4A93I

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I02
1RLYA 4QTTA 3GKQA 2YU9I 3RZOI 3M4OI 4A93I 4NBFA 4A3BI 4A3FI 1YUAA 2JR6A 3K7AI 4NBHA 1TWCI 2DE6A 1X3ZA 2JA8I 3U50C 2NVYI 4Y7NI 1USPA 2F4MA 1X3WA 3S2HI 1NUIA 5FLMI 4MH4A 2E2JI 3S2DI 3S1RI 2KPIA 1Y1VI 1N2FA 4NOZA 4NB8A 3GTPI 3HOZI 1ZB9A 3PO3I 3S1QI 2NVTI 2NVXI 3S17I 1WW9A 1DL6A 1K83I 2F4OA 2JS4A 1RO4A 1TWGI 2HF1A 3HOWI 4A3LI 4BXXI 3VB9A 3VMGA 3S15I 4X6AI 4BY1I 1SFOI 2R7ZI 3GTMI 3GTKI 5IP9I 2DE7A 2PK7A 4A3EI 1Y1VS 4A3GI 4A3CI 2JA6I 3S14I 1I50I 3GTQI 3PO3S 3ESWA 2VUMI 2JNYA 4A3MI 5IP7I 1Y1WI 1I6HI 4NBGA 4QTUA 3HOUI 1LQLA 4NBAA 1VLAA 2E2HI 3S1NI 1I3QI 1L1OC 4BBRI 2BJOA 1TWAI 2NVQI 3S16I 4NBDA 3HOVI 3GTMS 3H0GI 3GTLI 2J6AA 4A3JI 3I4NI 3PO2I 1TWHI 4NBEA 2RBLA 3FKII 2JA7I 3GTOI 3RZDI 4NBBA 1QYPA 3D6WA 1ZB8A 1TFIA 3I4MI 2AKLA 5C3EI 3HOXI 2R92I 1ML8A 4XX2A 5C44I 4BY7I 3GCFA 3LUSA 3Q87A 3H3VJ 1PFTA 4BBSI 2P3YA 3I07A 4NB9A 3EERA 5C4JI 3GTJI 5CM2M 3VMHA 3M3YI 1TWFI 3VMIA 3GTGI 1WCMI 5C4XI 2B63I 1R9TI 4NBCA 1USPB 4A3KI 3S1MI 3HOYI 2R93I 4Y52I 2DE5A 4A3DI 4A3II 3CQZI 2K5RA 2JA5I 2E2II
chains in the Genus database with same CATH superfamily
4QTTA 4DQYB 2YU9I 3RZOI 1VQP1 4A93I 3CXCZ 1YJWZ 1N8R2 2NVYI 4Y7NI 1WJ2A 4RVDA 1FDIA 3S2DI 1VQNZ 4NB8A 3GTPI 3BG0B 1VQ61 3J81b 4MD9A 1WW9A 2LFUA 2JIQA 2F4OA 1K731 4A3LI 2VF1A 2VPYA 4BXXI 1S72Z 3S15I 4X6AI 2QA4Z 2R7ZI 1VQ9Z 3GTKI 5A2Qf 3I551 1P9NA 2KI7B 1Q7Y1 5FLXb 1I50I 1YJN1 3ESWA 3KIFA 2VUMI 4A3MI 4E32A 1YIT1 2GTHA 4NBAA 1VLAA 3CCVZ 3JAMb 3G6E1 5D1OB 1Z01A 3CPWZ 2BJOA 3S16I 3QWUA 1S721 1RO0A 2QA41 1Q811 1VQ91 3CD6Z 3J81f 5T67A 3MONA 1TWHI 2WAQA 4NBEA 1VQ71 3CCQ1 3D6WA 1TFIA 3I4MI 2JIOA 2QLVB 1Q822 2AKLA 1JWHC 3CCSZ 5C44I 3GCFA 3Q87A 3OW2Z 3J7A4 3CCV1 4BBSI 2P3YA 3CCU1 5FLXf 3GTJI 1YJ91 3VMHA 3EEDA 1VQK1 2WB1A 3CD61 3F3PC 1K8A2 3HOYI 3JAMf 3CCMZ 1M1K1 5T64A 