4A93I

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I02
1TWCI 3PO2I 3PO3S 3S15I 1WW9A 3GTGI 4A3II 4NBAA 2NVXI 3S14I 2E2HI 5CM2M 2NVTI 1Y1VI 3H3VJ 1N2FA 2JA8I 3S1NI 4BXXI 1I6HI 3H0GI 3HOYI 1NUIA 1ZB8A 3I4MI 3RZOI 3VMGA 3CQZI 3GTQI 3HOXI 1L1OC 4NBCA 2P3YA 1ML8A 5C3EI 1RLYA 3HOZI 3I4NI 3I07A 5C44I 4A3MI 5IP7I 4MH4A 2DE5A 2JA7I 2F4MA 1R9TI 4NOZA 1LQLA 2YU9I 3PO3I 3M4OI 3U50C 3VMHA 2NVYI 3S2DI 3RZDI 1TWFI 2JR6A 4NBDA 5FLMI 4NBHA 2JA6I 2NVQI 2R7ZI 2B63I 1RO4A 3GTMS 4NBBA 1PFTA 2R93I 4NBFA 1DL6A 4A3GI 2E2II 2E2JI 1I50I 1TFIA 2K5RA 3LUSA 4NB8A 1ZB9A 4NBGA 1TWAI 2VUMI 4A3KI 5C4JI 3S16I 3EERA 2RBLA 3HOVI 2BJOA 3Q87A 1Y1VS 2J6AA 3GCFA 1X3ZA 1K83I 1QYPA 4A3BI 4BY7I 4QTTA 2PK7A 3GTJI 4A3JI 4BBSI 3D6WA 2HF1A 4QTUA 4XX2A 4A3FI 3HOUI 4A93I 2KPIA 3GTLI 4A3LI 3S2HI 1X3WA 3GKQA 4BBRI 4A3EI 3ESWA 1VLAA 3FKII 3HOWI 3M3YI 1TWGI 2AKLA 3S17I 4NB9A 3VB9A 4NBEA 2R92I 3S1QI 3S1RI 5IP9I 4BY1I 3GTMI 1YUAA 4A3DI 4Y7NI 4X6AI 1I3QI 3VMIA 5C4XI 3GTPI 4Y52I 1SFOI 2JA5I 1TWHI 3K7AI 2DE7A 1USPA 1WCMI 1USPB 2JNYA 2F4OA 3GTKI 3S1MI 4A3CI 3GTOI 2JS4A 1Y1WI 2DE6A
chains in the Genus database with same CATH superfamily
3PO2I 3CCJ1 3S15I 3S14I 2NVTI 5AN9F 3FQQA 1FDIA 3OW2Y 4BXXI 1I6HI 2W04A 3CQZI 3HOXI 2Y0SA 1Q821 2IZ4A 3P5JB 5LL6f 4NBCA 5C3EI 1Q812 3CCUZ 4RS4A 4A3MI 3TDHB 3J80b 4MH4A 3I56Z 4NOZA 2YU9I 3M4OI 2M48A 3G4SZ 2JIQA 1YHQZ 2NVYI 1KD12 4NBDA 2EGTA 3CCEZ 2NVQI 4MXUA 2B63I 1VQ51 1K8A1 1VQ7Z 2VPYA 4NBFA 2V8IA 1YI2Z 2E2JI 2VF1A 2WB1A 4EWCA 1TFIA 2K3RA 3IF8A 3LUSA 3CD61 4NBGA 1VQ9Z 5D1OB 1Y8CA 2H85A 3NDJA 2YADA 3G6EZ 1QVFZ 3S16I 3CCSZ 3IX0A 3TE5B 1KC81 2RIQA 4HGYA 2PMZA 5D1PA 4DK1A 3BG1B 5A2Qb 3GCFA 1YJW1 4E2WA 4A3BI 2ZAEB 2GTHA 2JIPA 3CC41 1YJNZ 4QTUA 4XX2A 1YIJ1 5IT9f 1X3WA 4BBRI 1KQSY 3KIFA 1M1K2 4RVGA 3HOWI 3S17I 1YITZ 1WJ2A 1K731 1YJ91 1VQ61 4RVFA 4BY1I 2QR1B 1YUAA 5IT9b 2QEXZ 4X6AI 1I3QI 4Y52I 4E2YA 2JA5I 1QVGZ 2V45A 3K7AI 3CMAZ 3G711 2GTIA 1W2BY 4MRIA 3JAMf 3J7A4 2QRDB 1TWCI 3PO3S 3CCL1 3GTGI 4A3II 4TNUA 2NVXI 2I3CA 3BG0B 4E30A 3CCM1 1N2FA 1Q811 2E9HA 3S1NI 3JAMb 1VQ4Z 3I4MI 1JJ2Z 1YI21 1L1OC 2E7ZA 1VQ81 3J81b 2P3YA 3VTNA 1KD11 1FDOA 3I4NI 2DE5A 4E33A 2JA7I 1R9TI 