4A93I

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I02
1TWAI 2JS4A 2F4MA 3VB9A 5C4JI 4MH4A 3S1NI 3U50C 3I07A 1TFIA 3GTMI 3S17I 2VUMI 3HOZI 4NBEA 3HOUI 4X6AI 4A3CI 1ZB8A 4BXXI 3PO3I 1L1OC 1DL6A 4NBHA 1I50I 3S1RI 5IP9I 3PO3S 4A93I 4A3DI 5C4XI 2B63I 2E2JI 3GTOI 3VMIA 1NUIA 2DE7A 3GKQA 3GCFA 1PFTA 4NBGA 1TWHI 2R92I 4BBRI 3S2HI 4BBSI 1Y1WI 4A3GI 4BY1I 3I4MI 2JNYA 3M3YI 2AKLA 1TWCI 2NVXI 2BJOA 1RO4A 1ZB9A 2NVYI 2F4OA 5CM2M 1RLYA 2R93I 3LUSA 2RBLA 1Y1VI 3GTQI 4Y52I 2KPIA 2NVTI 1USPA 3HOVI 1X3WA 3D6WA 1TWFI 3EERA 1YUAA 1SFOI 2DE6A 2JR6A 3ESWA 2J6AA 3HOXI 2E2II 3Q87A 3S2DI 4A3FI 1VLAA 4NBBA 3GTJI 1TWGI 3H3VJ 2NVQI 1I6HI 1WCMI 2HF1A 3S1MI 4QTTA 4NOZA 1QYPA 3RZOI 3VMGA 1WW9A 2JA5I 5IP7I 2E2HI 3S1QI 3S15I 3H0GI 4A3KI 3S14I 4A3EI 3S16I 3VMHA 2JA6I 3GTLI 1ML8A 2K5RA 4NBFA 1K83I 3HOYI 4A3JI 4NBAA 4NBCA 2P3YA 3GTMS 1X3ZA 2YU9I 3K7AI 4NB8A 4A3MI 3FKII 4A3II 3RZDI 3HOWI 1R9TI 2JA8I 3M4OI 1USPB 3PO2I 2PK7A 4XX2A 4A3LI 3I4NI 1LQLA 2R7ZI 4NB9A 4QTUA 4BY7I 5C44I 1N2FA 4NBDA 5FLMI 4Y7NI 1Y1VS 3GTKI 3GTPI 2DE5A 3CQZI 2JA7I 4A3BI 5C3EI 3GTGI 1I3QI
chains in the Genus database with same CATH superfamily
5FLXf 5T64A 3CCJ1 1KRLA 2F4MA 2JIQA 1Q811 3S17I 3HOZI 4NBEA 3CCJZ 4X6AI 1ZB8A 1YITZ 3BG0B 2GTIA 2OOYB 1L1OC 2WAQA 1VQO1 3G6EZ 4E30A 3S1RI 3NH4A 3G6E1 5IT9b 1PFTA 4NBGA 1KD12 1K732 4BBSI 3CCL1 1K8A1 1YIJZ 2R6MA 1WJ2A 1Q812 1VQ81 5CM2M 3HKZA 2Y0SA 2RBLA 1Y1VI 3T4NB 1M901 2JMOA 1QXFA 2KPIA 2PM9A 1RNIA 3HOVI 2OTL1 4E2XA 3FQQA 1Q861 1SFOI 2OTLZ 5D1OA 3F3FC 2J6AA 1KQSZ 2I3CA 3S2DI 3CCS1 3KIHA 3GTJI 3CCUZ 1VQ9Z 4MD7A 2WB1A 2HF1A 1Q822 4QTTA 5T6BA 3CXCY 1QYPA 3RZOI 1RO2A 3VMGA 3OW2Z 3QWUA 5IP7I 1VQ51 3NFZA 3CCLZ 2JA6I 1ML8A 2RT9A 4DK1A 2PMZA 2P3YA 2VPXA 2Q4ZA 4A3MI 2LEXA 2QRCB 2K3RA 1R9TI 4A3LI 1S721 1RO0A 2OZKA 4Y7NI 1Y1VS 3J81f 2RIQA 1YI2Z 2JIMA 1SIWA 5C3EI 1I3QI 2E7ZA 1Z01A 3NH8A 1TWAI 3I55Z 2JS4A 1QVFY 1KC81 3S1NI 5C4JI 4MH4A 3I56Z 3U50C 3BG1B 1M902 2QA4Z 3GTMI 1YJN1 3I551 1VQPZ 2JIPA 4BXXI 3I561 5LL6f 2HU9A 3IX0A 1DL6A 1WZNA 1VQP1 1I50I 5IP9I 3CCR1 3GTOI 1NUIA 3GKQA 3GCFA 4E33A 2R92I 3G4SZ 3CC2Z 4A3GI 1Y1WI 4HGYA 3CCRZ 4BY1I 1JWHC 1M1K2 2AKLA 4MD9A 1QVGY 3D2LA 