2K5RA 3CC21 2JA5I 3CCS1 1RLYA 1YIJZ 2W03A 2OTL1 1VQ41 3M4OI 4NBFA 1VQPZ 2OZKA 1YUAA 2G2KA 1Q862 1TWCI 1NJI2 1YHQZ 3IF8A 2IV2X 4DK1A 1USPA 2JMOA 1X3WA 2E2JI 2LIYA 3J80b 3CCR1 2KPIA 1Y1VI 1N2FA 1X0TA 2PM9A 2RHBA 4CL1A 1NP6A 2NVXI 2RPRA 2O4HA 1YIJ1 1K83I 1JJ2Y 2JS4A 4HH4A 2HF1A 1W2BZ 2AYDA 3HOWI 1YHQ1 3VMGA 2ZAEB 1S7MA 3G711 4HGYA 2PK7A 2V8JA 1M901 3I55Z 1Y1VS 3NDIA 4A3GI 3G4SZ 3S14I 1YI21 3CCE1 1YJNZ 2JNYA 1YITZ 1I6HI 2M48A 5D1PA 2E2HI 3S1NI 1FDOA 3G6EZ 1L1OC 3J80f 1K9M1 1KD12 4NBDA 1QXFA 3H0GI 3I4NI 1QVGZ 3PO2I 3G4S1 2RBLA 3GTOI 1VQ7Z 3CCQZ 3IR7A 2M6NA 1QVFY 2IZ4A 5C3EI 1ML8A 2K3RA 5AN9F 1KRLA 3LUSA 3CXCY 3NDJA 2W04A 4NB9A 4RVFA 5C4JI 1VQMZ 1VQOZ 3CCUZ 3CC4Z 5CM2M 1YJ9Z 2EGTA 2QEX1 1N8R1 1VQKZ 2OTJ1 3VMIA 4RS4A 2B63I 3T4NB 4A3DI 4A3II 3I56Z 3F3FC 4NBGA 2R6MA 3CC2Z 2O53A 3GKQA 2Y0SA 2NAPA 1AA6A 2OTLZ 1VQ4Z 2Q4ZA 4A3FI 3VTNA 3CC71 2DE6A 2E9HA 1Y8CA 3U50C 1VQM1 1VQO1 3CC41 2VPXA 3NH4A 2QRCB 3NH8A 3CCRZ 2IZ3A 4RV9A 1VQ8Z 2GU2A 1KC81 3HOZI 1ZB9A 4NFRA 1KQSZ 2H85A 1SIWA 3PO3I 4MONA 3I561 2NVTI 4MRIA 1Z02A 1DL6A 2QRDB 1JJ2Z 3HKZA 3CPWY 5IT9b 1ZH1A 2JUBA 4NH1C 3MZLB 3G71Z 4E30A 1SFOI 4MD7A 3GTMI 5IP9I 2DE7A 3FQMA 4A3CI 2JA6I 4DGLA 1YI2Z 1VQ81 3GTQI 3PO3S 3CCEZ 5IP7I 2QREB 2RIQA 4QTUA 1Q821 3OW2Y 1K732 3CMA1 1I3QI 2RT9A 1WZNA 1TWAI 2NVQI 2OOXB 3GTMS 1Q7Y2 4A3JI 3GTLI 3NFZA 4E33A 1WIIA 3FKII 4MXUA 2JA7I 3RZDI 4NBBA 2JIRA 4S1TA 5IT9f 4E2XA 3HOXI 2QKDA 3TE5B 3H3VJ 4RVHA 2PMZA 3I07A 1VQ5Z 3EERA 3CME1 1VQLZ 1Q861 1NJI1 1Q812 2GTIA 4E2YA 2QEXZ 1TWFI 2QR1B 2I3CA 2OTJZ 1WCMI 1R9TI 4NBCA 1USPB 4A3KI 3S1MI 1Z03A 2R93I 3TDHB 2DE5A 2E7ZA 3IFUA 2E2II 1W2BY 4A3BI 4HGZA 2JR6A 3K7AI 4NBHA 1X3ZA 3CC7Z 1VQ51 1YJW1 2JA8I 1VQL1 4AYBA 4E31A 2F4MA 3S2HI 1NUIA 2LEXA 5FLMI 4MH4A 1KC82 1VQN1 3S1RI 2V8IA 4NOZA 1M1K2 5LL6f 3IX0A 3S1QI 3S17I 1RO4A 1TWGI 3VB9A 3CCJZ 4BY1I 2JIPA 4TNUA 