1VQPZ 3PO3I 3RZDI 3NDIA 1VQNZ 4NBHA 1M902 1RO4A 1Q862 4MD8A 1WIIA 3EEDA 2V8KA 2OZKA 1I50I 2AYDA 2K5RA 1ZB9A 2P28A 3CC71 3CC2Z 1QF8A 1VQL1 4A3KI 2W03A 2V3VA 1NJI1 1YUKA 2QLVB 1VQMZ 3HOVI 3Q87A 1Y1VS 2J6AA 5T64A 3CCR1 1QYPA 2PM9A 2PK7A 1M1K1 4A3JI 4CL1A 2VUGA 4A3FI 2JIRA 3HOUI 4A93I 3FQMA 2OOYB 4A3EI 3GKQA 4E32A 2VPZA 4NBEA 2OTJ1 2QA4Z 3S1QI 2JUBA 2RPRA 4E31A 4RV9A 3I551 1RNIA 1NJI2 1Z03A 3NH5A 3IFUA 3NH4A 3GTPI 1VQO1 3D9XA 1TWHI 2DE7A 3CMEZ 1VQP1 2F4OA 3GTKI 3S1MI 2OTL1 3CXCZ 3CCQZ 4NBAA 3CCJZ 2IZ3A 5CM2M 2O53A 3H3VJ 1K9M2 2VPXA 3H0GI 1Q7Y2 1ZB8A 3IR7A 3VMGA 3GTQI 3CCVZ 2Q4ZA 3CCU1 3I561 3I07A 2O4HA 1VQKZ 2F4MA 3KIHA 3G4S1 1YHQ1 2QRCB 1M901 3U50C 1Q861 1X0TA 3VMHA 4NH1C 1JJ2Y 4HH4A 3HKZA 3CCE1 1TWFI 2NAPA 4E2ZA 2JA6I 2R7ZI 1VQ71 3GTMS 3CPWY 2JMOA 1PFTA 2HU9A 1VQ5Z 2R93I 1DL6A 2LEXA 1S72Z 4A3GI 2E2II 2LIYA 2QREB 1VQ91 3G6E1 1TWAI 3D2LA 1N8R2 2VUMI 3CCS1 2RT9A 2Q51A 3EERA 2QA41 2BJOA 1X3ZA 2JIMA 1YJWZ 1K83I 4QTTA 3GTJI 1YJN1 4BBSI 2HF1A 3CC4Z 2KPIA 3GTLI 1YIJZ 5D1OA 3MONA 3NFZA 1Q16A 3ESWA 1VLAA 1Z01A 3M3YI 1YIT1 4NB9A 3S1RI 1RO0A 3J80f 4NFRA 1KRLA 1YJ9Z 2QEX1 1VQ6Z 2RHBA 3CCV1 1SIWA 2KI7B 1QXFA 1SFOI 3CMA1 3OW2Z 1VQK1 1QVFY 2VPWA 1USPB 2JNYA 1JWHC 4RVDA 3F3PC 3MZLB 3T4NB 1ZH1A 3G71Z 2IV2X 1K9M1 4A3CI 4MD9A 1Q7Y1 1WW9A 2JIOA 2E2HI 3CCLZ 1Y1VI 2JA8I 3CCMZ 1VQ41 1RO2A 3HOYI 1NUIA 2WAQA 1S721 3RZOI 3CXCY 1VQ8Z 3MZKB 1ML8A 1RLYA 3HOZI 5C44I 5IP7I 1LQLA 1NP6A 5A2Qf 1Q822 1RQFA 3S2DI 1VQN1 4DQYB 2JR6A 1S7MA 5FLMI 4S1TA 4DGLA 1QVGY 5T6BA 4NBBA 2GU2A 2LFUA 1N8R1 2V8JA 3QWUA 3CC21 4NB8A 1K8A2 5FLXf 3CC7Z 5C4JI 1VQLZ 4HGZA 1AA6A 1VQM1 2RBLA 1KQSZ 5FLXb 4AYBA 3NH8A 4BY7I 2M6NA 2R6MA 3CCRZ 1KC82 3D6WA 2OOXB 4A3LI 3S2HI 3CD6Z 3F3FC 3FKII 1TWGI 3J81f 2AKLA 2QKDA 3VB9A 1Z02A 4MONA 2R92I 1W2BZ 5IP9I 4E2XA 3GTMI 2OTJZ 4A3DI 4Y7NI 4RVHA 3I55Z 3VMIA 2G2KA 5C4XI 1K732 1WZNA 5T67A 3CME1 1VQOZ 4MD7A 3CPWZ 1USPA 1WCMI 3GTOI 1P9NA 2OTLZ 2JS4A 1Y1WI 2DE6A 3CCQ1
chains in the Genus database with same CATH topology