5A2Qf 1VQ41 4TNUA 2R93I 3GTQI 2O4HA 2RPRA 3CC41 2IZ3A 3EERA 1K9M2 2VF1A 3CME1 1VQK1 2VPZA 2E2II 3Q87A 3TDHB 3G71Z 4E32A 1WCMI 4NOZA 1Q7Y2 3G711 4RVGA 2NAPA 3S15I 3H0GI 2QEXZ 2JUBA 1VQOZ 3GTLI 2K5RA 4MD8A 3CMA1 4NBCA 4MONA 3CCE1 3MZKB 2OTJZ 2QRDB 1VQ71 3FKII 4RVDA 3RZDI 3NDIA 3CC4Z 2JA8I 3M4OI 1USPB 3PO2I 3I4NI 4NB9A 5C44I 1N2FA 4NBDA 5FLMI 4RVHA 1M1K1 1YJW1 2VUGA 2M48A 3GTGI 1YJWZ 3CC7Z 3CCQZ 3VB9A 1NJI2 2E9HA 1TFIA 1YJ91 3CCQ1 3HOUI 3CCSZ 4DGLA 2V45A 4NBHA 1Z03A 2V3VA 4A93I 5C4XI 2B63I 2E2JI 3NH5A 3VMIA 2DE7A 4EWCA 1QVGZ 1TWHI 3S2HI 2QREB 3JAMf 3M3YI 1NJI1 1NP6A 1TWCI 1Q16A 4MRIA 4RVFA 4E31A 2NVXI 1KC82 1QVFZ 1ZB9A 1RLYA 3LUSA 4Y52I 2LIYA 1FDOA 2H85A 1USPA 3TE5B 1X3WA 1TWFI 2ZAEB 3CC71 2DE6A 2JR6A 3KIFA 2Q51A 3HOXI 2V8IA 4S1TA 1YJ9Z 4A3FI 1YIT1 4CL1A 2EGTA 4E2ZA 3H3VJ 1I6HI 3S1MI 3CD61 2QKDA 1VQ5Z 1K9M1 3CCU1 1VQ91 3CCM1 2AYDA 1YHQ1 3F3PC 2E2HI 3J7A4 2JIRA 4AYBA 4HH4A 3CCMZ 1YIJ1 4NBFA 1QF8A 1K83I 3HOYI 2O53A 4A3JI 1S7MA 1P9NA 1ZH1A 1VQ8Z 3IR7A 2YU9I 3G4S1 3CC21 3K7AI 4E2WA 1JJ2Y 3HOWI 3CCV1 3IFUA 1LQLA 2RHBA 1RQFA 1VQ4Z 5FLXb 3EEDA 1Q7Y1 4RS4A 3GTKI 1K731 3GTPI 1N8R1 3CQZI 4HGZA 2P28A 4A3BI 3J80b 3S14I 2G2KA 2V8KA 5A2Qb 1VQ61 3CD6Z 2JIOA 4NFRA 3I07A 2VUMI 2VPYA 4A3CI 1YHQZ 1VQL1 1W2BZ 3PO3I 1JJ2Z 2QA41 1AA6A 5IT9f 1YJNZ 1WIIA 3D9XA 3NDJA 2M6NA 3J80f 1Q862 2OOXB 1W2BY 3PO3S 4A3DI 2GU2A 2LFUA 4BBRI 1YUKA 3IF8A 4E2YA 1X0TA 2QR1B 3I4MI 2JNYA 3P5JB 1Y8CA 2GTHA 3CCVZ 3CMAZ 2KI7B 1Q821 4RV9A 2IV2X 2YADA 2BJOA 1RO4A 1S72Z 3OW2Y 2NVYI 2F4OA 3VTNA 3CCEZ 4DQYB 2OTJ1 1YI21 1VQ7Z 3FQMA 5D1OB 1KD11 2NVTI 3D6WA 2W04A 1VQ6Z 1YUAA 3ESWA 1VQNZ 1VLAA 4NBBA 1K8A2 2VPWA 1VQLZ 1TWGI 2NVQI 5T67A 1WW9A 2JA5I 3CPWY 3JAMb 3S1QI 4A3KI 3MONA 3CXCZ 4A3EI 1N8R2 3S16I 3VMHA 1VQM1 2V8JA 2QEX1 3CPWZ 4NBAA 1VQMZ 5AN9F 3GTMS 1X3ZA 4NB8A 2QLVB 4A3II 3MZLB 4MXUA 3J81b 1Z02A 2PK7A 4XX2A 2R7ZI 3CMEZ 1VQKZ 4QTUA 4BY7I 4NH1C 5D1PA 1FDIA 1KQSY 2W03A 1VQN1 2DE5A 2JA7I 2IZ4A
chains in the Genus database with same CATH topology
