  5C4J I;  2K3R A;  1YHQ 1;  1M90 2;  2P3Y A;  3OW2 Z;  4BBS I;  2V8J A;  1QYP A;  1K8A 1;  1K83 I;  1Q7Y 2;  4A93 I;  2F4M A;  3S17 I;  1VQK 1;  4NBE A;  4NBF A;  5D1O B;  3G71 1;  1QVG Z;  3RZD I;  1VQ5 1;  2JIR A;  5FLM I;  4A3L I;  2VPX A;  3G6E 1;  2E9H A;  1VQ4 1;  1AA6 A;  3S1Q I;  2AKL A;  3CCS Z;  5A2Q f;  1WII A;  2IZ4 A;  3CQZ I;  1KC8 1;  1Q16 A;  4NBB A;  3BG0 B;  4TNU A;  2HU9 A;  1DL6 A;  1P9N A;  1X3Z A;  2QRE B;  3Q87 A;  2VUM I;  4MXU A;  3GTO I;  4DK1 A;  1KQS Z;  2IZ3 A;  3CC2 1;  3I55 Z;  1YUK A;  4Y7N I;  1YIT 1;  3KIH A;  4CL1 A;  3NFZ A;  1K8A 2;  2GU2 A;  1KRL A;  2PK7 A;  3M4O I;  1YJ9 1;  4E2Y A;  4A3B I;  1ZB9 A;  4X6A I;  3CC4 Z;  3H3V J;  2ZAE B;  3P5J B;  4MON A;  5IT9 b;  3CCM Z;  1YJW Z;  3CCE Z;  4E2Z A;  2QRC B;  1JWH C;  2Q51 A;  2P28 A;  4A3K I;  3FQQ A;  1X3W A;  1X0T A;  1KC8 2;  2IV2 X;  3GTK I;  4NBG A;  2DE5 A;  2J6A A;  4NB9 A;  1USP A;  1VQP Z;  3NH5 A;  3D6W A;  4S1T A;  3CCS 1;  2B63 I;  3GKQ A;  3TDH B;  1FDO A;  3CD6 Z;  3S1M I;  4MH4 A;  4A3I I;  3D2L A;  1WW9 A;  1YIJ Z;  3OW2 Y;  3NH4 A;  1RO4 A;  2WB1 A;  3KIF A;  4A3C I;  1VQN Z;  4EWC A;  1JJ2 Z;  2RPR A;  4HH4 A;  3GTQ I;  4BXX I;  4XX2 A;  3I4M I;  1S72 Z;  3J80 b;  2VPZ A;  1I6H I;  1YIT Z;  2YU9 I;  3FQM A;  1QVG Y;  4QTU A;  5LL6 f;  5D1O A;  3VB9 A;  3TE5 B;  1YI2 Z;  1KD1 1;  2M6N A;  2M48 A;  1RO2 A;  3CC4 1;  3CCL Z;  2RBL A;  1VQ9 Z;  2V3V A;  1QVF Z;  1WZN A;  3HOY I;  3CCM 1;  4Y52 I;  3CCJ Z;  2R93 I;  1YJW 1;  3JAM b;  3CCE 1;  1M1K 1;  4NOZ A;  2BJO A;  2QR1 B;  3MZL B;  2JA6 I;  2V8K A;  2JA8 I;  4BY1 I;  4MD8 A;  3K7A I;  2Q4Z A;  3VMI A;  3GTP I;  3JAM f;  1KQS Y;  1VQM Z;  2V8I A;  3FKI I;  3I56 Z;  1VQP 1;  2AYD A;  2QLV B;  1TWC I;  5T64 A;  3HOX I;  3CD6 1;  3VTN A;  3ESW A;  2QKD A;  1PFT A;  3CMA Z;  3GTG I;  3VMH A;  3I07 A;  1YIJ 1;  2NVX I;  5T67 A;  4E30 A;  2R92 I;  3MZK B;  1VQ7 Z;  1VQN 1;  3CPW Y;  1L1O C;  2VUG A;  3HOW I;  1S72 1;  1K73 1;  2O4H A;  3CCV Z;  2R6M A;  1KD1 2;  4A3D I;  2NVT I;  2OTJ Z;  3S1R I;  2W03 A;  2LFU A;  1WJ2 A;  1YUA A;  2E7Z A;  4NH1 C;  3J7A 4;  1M1K 2;  2LIY A;  4NBA A;  1NUI A;  1YI2 1;  5AN9 F;  3PO3 S;  2JIQ A;  4E33 A;  1Q81 1;  4E31 A;  3CCL 1;  1VQ9 1;  3HOV I;  1Y1V S;  3IFU A;  3CPW Z;  1Z03 A;  3CCJ 1;  4A3E I;  1I50 I;  2JS4 A;  4A3M I;  5IT9 f;  4BY7 I;  2QA4 Z;  1JJ2 Y;  4E2W A;  2JA7 I;  3RZO I;  4NBH A;  2JNY A;  3J81 b;  3CCR 1;  3S14 I;  1VQM 1;  2F4O A;  1TWF I;  1VLA A;  