3PO2I 3CCJ1 3S15I 3S14I 2NVTI 5AN9F 3FQQA 3OW2Y 4BXXI 1I6HI 2W04A 3CQZI 3HOXI 2Y0SA 1Q821 2IZ4A 3P5JB 5LL6f 4NBCA 5C3EI 1Q812 3CCUZ 4RS4A 4A3MI 3TDHB 3J80b 4MH4A 3I56Z 4NOZA 2YU9I 3M4OI 2M48A 3G4SZ 1YHQZ 2NVYI 1KD12 4NBDA 2EGTA 3CCEZ 2NVQI 4MXUA 2B63I 1VQ51 1K8A1 1VQ7Z 4NBFA 2V8IA 1YI2Z 2E2JI 2VF1A 2WB1A 4EWCA 1TFIA 2K3RA 3IF8A 3LUSA 3CD61 4NBGA 1VQ9Z 5D1OB 2H85A 3NDJA 2YADA 3G6EZ 1QVFZ 3S16I 3CCSZ 3IX0A 3TE5B 1KC81 2RIQA 4HGYA 2PMZA 5D1PA 4DK1A 3BG1B 5A2Qb 3GCFA 1YJW1 4E2WA 4A3BI 2ZAEB 2GTHA 3CC41 1YJNZ 4QTUA 4XX2A 1YIJ1 5IT9f 1X3WA 4BBRI 1KQSY 3KIFA 1M1K2 4RVGA 3HOWI 3S17I 1YITZ 1K731 1YJ91 1VQ61 4RVFA 4BY1I 2QR1B 1YUAA 5IT9b 2QEXZ 4X6AI 1I3QI 4Y52I 4E2YA 2JA5I 1QVGZ 3K7AI 3CMAZ 3G711 2GTIA 1W2BY 4MRIA 3JAMf 3J7A4 2QRDB 1TWCI 3PO3S 3CCL1 3GTGI 4A3II 4TNUA 2NVXI 2I3CA 3BG0B 4E30A 3CCM1 1N2FA 1Q811 2E9HA 3S1NI 3JAMb 1VQ4Z 3I4MI 1JJ2Z 1YI21 1L1OC 1VQ81 3J81b 2P3YA 3VTNA 1KD11 3I4NI 2DE5A 4E33A 2JA7I 1R9TI 1VQPZ 3PO3I 3RZDI 3NDIA 1VQNZ 4NBHA 1M902 1RO4A 1Q862 4MD8A 1WIIA 3EEDA 2V8KA 2OZKA 1I50I 2K5RA 1ZB9A 2P28A 3CC71 3CC2Z 1QF8A 1VQL1 4A3KI 2W03A 1NJI1 1YUKA 2QLVB 1VQMZ 3HOVI 3Q87A 1Y1VS 2J6AA 5T64A 3CCR1 1QYPA 2PM9A 2PK7A 1M1K1 4A3JI 4CL1A 2VUGA 4A3FI 3HOUI 4A93I 3FQMA 2OOYB 4A3EI 3GKQA 4E32A 4NBEA 2OTJ1 2QA4Z 3S1QI 2JUBA 2RPRA 4E31A 4RV9A 3I551 1RNIA 1NJI2 1Z03A 3NH5A 3IFUA 3NH4A 3GTPI 1VQO1 3D9XA 1TWHI 2DE7A 3CMEZ 1VQP1 2F4OA 3GTKI 3S1MI 2OTL1 3CXCZ 3CCQZ 4NBAA 3CCJZ 2IZ3A 5CM2M 2O53A 3H3VJ 1K9M2 3H0GI 1Q7Y2 1ZB8A 3VMGA 3GTQI 3CCVZ 2Q4ZA 3CCU1 3I561 3I07A 2O4HA 1VQKZ 2F4MA 3KIHA 3G4S1 1YHQ1 2QRCB 1M901 3U50C 1Q861 1X0TA 3VMHA 4NH1C 1JJ2Y 4HH4A 3HKZA 3CCE1 1TWFI 4E2ZA 2JA6I 2R7ZI 1VQ71 3GTMS 3CPWY 2JMOA 1PFTA 2HU9A 1VQ5Z 2R93I 1DL6A 1S72Z 4A3GI 2E2II 2LIYA 2QREB 1VQ91 3G6E1 1TWAI 1N8R2 2VUMI 3CCS1 2RT9A 2Q51A 3EERA 2QA41 2BJOA 1X3ZA 1YJWZ 1K83I 4QTTA 3GTJI 1YJN1 4BBSI 2HF1A 3CC4Z 2KPIA 3GTLI 1YIJZ 5D1OA 3MONA 3NFZA 3ESWA 1VLAA 1Z01A 3M3YI 1YIT1 4NB9A 3S1RI 1RO0A 3J80f 4NFRA 1KRLA 1YJ9Z 2QEX1 1VQ6Z 2RHBA 3CCV1 2KI7B 1SFOI 3CMA1 3OW2Z 1VQK1 1QVFY 1USPB 2JNYA 1JWHC 4RVDA 3F3PC 3MZLB 3T4NB 1ZH1A 3G71Z 1K9M1 4A3CI 4MD9A 1Q7Y1 1WW9A 2E2HI 3CCLZ 1Y1VI 2JA8I 3CCMZ 1VQ41 1RO2A 3HOYI 1NUIA 2WAQA 1S721 3RZOI 3CXCY 1VQ8Z 3MZKB 1ML8A 1RLYA 3HOZI 5C44I 5IP7I 1LQLA 1NP6A 5A2Qf 1Q822 1RQFA 3S2DI 1VQN1 4DQYB 2JR6A 