5FLXf 5T64A 3CCJ1 1KRLA 2F4MA 1Q811 3S17I 3HOZI 4NBEA 3CCJZ 4X6AI 1ZB8A 1YITZ 3BG0B 2GTIA 2OOYB 1L1OC 2WAQA 1VQO1 3G6EZ 4E30A 3S1RI 3NH4A 3G6E1 5IT9b 1PFTA 4NBGA 1KD12 1K732 4BBSI 3CCL1 1K8A1 1YIJZ 2R6MA 1Q812 1VQ81 5CM2M 3HKZA 2Y0SA 2RBLA 1Y1VI 3T4NB 1M901 2JMOA 2PM9A 2KPIA 1RNIA 3HOVI 2OTL1 4E2XA 3FQQA 1Q861 1SFOI 2OTLZ 5D1OA 3F3FC 2J6AA 1KQSZ 2I3CA 3S2DI 3CCS1 3KIHA 3GTJI 3CCUZ 1VQ9Z 4MD7A 2WB1A 2HF1A 1Q822 4QTTA 5T6BA 3CXCY 1QYPA 3RZOI 1RO2A 3VMGA 3OW2Z 3QWUA 5IP7I 1VQ51 3NFZA 3CCLZ 2JA6I 1ML8A 2RT9A 4DK1A 2PMZA 2P3YA 2Q4ZA 4A3MI 2QRCB 2K3RA 1R9TI 4A3LI 1S721 1RO0A 2OZKA 4Y7NI 1Y1VS 3J81f 2RIQA 1YI2Z 5C3EI 1I3QI 1Z01A 3NH8A 1TWAI 3I55Z 2JS4A 1QVFY 1KC81 3S1NI 5C4JI 4MH4A 3I56Z 3U50C 3BG1B 1M902 2QA4Z 3GTMI 1YJN1 3I551 1VQPZ 4BXXI 3I561 5LL6f 2HU9A 3IX0A 1DL6A 1VQP1 1I50I 5IP9I 3CCR1 3GTOI 1NUIA 3GKQA 3GCFA 4E33A 2R92I 3G4SZ 3CC2Z 4A3GI 1Y1WI 4HGYA 3CCRZ 4BY1I 1JWHC 1M1K2 2AKLA 4MD9A 1QVGY 5A2Qf 1VQ41 4TNUA 2R93I 3GTQI 2O4HA 2RPRA 3CC41 2IZ3A 3EERA 1K9M2 2VF1A 3CME1 1VQK1 2E2II 3Q87A 3TDHB 3G71Z 4E32A 1WCMI 4NOZA 1Q7Y2 3G711 4RVGA 3S15I 3H0GI 2QEXZ 2JUBA 1VQOZ 3GTLI 2K5RA 4MD8A 3CMA1 4NBCA 4MONA 3CCE1 3MZKB 2OTJZ 2QRDB 1VQ71 3FKII 4RVDA 3RZDI 3NDIA 3CC4Z 2JA8I 3M4OI 1USPB 3PO2I 3I4NI 4NB9A 5C44I 1N2FA 4NBDA 5FLMI 4RVHA 1M1K1 1YJW1 2VUGA 2M48A 3GTGI 1YJWZ 3CC7Z 3CCQZ 3VB9A 1NJI2 2E9HA 1TFIA 1YJ91 3CCQ1 3HOUI 3CCSZ 4DGLA 4NBHA 1Z03A 4A93I 5C4XI 2B63I 2E2JI 3NH5A 3VMIA 2DE7A 4EWCA 1QVGZ 1TWHI 3S2HI 2QREB 3JAMf 3M3YI 1NJI1 1NP6A 1TWCI 4MRIA 4RVFA 4E31A 2NVXI 1KC82 1QVFZ 1ZB9A 1RLYA 3LUSA 4Y52I 2LIYA 2H85A 1USPA 3TE5B 1X3WA 1TWFI 2ZAEB 3CC71 2DE6A 2JR6A 3KIFA 2Q51A 3HOXI 2V8IA 4S1TA 1YJ9Z 4A3FI 1YIT1 4CL1A 2EGTA 4E2ZA 3H3VJ 1I6HI 3S1MI 3CD61 2QKDA 1VQ5Z 1K9M1 3CCU1 1VQ91 3CCM1 1YHQ1 2E2HI 3F3PC 3J7A4 4AYBA 4HH4A 3CCMZ 1YIJ1 4NBFA 1QF8A 1K83I 3HOYI 2O53A 4A3JI 1S7MA 1P9NA 1ZH1A 1VQ8Z 2YU9I 3G4S1 3CC21 3K7AI 4E2WA 1JJ2Y 3HOWI 3CCV1 3IFUA 1LQLA 2RHBA 1RQFA 1VQ4Z 5FLXb 3EEDA 1Q7Y1 4RS4A 3GTKI 1K731 3GTPI 1N8R1 3CQZI 4HGZA 2P28A 4A3BI 3J80b 3S14I 2G2KA 2V8KA 5A2Qb 1VQ61 3CD6Z 4NFRA 3I07A 2VUMI 4A3CI 1YHQZ 1VQL1 1W2BZ 3PO3I 1JJ2Z 2QA41 5IT9f 1YJNZ 1WIIA 3D9XA 3NDJA 2M6NA 3J80f 1Q862 2OOXB 1W2BY 3PO3S 4A3DI 2GU2A 2LFUA 4BBRI 1YUKA 3IF8A 4E2YA 1X0TA 2QR1B 3I4MI 2JNYA 3P5JB 2GTHA 3CCVZ 3CMAZ 2KI7B 1Q821 4RV9A 