3I56 1;  1NP6 A;  3CME Z;  4E2X A;  5FLX b;  3T4N B;  4NB8 A;  1NJI 1;  5C44 I;  3GTM S;  3CMA 1;  1K73 2;  3NDI A;  5FLX f;  1QVF Y;  4A3G I;  2E2I I;  1VQ7 1;  4MD7 A;  5C4X I;  1VQO Z;  2QEX 1;  2NAP A;  1S7M A;  1N2F A;  2WAQ A;  2OTL Z;  1RO0 A;  1SIW A;  1Q82 1;  3CCV 1;  1Y8C A;  1TWG I;  1Q81 2;  2RIQ A;  4BBR I;  3QWU A;  3G4S Z;  1W2B Z;  2OTJ 1;  3J80 f;  2Y0S A;  4E32 A;  1N8R 1;  2KI7 B;  3CC7 Z;  3CCU Z;  2NVQ I;  1R9T I;  1TFI A;  4MRI A;  4DQY B;  1Q86 1;  2EGT A;  2KPI A;  4NFR A;  1WCM I;  1RNI A;  3CCR Z;  2QA4 1;  3GTL I;  2JR6 A;  1I3Q I;  2I3C A;  1NJI 2;  3D9X A;  1VQ8 Z;  2JIM A;  4A3J I;  2JIO A;  1K9M 1;  2HF1 A;  3CME 1;  2LEX A; 
#chains in the Genus database with same CATH homology
 2GTH A;  5CM2 M;  3HKZ A;  5A2Q b;  3H0G I;  2NVY I;  3GCF A;  3S1N I;  1TWA I;  1Z01 A;  3I4N I;  1Z02 A;  1ZB8 A;  1LQL A;  3CCQ Z;  1Q82 2;  3PO2 I;  2RT9 A;  2QEX Z;  1VQ6 Z;  1SFO I;  2R7Z I;  1VQO 1;  3NDJ A;  3EER A;  2JUB A;  1N8R 2;  1QF8 A;  4RVD A;  2OTL 1;  1RLY A;  2H85 A;  3G4S 1;  2G2K A;  3S15 I;  1Q86 2;  3PO3 I;  1VQL Z;  3CC7 1;  4RS4 A;  3CCU 1;  1Y1V I;  2OOX B;  2JMO A;  3M3Y I;  5T6B A;  2OZK A;  4AYB A;  2PM9 A;  4NBD A;  1YJN 1;  3U50 C;  4QTT A;  5IP7 I;  3S2H I;  2PMZ A;  1K9M 2;  1YHQ Z;  2VF1 A;  1VQ8 1;  1VQK Z;  3J81 f;  1W2B Y;  3IF8 A;  2GTI A;  1M90 1;  3GTM I;  3G71 Z;  4RV9 A;  1VQ5 Z;  2JA5 I;  4RVF A;  3G6E Z;  1TWH I;  1Q7Y 1;  2E2H I;  1VQ4 Z;  2DE6 A;  3S16 I;  3CCQ 1;  5C3E I;  2DE7 A;  4NBC A;  1VQ6 1;  3CXC Y;  3NH8 A;  3LUS A;  3VMG A;  2K5R A;  4RVG A;  4HGZ A;  2O53 A;  1RQF A;  2W04 A;  4A3F I;  2QRD B;  2YAD A;  3IX0 A;  3EED A;  5D1P A;  1USP B;  3GTJ I;  4RVH A;  3BG1 B;  3CC2 Z;  1Y1W I;  1VQL 1;  3HOZ I;  4MD9 A;  3F3F C;  1YJN Z;  3I55 1;  1ML8 A;  2RHB A;  3MON A;  3HOU I;  3CXC Z;  2OOY B;  4HGY A;  4DGL A;  1ZH1 A;  2E2J I;  3F3P C;  1YJ9 Z;  3S2D I;  5IP9 I;  5C4J I;  2K3R A;  1YHQ 1;  1M90 2;  2P3Y A;  3OW2 Z;  4BBS I;  2V8J A;  1QYP A;  1K8A 1;  1K83 I;  1Q7Y 2;  4A93 I;  2F4M A;  3S17 I;  1VQK 1;  4NBE A;  4NBF A;  5D1O B;  3G71 1;  1QVG Z;  3RZD I;  1VQ5 1;  5FLM I;  4A3L I;  3G6E 1;  2E9H A;  1VQ4 1;  3S1Q I;  2AKL A;  3CCS Z;  5A2Q f;  1WII A;  2IZ4 A;  3CQZ I;  1KC8 1;  4NBB A;  3BG0 B;  4TNU A;  2HU9 A;  1DL6 A;  1P9N A;  1X3Z A;  2QRE B;  3Q87 A;  2VUM I;  4MXU A;  3GTO I;  4DK1 A;  1KQS Z;  2IZ3 A;  3CC2 1;  3I55 Z;  1YUK A;  4Y7N I;  1YIT 1;  3KIH A;  4CL1 A;  3NFZ A;  1K8A 