1S7MA 5FLMI 4S1TA 4DGLA 1QVGY 5T6BA 4NBBA 2GU2A 2LFUA 1N8R1 2V8JA 3QWUA 3CC21 4NB8A 1K8A2 5FLXf 3CC7Z 5C4JI 1VQLZ 4HGZA 1VQM1 2RBLA 1KQSZ 5FLXb 4AYBA 3NH8A 4BY7I 2M6NA 2R6MA 3CCRZ 1KC82 3D6WA 2OOXB 4A3LI 3S2HI 3CD6Z 3F3FC 3FKII 1TWGI 3J81f 2AKLA 2QKDA 3VB9A 1Z02A 4MONA 2R92I 1W2BZ 5IP9I 4E2XA 3GTMI 2OTJZ 4A3DI 4Y7NI 4RVHA 3I55Z 3VMIA 2G2KA 5C4XI 1K732 5T67A 3CME1 1VQOZ 4MD7A 3CPWZ 1USPA 1WCMI 3GTOI 1P9NA 2OTLZ 2JS4A 1Y1WI 2DE6A 3CCQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC I;  3PO2 I;  3PO3 S;  3S15 I;  1WW9 A;  3GTG I;  4A3I I;  4NBA A;  2NVX I;  3S14 I;  2E2H I;  5CM2 M;  2NVT I;  1Y1V I;  3H3V J;  1N2F A;  2JA8 I;  3S1N I;  4BXX I;  1I6H I;  3H0G I;  3HOY I;  1NUI A;  1ZB8 A;  3I4M I;  3RZO I;  3VMG A;  3CQZ I;  3GTQ I;  3HOX I;  1L1O C;  4NBC A;  2P3Y A;  1ML8 A;  5C3E I;  1RLY A;  3HOZ I;  3I4N I;  3I07 A;  5C44 I;  4A3M I;  5IP7 I;  4MH4 A;  2DE5 A;  2JA7 I;  2F4M A;  1R9T I;  4NOZ A;  1LQL A;  2YU9 I;  3PO3 I;  3M4O I;  3U50 C;  3VMH A;  2NVY I;  3S2D I;  3RZD I;  1TWF I;  2JR6 A;  4NBD A;  5FLM I;  4NBH A;  2JA6 I;  2NVQ I;  2R7Z I;  2B63 I;  1RO4 A;  3GTM S;  4NBB A;  1PFT A;  2R93 I;  4NBF A;  1DL6 A;  4A3G I;  2E2I I;  2E2J I;  1I50 I;  1TFI A;  2K5R A;  3LUS A;  4NB8 A;  1ZB9 A;  4NBG A;  1TWA I;  2VUM I;  4A3K I;  5C4J I;  3S16 I;  3EER A;  2RBL A;  3HOV I;  2BJO A;  3Q87 A;  1Y1V S;  2J6A A;  3GCF A;  1X3Z A;  1K83 I;  1QYP A;  4A3B I;  4BY7 I;  4QTT A;  2PK7 A;  3GTJ I;  4A3J I;  4BBS I;  3D6W A;  2HF1 A;  4QTU A;  4XX2 A;  4A3F I;  3HOU I;  4A93 I;  2KPI A;  3GTL I;  4A3L I;  3S2H I;  1X3W A;  3GKQ A;  4BBR I;  4A3E I;  3ESW A;  1VLA A;  3FKI I;  3HOW I;  3M3Y I;  1TWG I;  2AKL A;  3S17 I;  4NB9 A;  3VB9 A;  4NBE A;  2R92 I;  3S1Q I;  3S1R I;  5IP9 I;  4BY1 I;  3GTM I;  1YUA A;  4A3D I;  4Y7N I;  4X6A I;  1I3Q I;  3VMI A;  5C4X I;  3GTP I;  4Y52 I;  1SFO I;  2JA5 I;  1TWH I;  3K7A I;  2DE7 A;  1USP A;  1WCM I;  1USP B;  2JNY A;  2F4O A;  3GTK I;  3S1M I;  4A3C I;  3GTO I;  2JS4 A;  1Y1W I;  2DE6 A; 
#chains in the Genus database with same CATH topology