2YADA 2BJOA 1RO4A 1S72Z 3OW2Y 2NVYI 2F4OA 3VTNA 3CCEZ 4DQYB 2OTJ1 1YI21 1VQ7Z 3FQMA 5D1OB 1KD11 2NVTI 3D6WA 2W04A 1VQ6Z 1YUAA 3ESWA 1VQNZ 1VLAA 4NBBA 1K8A2 1VQLZ 1TWGI 2NVQI 5T67A 1WW9A 2JA5I 3CPWY 3JAMb 3S1QI 4A3KI 3MONA 3CXCZ 4A3EI 1N8R2 3S16I 3VMHA 1VQM1 2V8JA 2QEX1 3CPWZ 4NBAA 1VQMZ 5AN9F 3GTMS 1X3ZA 4NB8A 2QLVB 4A3II 3MZLB 4MXUA 3J81b 1Z02A 2PK7A 4XX2A 2R7ZI 3CMEZ 1VQKZ 4QTUA 4BY7I 4NH1C 5D1PA 1KQSY 2W03A 1VQN1 2DE5A 2JA7I 2IZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  2JS4 A;  2F4M A;  3VB9 A;  5C4J I;  4MH4 A;  3S1N I;  3U50 C;  3I07 A;  1TFI A;  3GTM I;  3S17 I;  2VUM I;  3HOZ I;  4NBE A;  3HOU I;  4X6A I;  4A3C I;  1ZB8 A;  4BXX I;  3PO3 I;  1L1O C;  1DL6 A;  4NBH A;  1I50 I;  3S1R I;  5IP9 I;  3PO3 S;  4A93 I;  4A3D I;  5C4X I;  2B63 I;  2E2J I;  3GTO I;  3VMI A;  1NUI A;  2DE7 A;  3GKQ A;  3GCF A;  1PFT A;  4NBG A;  1TWH I;  2R92 I;  4BBR I;  3S2H I;  4BBS I;  1Y1W I;  4A3G I;  4BY1 I;  3I4M I;  2JNY A;  3M3Y I;  2AKL A;  1TWC I;  2NVX I;  2BJO A;  1RO4 A;  1ZB9 A;  2NVY I;  2F4O A;  5CM2 M;  1RLY A;  2R93 I;  3LUS A;  2RBL A;  1Y1V I;  3GTQ I;  4Y52 I;  2KPI A;  2NVT I;  1USP A;  3HOV I;  1X3W A;  3D6W A;  1TWF I;  3EER A;  1YUA A;  1SFO I;  2DE6 A;  2JR6 A;  3ESW A;  2J6A A;  3HOX I;  2E2I I;  3Q87 A;  3S2D I;  4A3F I;  1VLA A;  4NBB A;  3GTJ I;  1TWG I;  3H3V J;  2NVQ I;  1I6H I;  1WCM I;  2HF1 A;  3S1M I;  4QTT A;  4NOZ A;  1QYP A;  3RZO I;  3VMG A;  1WW9 A;  2JA5 I;  5IP7 I;  2E2H I;  3S1Q I;  3S15 I;  3H0G I;  4A3K I;  3S14 I;  4A3E I;  3S16 I;  3VMH A;  2JA6 I;  3GTL I;  1ML8 A;  2K5R A;  4NBF A;  1K83 I;  3HOY I;  4A3J I;  4NBA A;  4NBC A;  2P3Y A;  3GTM S;  1X3Z A;  2YU9 I;  3K7A I;  4NB8 A;  4A3M I;  3FKI I;  4A3I I;  3RZD I;  3HOW I;  1R9T I;  2JA8 I;  3M4O I;  1USP B;  3PO2 I;  2PK7 A;  4XX2 A;  4A3L I;  3I4N I;  1LQL A;  2R7Z I;  4NB9 A;  4QTU A;  4BY7 I;  5C44 I;  1N2F A;  4NBD A;  5FLM I;  4Y7N I;  1Y1V S;  3GTK I;  3GTP I;  2DE5 A;  3CQZ I;  2JA7 I;  4A3B I;  5C3E I;  3GTG I;  1I3Q I; 
#chains in the Genus database with same CATH topology