1KD11 1Q16A 2JIMA 1QVGY 4E2ZA 4A3EI 3P5JB 1Y1WI 3D2LA 3HOUI 1LQLA 3CCLZ 3CMAZ 4BBRI 1YUKA 3CCJ1 2V8KA 4MD8A 3HOVI 4E2WA 5T6BA 1M902 3D9XA 2VPZA 2HU9A 2J6AA 2P28A 3MZKB 4EWCA 1QYPA 1ZB8A 1RQFA 3NH5A 2R92I 4XX2A 4BY7I 1PFTA 3CCL1 1QF8A 3KIHA 1K9M2 2Q51A 3CMEZ 2YADA 4RVGA 3FQQA 3M3YI 3BG1B 3GTGI 5C4XI 2VPWA 2V45A 1RO2A 2OOYB 1KQSY 2V3VA 3CCM1 4Y52I 1VQ6Z 1K8A1 1RNIA 2VUGA 3CQZI 5A2Qb 1QVFZ 5D1OA
chains in the Genus database with same CATH topology
4QTTA 4DQYB 2YU9I 3RZOI 1VQP1 4A93I 3CXCZ 1YJWZ 1N8R2 2NVYI 4Y7NI 4RVDA 3S2DI 1VQNZ 4NB8A 3GTPI 3BG0B 1VQ61 3J81b 4MD9A 1WW9A 2LFUA 2F4OA 1K731 4A3LI 2VF1A 4BXXI 1S72Z 3S15I 4X6AI 2QA4Z 2R7ZI 1VQ9Z 3GTKI 5A2Qf 3I551 1P9NA 2KI7B 1Q7Y1 5FLXb 1I50I 1YJN1 3ESWA 3KIFA 2VUMI 4A3MI 4E32A 1YIT1 2GTHA 4NBAA 1VLAA 3CCVZ 3JAMb 3G6E1 5D1OB 1Z01A 3CPWZ 2BJOA 3S16I 3QWUA 1S721 1RO0A 2QA41 1Q811 1VQ91 3CD6Z 3J81f 5T67A 3MONA 1TWHI 2WAQA 4NBEA 1VQ71 3CCQ1 3D6WA 1TFIA 3I4MI 2QLVB 1Q822 2AKLA 1JWHC 3CCSZ 5C44I 3GCFA 3Q87A 3OW2Z 3J7A4 3CCV1 4BBSI 2P3YA 3CCU1 5FLXf 3GTJI 1YJ91 3VMHA 3EEDA 1VQK1 2WB1A 3CD61 3F3PC 1K8A2 3HOYI 3JAMf 3CCMZ 1M1K1 5T64A 2K5RA 3CC21 2JA5I 3CCS1 1RLYA 1YIJZ 2W03A 2OTL1 1VQ41 3M4OI 4NBFA 1VQPZ 2OZKA 1YUAA 2G2KA 1Q862 1TWCI 1NJI2 1YHQZ 3IF8A 4DK1A 1USPA 2JMOA 1X3WA 2E2JI 2LIYA 3J80b 3CCR1 2KPIA 1Y1VI 1N2FA 1X0TA 2PM9A 2RHBA 4CL1A 1NP6A 2NVXI 2RPRA 2O4HA 1YIJ1 1K83I 1JJ2Y 2JS4A 4HH4A 2HF1A 1W2BZ 3HOWI 1YHQ1 3VMGA 2ZAEB 1S7MA 3G711 4HGYA 2PK7A 2V8JA 1M901 3I55Z 1Y1VS 3NDIA 4A3GI 3G4SZ 3S14I 1YI21 3CCE1 1YJNZ 2JNYA 1YITZ 1I6HI 2M48A 5D1PA 2E2HI 3S1NI 3G6EZ 1L1OC 3J80f 1K9M1 1KD12 4NBDA 3H0GI 3I4NI 1QVGZ 3PO2I 3G4S1 2RBLA 3GTOI 1VQ7Z 3CCQZ 2M6NA 1QVFY 2IZ4A 5C3EI 1ML8A 2K3RA 5AN9F 1KRLA 3LUSA 3CXCY 3NDJA 2W04A 4NB9A 4RVFA 5C4JI 1VQMZ 1VQOZ 3CCUZ 3CC4Z 5CM2M 1YJ9Z 2EGTA 2QEX1 1N8R1 1VQKZ 2OTJ1 3VMIA 