 3PO2 I;  3CCJ 1;  3S15 I;  3S14 I;  2NVT I;  5AN9 F;  3FQQ A;  1FDI A;  3OW2 Y;  4BXX I;  1I6H I;  2W04 A;  3CQZ I;  3HOX I;  2Y0S A;  1Q82 1;  2IZ4 A;  3P5J B;  5LL6 f;  4NBC A;  5C3E I;  1Q81 2;  3CCU Z;  4RS4 A;  4A3M I;  3TDH B;  3J80 b;  4MH4 A;  3I56 Z;  4NOZ A;  2YU9 I;  3M4O I;  2M48 A;  3G4S Z;  2JIQ A;  1YHQ Z;  2NVY I;  1KD1 2;  4NBD A;  2EGT A;  3CCE Z;  2NVQ I;  4MXU A;  2B63 I;  1VQ5 1;  1K8A 1;  1VQ7 Z;  2VPY A;  4NBF A;  2V8I A;  1YI2 Z;  2E2J I;  2VF1 A;  2WB1 A;  4EWC A;  1TFI A;  2K3R A;  3IF8 A;  3LUS A;  3CD6 1;  4NBG A;  1VQ9 Z;  5D1O B;  1Y8C A;  2H85 A;  3NDJ A;  2YAD A;  3G6E Z;  1QVF Z;  3S16 I;  3CCS Z;  3IX0 A;  3TE5 B;  1KC8 1;  2RIQ A;  4HGY A;  2PMZ A;  5D1P A;  4DK1 A;  3BG1 B;  5A2Q b;  3GCF A;  1YJW 1;  4E2W A;  4A3B I;  2ZAE B;  2GTH A;  2JIP A;  3CC4 1;  1YJN Z;  4QTU A;  4XX2 A;  1YIJ 1;  5IT9 f;  1X3W A;  4BBR I;  1KQS Y;  3KIF A;  1M1K 2;  4RVG A;  3HOW I;  3S17 I;  1YIT Z;  1WJ2 A;  1K73 1;  1YJ9 1;  1VQ6 1;  4RVF A;  4BY1 I;  2QR1 B;  1YUA A;  5IT9 b;  2QEX Z;  4X6A I;  1I3Q I;  4Y52 I;  4E2Y A;  2JA5 I;  1QVG Z;  2V45 A;  3K7A I;  3CMA Z;  3G71 1;  2GTI A;  1W2B Y;  4MRI A;  3JAM f;  3J7A 4;  2QRD B;  1TWC I;  3PO3 S;  3CCL 1;  3GTG I;  4A3I I;  4TNU A;  2NVX I;  2I3C A;  3BG0 B;  4E30 A;  3CCM 1;  1N2F A;  1Q81 1;  2E9H A;  3S1N I;  3JAM b;  1VQ4 Z;  3I4M I;  1JJ2 Z;  1YI2 1;  1L1O C;  2E7Z A;  1VQ8 1;  3J81 b;  2P3Y A;  3VTN A;  1KD1 1;  1FDO A;  3I4N I;  2DE5 A;  4E33 A;  2JA7 I;  1R9T I;  1VQP Z;  3PO3 I;  3RZD I;  3NDI A;  1VQN Z;  4NBH A;  1M90 2;  1RO4 A;  1Q86 2;  4MD8 A;  1WII A;  3EED A;  2V8K A;  2OZK A;  1I50 I;  2AYD A;  2K5R A;  1ZB9 A;  2P28 A;  3CC7 1;  3CC2 Z;  1QF8 A;  1VQL 1;  4A3K I;  2W03 A;  2V3V A;  1NJI 1;  1YUK A;  2QLV B;  1VQM Z;  3HOV I;  3Q87 A;  1Y1V S;  2J6A A;  5T64 A;  3CCR 1;  1QYP A;  2PM9 A;  2PK7 A;  1M1K 1;  4A3J I;  4CL1 A;  2VUG A;  4A3F I;  2JIR A;  3HOU I;  4A93 I;  3FQM A;  2OOY B;  4A3E I;  3GKQ A;  4E32 A;  2VPZ A;  4NBE A;  2OTJ 1;  2QA4 Z;  3S1Q I;  2JUB A;  2RPR A;  4E31 A;  4RV9 A;  3I55 1;  1RNI A;  1NJI 2;  1Z03 A;  3NH5 A;  3IFU A;  3NH4 A;  3GTP I;  1VQO 1;  3D9X A;  1TWH I;  2DE7 A;  3CME Z;  1VQP 1;  2F4O A;  