 5FLX f;  5T64 A;  3CCJ 1;  1KRL A;  2F4M A;  2JIQ A;  1Q81 1;  3S17 I;  3HOZ I;  4NBE A;  3CCJ Z;  4X6A I;  1ZB8 A;  1YIT Z;  3BG0 B;  2GTI A;  2OOY B;  1L1O C;  2WAQ A;  1VQO 1;  3G6E Z;  4E30 A;  3S1R I;  3NH4 A;  3G6E 1;  5IT9 b;  1PFT A;  4NBG A;  1KD1 2;  1K73 2;  4BBS I;  3CCL 1;  1K8A 1;  1YIJ Z;  2R6M A;  1WJ2 A;  1Q81 2;  1VQ8 1;  5CM2 M;  3HKZ A;  2Y0S A;  2RBL A;  1Y1V I;  3T4N B;  1M90 1;  2JMO A;  1QXF A;  2KPI A;  2PM9 A;  1RNI A;  3HOV I;  2OTL 1;  4E2X A;  3FQQ A;  1Q86 1;  1SFO I;  2OTL Z;  5D1O A;  3F3F C;  2J6A A;  1KQS Z;  2I3C A;  3S2D I;  3CCS 1;  3KIH A;  3GTJ I;  3CCU Z;  1VQ9 Z;  4MD7 A;  2WB1 A;  2HF1 A;  1Q82 2;  4QTT A;  5T6B A;  3CXC Y;  1QYP A;  3RZO I;  1RO2 A;  3VMG A;  3OW2 Z;  3QWU A;  5IP7 I;  1VQ5 1;  3NFZ A;  3CCL Z;  2JA6 I;  1ML8 A;  2RT9 A;  4DK1 A;  2PMZ A;  2P3Y A;  2VPX A;  2Q4Z A;  4A3M I;  2LEX A;  2QRC B;  2K3R A;  1R9T I;  4A3L I;  1S72 1;  1RO0 A;  2OZK A;  4Y7N I;  1Y1V S;  3J81 f;  2RIQ A;  1YI2 Z;  2JIM A;  1SIW A;  5C3E I;  1I3Q I;  2E7Z A;  1Z01 A;  3NH8 A;  1TWA I;  3I55 Z;  2JS4 A;  1QVF Y;  1KC8 1;  3S1N I;  5C4J I;  4MH4 A;  3I56 Z;  3U50 C;  3BG1 B;  1M90 2;  2QA4 Z;  3GTM I;  1YJN 1;  3I55 1;  1VQP Z;  2JIP A;  4BXX I;  3I56 1;  5LL6 f;  2HU9 A;  3IX0 A;  1DL6 A;  1WZN A;  1VQP 1;  1I50 I;  5IP9 I;  3CCR 1;  3GTO I;  1NUI A;  3GKQ A;  3GCF A;  4E33 A;  2R92 I;  3G4S Z;  3CC2 Z;  4A3G I;  1Y1W I;  4HGY A;  3CCR Z;  4BY1 I;  1JWH C;  1M1K 2;  2AKL A;  4MD9 A;  1QVG Y;  3D2L A;  5A2Q f;  1VQ4 1;  4TNU A;  2R93 I;  3GTQ I;  2O4H A;  2RPR A;  3CC4 1;  2IZ3 A;  3EER A;  1K9M 2;  2VF1 A;  3CME 1;  1VQK 1;  2VPZ A;  2E2I I;  3Q87 A;  3TDH B;  3G71 Z;  4E32 A;  1WCM I;  4NOZ A;  1Q7Y 2;  3G71 1;  4RVG A;  2NAP A;  3S15 I;  3H0G I;  2QEX Z;  2JUB A;  1VQO Z;  3GTL I;  2K5R A;  4MD8 A;  3CMA 1;  4NBC A;  4MON A;  3CCE 1;  3MZK B;  2OTJ Z;  2QRD B;  1VQ7 1;  3FKI I;  4RVD A;  3RZD I;  3NDI A;  3CC4 Z;  2JA8 I;  3M4O I;  1USP B;  3PO2 I;  3I4N I;  4NB9 A;  5C44 I;  1N2F A;  4NBD A;  5FLM I;  4RVH A;  1M1K 1;  1YJW 1;  2VUG A;  2M48 A;  3GTG I;  1YJW Z;  3CC7 Z;  3CCQ Z;  3VB9 A;  1NJI 2;  2E9H A;  1TFI A;  1YJ9 1;  3CCQ 1;  3HOU I;  3CCS Z;  4DGL A;  2V45 A;  