4RS4A 2B63I 3T4NB 4A3DI 4A3II 3I56Z 3F3FC 4NBGA 2R6MA 3CC2Z 2O53A 3GKQA 2Y0SA 2OTLZ 1VQ4Z 2Q4ZA 4A3FI 3VTNA 3CC71 2DE6A 2E9HA 3U50C 1VQM1 1VQO1 3CC41 3NH4A 2QRCB 3NH8A 3CCRZ 2IZ3A 4RV9A 1VQ8Z 2GU2A 1KC81 3HOZI 1ZB9A 4NFRA 1KQSZ 2H85A 3PO3I 4MONA 3I561 2NVTI 4MRIA 1Z02A 1DL6A 2QRDB 1JJ2Z 3HKZA 3CPWY 5IT9b 1ZH1A 2JUBA 4NH1C 3MZLB 3G71Z 4E30A 1SFOI 4MD7A 3GTMI 5IP9I 2DE7A 3FQMA 4A3CI 2JA6I 4DGLA 1YI2Z 1VQ81 3GTQI 3PO3S 3CCEZ 5IP7I 2QREB 2RIQA 4QTUA 1Q821 3OW2Y 1K732 3CMA1 1I3QI 2RT9A 1TWAI 2NVQI 2OOXB 3GTMS 1Q7Y2 4A3JI 3GTLI 3NFZA 4E33A 1WIIA 3FKII 4MXUA 2JA7I 3RZDI 4NBBA 4S1TA 5IT9f 4E2XA 3HOXI 2QKDA 3TE5B 3H3VJ 4RVHA 2PMZA 3I07A 1VQ5Z 3EERA 3CME1 1VQLZ 1Q861 1NJI1 1Q812 2GTIA 4E2YA 2QEXZ 1TWFI 2QR1B 2I3CA 2OTJZ 1WCMI 1R9TI 4NBCA 1USPB 4A3KI 3S1MI 1Z03A 2R93I 3TDHB 2DE5A 3IFUA 2E2II 1W2BY 4A3BI 4HGZA 2JR6A 3K7AI 4NBHA 1X3ZA 3CC7Z 1VQ51 1YJW1 2JA8I 1VQL1 4AYBA 4E31A 2F4MA 3S2HI 1NUIA 5FLMI 4MH4A 1KC82 1VQN1 3S1RI 2V8IA 4NOZA 1M1K2 5LL6f 3IX0A 3S1QI 3S17I 1RO4A 1TWGI 3VB9A 3CCJZ 4BY1I 4TNUA 1KD11 1QVGY 4E2ZA 4A3EI 3P5JB 1Y1WI 3HOUI 1LQLA 3CCLZ 3CMAZ 4BBRI 1YUKA 3CCJ1 2V8KA 4MD8A 3HOVI 4E2WA 5T6BA 1M902 3D9XA 2HU9A 2J6AA 2P28A 3MZKB 4EWCA 1QYPA 1ZB8A 1RQFA 3NH5A 2R92I 4XX2A 4BY7I 1PFTA 3CCL1 1QF8A 3KIHA 1K9M2 2Q51A 3CMEZ 2YADA 4RVGA 3FQQA 3M3YI 3BG1B 3GTGI 5C4XI 1RO2A 2OOYB 1KQSY 3CCM1 4Y52I 1VQ6Z 1K8A1 1RNIA 2VUGA 3CQZI 5A2Qb 1QVFZ 5D1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLY A;  4QTT A;  3GKQ A;  2YU9 I;  3RZO I;  3M4O I;  4A93 I;  4NBF A;  4A3B I;  4A3F I;  1YUA A;  2JR6 A;  3K7A I;  4NBH A;  1TWC I;  2DE6 A;  1X3Z A;  2JA8 I;  3U50 C;  2NVY I;  4Y7N I;  1USP A;  2F4M A;  1X3W A;  3S2H I;  1NUI A;  5FLM I;  4MH4 A;  2E2J I;  3S2D I;  3S1R I;  2KPI A;  1Y1V I;  1N2F A;  4NOZ A;  4NB8 A;  3GTP I;  3HOZ I;  1ZB9 A;  3PO3 I;  3S1Q I;  