3GTK I;  3S1M I;  2OTL 1;  3CXC Z;  3CCQ Z;  4NBA A;  3CCJ Z;  2IZ3 A;  5CM2 M;  2O53 A;  3H3V J;  1K9M 2;  2VPX A;  3H0G I;  1Q7Y 2;  1ZB8 A;  3IR7 A;  3VMG A;  3GTQ I;  3CCV Z;  2Q4Z A;  3CCU 1;  3I56 1;  3I07 A;  2O4H A;  1VQK Z;  2F4M A;  3KIH A;  3G4S 1;  1YHQ 1;  2QRC B;  1M90 1;  3U50 C;  1Q86 1;  1X0T A;  3VMH A;  4NH1 C;  1JJ2 Y;  4HH4 A;  3HKZ A;  3CCE 1;  1TWF I;  2NAP A;  4E2Z A;  2JA6 I;  2R7Z I;  1VQ7 1;  3GTM S;  3CPW Y;  2JMO A;  1PFT A;  2HU9 A;  1VQ5 Z;  2R93 I;  1DL6 A;  2LEX A;  1S72 Z;  4A3G I;  2E2I I;  2LIY A;  2QRE B;  1VQ9 1;  3G6E 1;  1TWA I;  3D2L A;  1N8R 2;  2VUM I;  3CCS 1;  2RT9 A;  2Q51 A;  3EER A;  2QA4 1;  2BJO A;  1X3Z A;  2JIM A;  1YJW Z;  1K83 I;  4QTT A;  3GTJ I;  1YJN 1;  4BBS I;  2HF1 A;  3CC4 Z;  2KPI A;  3GTL I;  1YIJ Z;  5D1O A;  3MON A;  3NFZ A;  1Q16 A;  3ESW A;  1VLA A;  1Z01 A;  3M3Y I;  1YIT 1;  4NB9 A;  3S1R I;  1RO0 A;  3J80 f;  4NFR A;  1KRL A;  1YJ9 Z;  2QEX 1;  1VQ6 Z;  2RHB A;  3CCV 1;  1SIW A;  2KI7 B;  1QXF A;  1SFO I;  3CMA 1;  3OW2 Z;  1VQK 1;  1QVF Y;  2VPW A;  1USP B;  2JNY A;  1JWH C;  4RVD A;  3F3P C;  3MZL B;  3T4N B;  1ZH1 A;  3G71 Z;  2IV2 X;  1K9M 1;  4A3C I;  4MD9 A;  1Q7Y 1;  1WW9 A;  2JIO A;  2E2H I;  3CCL Z;  1Y1V I;  2JA8 I;  3CCM Z;  1VQ4 1;  1RO2 A;  3HOY I;  1NUI A;  2WAQ A;  1S72 1;  3RZO I;  3CXC Y;  1VQ8 Z;  3MZK B;  1ML8 A;  1RLY A;  3HOZ I;  5C44 I;  5IP7 I;  1LQL A;  1NP6 A;  5A2Q f;  1Q82 2;  1RQF A;  3S2D I;  1VQN 1;  4DQY B;  2JR6 A;  1S7M A;  5FLM I;  4S1T A;  4DGL A;  1QVG Y;  5T6B A;  4NBB A;  2GU2 A;  2LFU A;  1N8R 1;  2V8J A;  3QWU A;  3CC2 1;  4NB8 A;  1K8A 2;  5FLX f;  3CC7 Z;  5C4J I;  1VQL Z;  4HGZ A;  1AA6 A;  1VQM 1;  2RBL A;  1KQS Z;  5FLX b;  4AYB A;  3NH8 A;  4BY7 I;  2M6N A;  2R6M A;  3CCR Z;  1KC8 2;  3D6W A;  2OOX B;  4A3L I;  3S2H I;  3CD6 Z;  3F3F C;  3FKI I;  1TWG I;  3J81 f;  2AKL A;  2QKD A;  3VB9 A;  1Z02 A;  4MON A;  2R92 I;  1W2B Z;  5IP9 I;  4E2X A;  3GTM I;  2OTJ Z;  4A3D I;  4Y7N I;  4RVH A;  3I55 Z;  3VMI A;  2G2K A;  5C4X I;  1K73 2;  1WZN A;  5T67 A;  3CME 1;  1VQO Z;  4MD7 A;  3CPW Z;  1USP A;  1WCM I;  3GTO I;  1P9N A;  2OTL Z;  2JS4 A;  1Y1W I;  2DE6 A;  3CCQ 1; 