4NBH A;  1Z03 A;  2V3V A;  4A93 I;  5C4X I;  2B63 I;  2E2J I;  3NH5 A;  3VMI A;  2DE7 A;  4EWC A;  1QVG Z;  1TWH I;  3S2H I;  2QRE B;  3JAM f;  3M3Y I;  1NJI 1;  1NP6 A;  1TWC I;  1Q16 A;  4MRI A;  4RVF A;  4E31 A;  2NVX I;  1KC8 2;  1QVF Z;  1ZB9 A;  1RLY A;  3LUS A;  4Y52 I;  2LIY A;  1FDO A;  2H85 A;  1USP A;  3TE5 B;  1X3W A;  1TWF I;  2ZAE B;  3CC7 1;  2DE6 A;  2JR6 A;  3KIF A;  2Q51 A;  3HOX I;  2V8I A;  4S1T A;  1YJ9 Z;  4A3F I;  1YIT 1;  4CL1 A;  2EGT A;  4E2Z A;  3H3V J;  1I6H I;  3S1M I;  3CD6 1;  2QKD A;  1VQ5 Z;  1K9M 1;  3CCU 1;  1VQ9 1;  3CCM 1;  2AYD A;  1YHQ 1;  3F3P C;  2E2H I;  3J7A 4;  2JIR A;  4AYB A;  4HH4 A;  3CCM Z;  1YIJ 1;  4NBF A;  1QF8 A;  1K83 I;  3HOY I;  2O53 A;  4A3J I;  1S7M A;  1P9N A;  1ZH1 A;  1VQ8 Z;  3IR7 A;  2YU9 I;  3G4S 1;  3CC2 1;  3K7A I;  4E2W A;  1JJ2 Y;  3HOW I;  3CCV 1;  3IFU A;  1LQL A;  2RHB A;  1RQF A;  1VQ4 Z;  5FLX b;  3EED A;  1Q7Y 1;  4RS4 A;  3GTK I;  1K73 1;  3GTP I;  1N8R 1;  3CQZ I;  4HGZ A;  2P28 A;  4A3B I;  3J80 b;  3S14 I;  2G2K A;  2V8K A;  5A2Q b;  1VQ6 1;  3CD6 Z;  2JIO A;  4NFR A;  3I07 A;  2VUM I;  2VPY A;  4A3C I;  1YHQ Z;  1VQL 1;  1W2B Z;  3PO3 I;  1JJ2 Z;  2QA4 1;  1AA6 A;  5IT9 f;  1YJN Z;  1WII A;  3D9X A;  3NDJ A;  2M6N A;  3J80 f;  1Q86 2;  2OOX B;  1W2B Y;  3PO3 S;  4A3D I;  2GU2 A;  2LFU A;  4BBR I;  1YUK A;  3IF8 A;  4E2Y A;  1X0T A;  2QR1 B;  3I4M I;  2JNY A;  3P5J B;  1Y8C A;  2GTH A;  3CCV Z;  3CMA Z;  2KI7 B;  1Q82 1;  4RV9 A;  2IV2 X;  2YAD A;  2BJO A;  1RO4 A;  1S72 Z;  3OW2 Y;  2NVY I;  2F4O A;  3VTN A;  3CCE Z;  4DQY B;  2OTJ 1;  1YI2 1;  1VQ7 Z;  3FQM A;  5D1O B;  1KD1 1;  2NVT I;  3D6W A;  2W04 A;  1VQ6 Z;  1YUA A;  3ESW A;  1VQN Z;  1VLA A;  4NBB A;  1K8A 2;  2VPW A;  1VQL Z;  1TWG I;  2NVQ I;  5T67 A;  1WW9 A;  2JA5 I;  3CPW Y;  3JAM b;  3S1Q I;  4A3K I;  3MON A;  3CXC Z;  4A3E I;  1N8R 2;  3S16 I;  3VMH A;  1VQM 1;  2V8J A;  2QEX 1;  3CPW Z;  4NBA A;  1VQM Z;  5AN9 F;  3GTM S;  1X3Z A;  4NB8 A;  2QLV B;  4A3I I;  3MZL B;  4MXU A;  3J81 b;  1Z02 A;  2PK7 A;  4XX2 A;  2R7Z I;  3CME Z;  1VQK Z;  4QTU A;  4BY7 I;  4NH1 C;  5D1P A;  1FDI A;  1KQS Y;  2W03 A;  1VQN 1;  2DE5 A;  2JA7 I;  2IZ4 A; 