2;  2GU2 A;  1KRL A;  2PK7 A;  3M4O I;  1YJ9 1;  4E2Y A;  4A3B I;  1ZB9 A;  4X6A I;  3CC4 Z;  3H3V J;  2ZAE B;  3P5J B;  4MON A;  5IT9 b;  3CCM Z;  1YJW Z;  3CCE Z;  4E2Z A;  2QRC B;  1JWH C;  2Q51 A;  2P28 A;  4A3K I;  3FQQ A;  1X3W A;  1X0T A;  1KC8 2;  3GTK I;  4NBG A;  2DE5 A;  2J6A A;  4NB9 A;  1USP A;  1VQP Z;  3NH5 A;  3D6W A;  4S1T A;  3CCS 1;  2B63 I;  3GKQ A;  3TDH B;  3CD6 Z;  3S1M I;  4MH4 A;  4A3I I;  1WW9 A;  1YIJ Z;  3OW2 Y;  3NH4 A;  1RO4 A;  2WB1 A;  3KIF A;  4A3C I;  1VQN Z;  4EWC A;  1JJ2 Z;  2RPR A;  4HH4 A;  3GTQ I;  4BXX I;  4XX2 A;  3I4M I;  1S72 Z;  3J80 b;  1I6H I;  1YIT Z;  2YU9 I;  3FQM A;  1QVG Y;  4QTU A;  5LL6 f;  5D1O A;  3VB9 A;  3TE5 B;  1YI2 Z;  1KD1 1;  2M6N A;  2M48 A;  1RO2 A;  3CC4 1;  3CCL Z;  2RBL A;  1VQ9 Z;  1QVF Z;  3HOY I;  3CCM 1;  4Y52 I;  3CCJ Z;  2R93 I;  1YJW 1;  3JAM b;  3CCE 1;  1M1K 1;  4NOZ A;  2BJO A;  2QR1 B;  3MZL B;  2JA6 I;  2V8K A;  2JA8 I;  4BY1 I;  4MD8 A;  3K7A I;  2Q4Z A;  3VMI A;  3GTP I;  3JAM f;  1KQS Y;  1VQM Z;  2V8I A;  3FKI I;  3I56 Z;  1VQP 1;  2QLV B;  1TWC I;  5T64 A;  3HOX I;  3CD6 1;  3VTN A;  3ESW A;  2QKD A;  1PFT A;  3CMA Z;  3GTG I;  3VMH A;  3I07 A;  1YIJ 1;  2NVX I;  5T67 A;  4E30 A;  2R92 I;  3MZK B;  1VQ7 Z;  1VQN 1;  3CPW Y;  1L1O C;  2VUG A;  3HOW I;  1S72 1;  1K73 1;  2O4H A;  3CCV Z;  2R6M A;  1KD1 2;  4A3D I;  2NVT I;  2OTJ Z;  3S1R I;  2W03 A;  2LFU A;  1YUA A;  4NH1 C;  3J7A 4;  1M1K 2;  2LIY A;  4NBA A;  1NUI A;  1YI2 1;  5AN9 F;  3PO3 S;  4E33 A;  1Q81 1;  4E31 A;  3CCL 1;  1VQ9 1;  3HOV I;  1Y1V S;  3IFU A;  3CPW Z;  1Z03 A;  3CCJ 1;  4A3E I;  1I50 I;  2JS4 A;  4A3M I;  5IT9 f;  4BY7 I;  2QA4 Z;  1JJ2 Y;  4E2W A;  2JA7 I;  3RZO I;  4NBH A;  2JNY A;  3J81 b;  3CCR 1;  3S14 I;  1VQM 1;  2F4O A;  1TWF I;  1VLA A;  3I56 1;  1NP6 A;  3CME Z;  4E2X A;  5FLX b;  3T4N B;  4NB8 A;  1NJI 1;  5C44 I;  3GTM S;  3CMA 1;  1K73 2;  3NDI A;  5FLX f;  1QVF Y;  4A3G I;  2E2I I;  1VQ7 1;  4MD7 A;  5C4X I;  1VQO Z;  2QEX 1;  1S7M A;  1N2F A;  2WAQ A;  2OTL Z;  1RO0 A;  1Q82 1;  3CCV 1;  1TWG I;  1Q81 2;  2RIQ A;  4BBR I;  3QWU A;  3G4S Z;  1W2B Z;  2OTJ 1;  3J80 f;  2Y0S A;  4E32 A;  1N8R 1;  2KI7 B;  3CC7 Z;  3CCU Z;  2NVQ I;  1R9T I;  1TFI A;  4MRI A;  4DQY B;  1Q86 1;  2EGT A;  2KPI A;  4NFR A;  1WCM I;  1RNI A;  3CCR Z;  2QA4 1;  3GTL I;  2JR6 A;  1I3Q I;  2I3C A;  1NJI 2;  3D9X A;  1VQ8 Z;  4A3J I;  1K9M 1;  2HF1 A;  3CME 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...