#chains in the Genus database with same CATH homology
 3PO2 I;  3CCJ 1;  3S15 I;  3S14 I;  2NVT I;  5AN9 F;  3FQQ A;  3OW2 Y;  4BXX I;  1I6H I;  2W04 A;  3CQZ I;  3HOX I;  2Y0S A;  1Q82 1;  2IZ4 A;  3P5J B;  5LL6 f;  4NBC A;  5C3E I;  1Q81 2;  3CCU Z;  4RS4 A;  4A3M I;  3TDH B;  3J80 b;  4MH4 A;  3I56 Z;  4NOZ A;  2YU9 I;  3M4O I;  2M48 A;  3G4S Z;  1YHQ Z;  2NVY I;  1KD1 2;  4NBD A;  2EGT A;  3CCE Z;  2NVQ I;  4MXU A;  2B63 I;  1VQ5 1;  1K8A 1;  1VQ7 Z;  4NBF A;  2V8I A;  1YI2 Z;  2E2J I;  2VF1 A;  2WB1 A;  4EWC A;  1TFI A;  2K3R A;  3IF8 A;  3LUS A;  3CD6 1;  4NBG A;  1VQ9 Z;  5D1O B;  2H85 A;  3NDJ A;  2YAD A;  3G6E Z;  1QVF Z;  3S16 I;  3CCS Z;  3IX0 A;  3TE5 B;  1KC8 1;  2RIQ A;  4HGY A;  2PMZ A;  5D1P A;  4DK1 A;  3BG1 B;  5A2Q b;  3GCF A;  1YJW 1;  4E2W A;  4A3B I;  2ZAE B;  2GTH A;  3CC4 1;  1YJN Z;  4QTU A;  4XX2 A;  1YIJ 1;  5IT9 f;  1X3W A;  4BBR I;  1KQS Y;  3KIF A;  1M1K 2;  4RVG A;  3HOW I;  3S17 I;  1YIT Z;  1K73 1;  1YJ9 1;  1VQ6 1;  4RVF A;  4BY1 I;  2QR1 B;  1YUA A;  5IT9 b;  2QEX Z;  4X6A I;  1I3Q I;  4Y52 I;  4E2Y A;  2JA5 I;  1QVG Z;  3K7A I;  3CMA Z;  3G71 1;  2GTI A;  1W2B Y;  4MRI A;  3JAM f;  3J7A 4;  2QRD B;  1TWC I;  3PO3 S;  3CCL 1;  3GTG I;  4A3I I;  4TNU A;  2NVX I;  2I3C A;  3BG0 B;  4E30 A;  3CCM 1;  1N2F A;  1Q81 1;  2E9H A;  3S1N I;  3JAM b;  1VQ4 Z;  3I4M I;  1JJ2 Z;  1YI2 1;  1L1O C;  1VQ8 1;  3J81 b;  2P3Y A;  3VTN A;  1KD1 1;  3I4N I;  2DE5 A;  4E33 A;  2JA7 I;  1R9T I;  1VQP Z;  3PO3 I;  3RZD I;  3NDI A;  1VQN Z;  4NBH A;  1M90 2;  1RO4 A;  1Q86 2;  4MD8 A;  1WII A;  3EED A;  2V8K A;  2OZK A;  1I50 I;  2K5R A;  1ZB9 A;  2P28 A;  3CC7 1;  3CC2 Z;  1QF8 A;  1VQL 1;  4A3K I;  2W03 A;  1NJI 1;  1YUK A;  2QLV B;  1VQM Z;  3HOV I;  3Q87 A;  1Y1V S;  2J6A A;  5T64 A;  3CCR 1;  1QYP A;  2PM9 A;  2PK7 A;  1M1K 1;  4A3J I;  4CL1 A;  2VUG A;  4A3F I;  3HOU I;  4A93 I;  3FQM A;  2OOY B;  4A3E I;  3GKQ A;  4E32 A;  4NBE A;  2OTJ 1;  2QA4 Z;  3S1Q I;  2JUB A;  2RPR A;  4E31 A;  4RV9 A;  3I55 1;  1RNI A;  1NJI 2;  1Z03 A;  3NH5 A;  3IFU A;  3NH4 A;  3GTP I;  1VQO 1;  3D9X A;  1TWH