#chains in the Genus database with same CATH homology
 5FLX f;  5T64 A;  3CCJ 1;  1KRL A;  2F4M A;  1Q81 1;  3S17 I;  3HOZ I;  4NBE A;  3CCJ Z;  4X6A I;  1ZB8 A;  1YIT Z;  3BG0 B;  2GTI A;  2OOY B;  1L1O C;  2WAQ A;  1VQO 1;  3G6E Z;  4E30 A;  3S1R I;  3NH4 A;  3G6E 1;  5IT9 b;  1PFT A;  4NBG A;  1KD1 2;  1K73 2;  4BBS I;  3CCL 1;  1K8A 1;  1YIJ Z;  2R6M A;  1Q81 2;  1VQ8 1;  5CM2 M;  3HKZ A;  2Y0S A;  2RBL A;  1Y1V I;  3T4N B;  1M90 1;  2JMO A;  2PM9 A;  2KPI A;  1RNI A;  3HOV I;  2OTL 1;  4E2X A;  3FQQ A;  1Q86 1;  1SFO I;  2OTL Z;  5D1O A;  3F3F C;  2J6A A;  1KQS Z;  2I3C A;  3S2D I;  3CCS 1;  3KIH A;  3GTJ I;  3CCU Z;  1VQ9 Z;  4MD7 A;  2WB1 A;  2HF1 A;  1Q82 2;  4QTT A;  5T6B A;  3CXC Y;  1QYP A;  3RZO I;  1RO2 A;  3VMG A;  3OW2 Z;  3QWU A;  5IP7 I;  1VQ5 1;  3NFZ A;  3CCL Z;  2JA6 I;  1ML8 A;  2RT9 A;  4DK1 A;  2PMZ A;  2P3Y A;  2Q4Z A;  4A3M I;  2QRC B;  2K3R A;  1R9T I;  4A3L I;  1S72 1;  1RO0 A;  2OZK A;  4Y7N I;  1Y1V S;  3J81 f;  2RIQ A;  1YI2 Z;  5C3E I;  1I3Q I;  1Z01 A;  3NH8 A;  1TWA I;  3I55 Z;  2JS4 A;  1QVF Y;  1KC8 1;  3S1N I;  5C4J I;  4MH4 A;  3I56 Z;  3U50 C;  3BG1 B;  1M90 2;  2QA4 Z;  3GTM I;  1YJN 1;  3I55 1;  1VQP Z;  4BXX I;  3I56 1;  5LL6 f;  2HU9 A;  3IX0 A;  1DL6 A;  1VQP 1;  1I50 I;  5IP9 I;  3CCR 1;  3GTO I;  1NUI A;  3GKQ A;  3GCF A;  4E33 A;  2R92 I;  3G4S Z;  3CC2 Z;  4A3G I;  1Y1W I;  4HGY A;  3CCR Z;  4BY1 I;  1JWH C;  1M1K 2;  2AKL A;  4MD9 A;  1QVG Y;  5A2Q f;  1VQ4 1;  4TNU A;  2R93 I;  3GTQ I;  2O4H A;  2RPR A;  3CC4 1;  2IZ3 A;  3EER A;  1K9M 2;  2VF1 A;  3CME 1;  1VQK 1;  2E2I I;  3Q87 A;  3TDH B;  3G71 Z;  4E32 A;  1WCM I;  4NOZ A;  1Q7Y 2;  3G71 1;  4RVG A;  3S15 I;  3H0G I;  2QEX Z;  2JUB A;  1VQO Z;  3GTL I;  2K5R A;  4MD8 A;  3CMA 1;  4NBC A;  4MON A;  3CCE 1;  3MZK B;  2OTJ Z;  2QRD B;  1VQ7 1;  3FKI I;  4RVD A;  3RZD I;  3NDI A;  3CC4 Z;  2JA8 I;  3M4O I;  1USP B;  3PO2 I;  3I4N I;  4NB9 A;  5C44 I;  1N2F A;  4NBD A;  5FLM I;  4RVH A;  1M1K 1;  1YJW 1;  2VUG A;  2M48 A;  3GTG I;  1YJW Z;  3CC7 Z;  3CCQ Z;  3VB9 A;  1NJI 2;  2E9H A;  1TFI A;  1YJ9 1;  3CCQ 