I;  2DE7 A;  3CME Z;  1VQP 1;  2F4O A;  3GTK I;  3S1M I;  2OTL 1;  3CXC Z;  3CCQ Z;  4NBA A;  3CCJ Z;  2IZ3 A;  5CM2 M;  2O53 A;  3H3V J;  1K9M 2;  3H0G I;  1Q7Y 2;  1ZB8 A;  3VMG A;  3GTQ I;  3CCV Z;  2Q4Z A;  3CCU 1;  3I56 1;  3I07 A;  2O4H A;  1VQK Z;  2F4M A;  3KIH A;  3G4S 1;  1YHQ 1;  2QRC B;  1M90 1;  3U50 C;  1Q86 1;  1X0T A;  3VMH A;  4NH1 C;  1JJ2 Y;  4HH4 A;  3HKZ A;  3CCE 1;  1TWF I;  4E2Z A;  2JA6 I;  2R7Z I;  1VQ7 1;  3GTM S;  3CPW Y;  2JMO A;  1PFT A;  2HU9 A;  1VQ5 Z;  2R93 I;  1DL6 A;  1S72 Z;  4A3G I;  2E2I I;  2LIY A;  2QRE B;  1VQ9 1;  3G6E 1;  1TWA I;  1N8R 2;  2VUM I;  3CCS 1;  2RT9 A;  2Q51 A;  3EER A;  2QA4 1;  2BJO A;  1X3Z A;  1YJW Z;  1K83 I;  4QTT A;  3GTJ I;  1YJN 1;  4BBS I;  2HF1 A;  3CC4 Z;  2KPI A;  3GTL I;  1YIJ Z;  5D1O A;  3MON A;  3NFZ A;  3ESW A;  1VLA A;  1Z01 A;  3M3Y I;  1YIT 1;  4NB9 A;  3S1R I;  1RO0 A;  3J80 f;  4NFR A;  1KRL A;  1YJ9 Z;  2QEX 1;  1VQ6 Z;  2RHB A;  3CCV 1;  2KI7 B;  1SFO I;  3CMA 1;  3OW2 Z;  1VQK 1;  1QVF Y;  1USP B;  2JNY A;  1JWH C;  4RVD A;  3F3P C;  3MZL B;  3T4N B;  1ZH1 A;  3G71 Z;  1K9M 1;  4A3C I;  4MD9 A;  1Q7Y 1;  1WW9 A;  2E2H I;  3CCL Z;  1Y1V I;  2JA8 I;  3CCM Z;  1VQ4 1;  1RO2 A;  3HOY I;  1NUI A;  2WAQ A;  1S72 1;  3RZO I;  3CXC Y;  1VQ8 Z;  3MZK B;  1ML8 A;  1RLY A;  3HOZ I;  5C44 I;  5IP7 I;  1LQL A;  1NP6 A;  5A2Q f;  1Q82 2;  1RQF A;  3S2D I;  1VQN 1;  4DQY B;  2JR6 A;  1S7M A;  5FLM I;  4S1T A;  4DGL A;  1QVG Y;  5T6B A;  4NBB A;  2GU2 A;  2LFU A;  1N8R 1;  2V8J A;  3QWU A;  3CC2 1;  4NB8 A;  1K8A 2;  5FLX f;  3CC7 Z;  5C4J I;  1VQL Z;  4HGZ A;  1VQM 1;  2RBL A;  1KQS Z;  5FLX b;  4AYB A;  3NH8 A;  4BY7 I;  2M6N A;  2R6M A;  3CCR Z;  1KC8 2;  3D6W A;  2OOX B;  4A3L I;  3S2H I;  3CD6 Z;  3F3F C;  3FKI I;  1TWG I;  3J81 f;  2AKL A;  2QKD A;  3VB9 A;  1Z02 A;  4MON A;  2R92 I;  1W2B Z;  5IP9 I;  4E2X A;  3GTM I;  2OTJ Z;  4A3D I;  4Y7N I;  4RVH A;  3I55 Z;  3VMI A;  2G2K A;  5C4X I;  1K73 2;  5T67 A;  3CME 1;  1VQO Z;  4MD7 A;  3CPW Z;  1USP A;  1WCM I;  3GTO I;  1P9N A;  2OTL Z;  2JS4 A;  1Y1W I;  2DE6 A;  3CCQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...