1;  3HOU I;  3CCS Z;  4DGL A;  4NBH A;  1Z03 A;  4A93 I;  5C4X I;  2B63 I;  2E2J I;  3NH5 A;  3VMI A;  2DE7 A;  4EWC A;  1QVG Z;  1TWH I;  3S2H I;  2QRE B;  3JAM f;  3M3Y I;  1NJI 1;  1NP6 A;  1TWC I;  4MRI A;  4RVF A;  4E31 A;  2NVX I;  1KC8 2;  1QVF Z;  1ZB9 A;  1RLY A;  3LUS A;  4Y52 I;  2LIY A;  2H85 A;  1USP A;  3TE5 B;  1X3W A;  1TWF I;  2ZAE B;  3CC7 1;  2DE6 A;  2JR6 A;  3KIF A;  2Q51 A;  3HOX I;  2V8I A;  4S1T A;  1YJ9 Z;  4A3F I;  1YIT 1;  4CL1 A;  2EGT A;  4E2Z A;  3H3V J;  1I6H I;  3S1M I;  3CD6 1;  2QKD A;  1VQ5 Z;  1K9M 1;  3CCU 1;  1VQ9 1;  3CCM 1;  1YHQ 1;  2E2H I;  3F3P C;  3J7A 4;  4AYB A;  4HH4 A;  3CCM Z;  1YIJ 1;  4NBF A;  1QF8 A;  1K83 I;  3HOY I;  2O53 A;  4A3J I;  1S7M A;  1P9N A;  1ZH1 A;  1VQ8 Z;  2YU9 I;  3G4S 1;  3CC2 1;  3K7A I;  4E2W A;  1JJ2 Y;  3HOW I;  3CCV 1;  3IFU A;  1LQL A;  2RHB A;  1RQF A;  1VQ4 Z;  5FLX b;  3EED A;  1Q7Y 1;  4RS4 A;  3GTK I;  1K73 1;  3GTP I;  1N8R 1;  3CQZ I;  4HGZ A;  2P28 A;  4A3B I;  3J80 b;  3S14 I;  2G2K A;  2V8K A;  5A2Q b;  1VQ6 1;  3CD6 Z;  4NFR A;  3I07 A;  2VUM I;  4A3C I;  1YHQ Z;  1VQL 1;  1W2B Z;  3PO3 I;  1JJ2 Z;  2QA4 1;  5IT9 f;  1YJN Z;  1WII A;  3D9X A;  3NDJ A;  2M6N A;  3J80 f;  1Q86 2;  2OOX B;  1W2B Y;  3PO3 S;  4A3D I;  2GU2 A;  2LFU A;  4BBR I;  1YUK A;  3IF8 A;  4E2Y A;  1X0T A;  2QR1 B;  3I4M I;  2JNY A;  3P5J B;  2GTH A;  3CCV Z;  3CMA Z;  2KI7 B;  1Q82 1;  4RV9 A;  2YAD A;  2BJO A;  1RO4 A;  1S72 Z;  3OW2 Y;  2NVY I;  2F4O A;  3VTN A;  3CCE Z;  4DQY B;  2OTJ 1;  1YI2 1;  1VQ7 Z;  3FQM A;  5D1O B;  1KD1 1;  2NVT I;  3D6W A;  2W04 A;  1VQ6 Z;  1YUA A;  3ESW A;  1VQN Z;  1VLA A;  4NBB A;  1K8A 2;  1VQL Z;  1TWG I;  2NVQ I;  5T67 A;  1WW9 A;  2JA5 I;  3CPW Y;  3JAM b;  3S1Q I;  4A3K I;  3MON A;  3CXC Z;  4A3E I;  1N8R 2;  3S16 I;  3VMH A;  1VQM 1;  2V8J A;  2QEX 1;  3CPW Z;  4NBA A;  1VQM Z;  5AN9 F;  3GTM S;  1X3Z A;  4NB8 A;  2QLV B;  4A3I I;  3MZL B;  4MXU A;  3J81 b;  1Z02 A;  2PK7 A;  4XX2 A;  2R7Z I;  3CME Z;  1VQK Z;  4QTU A;  4BY7 I;  4NH1 C;  5D1P A;  1KQS Y;  2W03 A;  1VQN 1;  2DE5 A;  2JA7 I;  2IZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...