2NVT I;  2NVX I;  3S17 I;  1WW9 A;  1DL6 A;  1K83 I;  2F4O A;  2JS4 A;  1RO4 A;  1TWG I;  2HF1 A;  3HOW I;  4A3L I;  4BXX I;  3VB9 A;  3VMG A;  3S15 I;  4X6A I;  4BY1 I;  1SFO I;  2R7Z I;  3GTM I;  3GTK I;  5IP9 I;  2DE7 A;  2PK7 A;  4A3E I;  1Y1V S;  4A3G I;  4A3C I;  2JA6 I;  3S14 I;  1I50 I;  3GTQ I;  3PO3 S;  3ESW A;  2VUM I;  2JNY A;  4A3M I;  5IP7 I;  1Y1W I;  1I6H I;  4NBG A;  4QTU A;  3HOU I;  1LQL A;  4NBA A;  1VLA A;  2E2H I;  3S1N I;  1I3Q I;  1L1O C;  4BBR I;  2BJO A;  1TWA I;  2NVQ I;  3S16 I;  4NBD A;  3HOV I;  3GTM S;  3H0G I;  3GTL I;  2J6A A;  4A3J I;  3I4N I;  3PO2 I;  1TWH I;  4NBE A;  2RBL A;  3FKI I;  2JA7 I;  3GTO I;  3RZD I;  4NBB A;  1QYP A;  3D6W A;  1ZB8 A;  1TFI A;  3I4M I;  2AKL A;  5C3E I;  3HOX I;  2R92 I;  1ML8 A;  4XX2 A;  5C44 I;  4BY7 I;  3GCF A;  3LUS A;  3Q87 A;  3H3V J;  1PFT A;  4BBS I;  2P3Y A;  3I07 A;  4NB9 A;  3EER A;  5C4J I;  3GTJ I;  5CM2 M;  3VMH A;  3M3Y I;  1TWF I;  3VMI A;  3GTG I;  1WCM I;  5C4X I;  2B63 I;  1R9T I;  4NBC A;  1USP B;  4A3K I;  3S1M I;  3HOY I;  2R93 I;  4Y52 I;  2DE5 A;  4A3D I;  4A3I I;  3CQZ I;  2K5R A;  2JA5 I;  2E2I I; 
#chains in the Genus database with same CATH topology
 4QTT A;  4DQY B;  2YU9 I;  3RZO I;  1VQP 1;  4A93 I;  3CXC Z;  1YJW Z;  1N8R 2;  2NVY I;  4Y7N I;  1WJ2 A;  4RVD A;  1FDI A;  3S2D I;  1VQN Z;  4NB8 A;  3GTP I;  3BG0 B;  1VQ6 1;  3J81 b;  4MD9 A;  1WW9 A;  2LFU A;  2JIQ A;  2F4O A;  1K73 1;  4A3L I;  2VF1 A;  2VPY A;  4BXX I;  1S72 Z;  3S15 I;  4X6A I;  2QA4 Z;  2R7Z I;  1VQ9 Z;  3GTK I;  5A2Q f;  3I55 1;  1P9N A;  2KI7 B;  1Q7Y 1;  5FLX b;  1I50 I;  1YJN 1;  3ESW A;  3KIF A;  2VUM I;  4A3M I;  4E32 A;  1YIT 1;  2GTH A;  4NBA A;  1VLA A;  3CCV Z;  3JAM b;  3G6E 1;  5D1O B;  1Z01 A;  3CPW Z;  2BJO A;  3S16 I;  3QWU A;  1S72 1;  1RO0 A;  2QA4 1;  1Q81 1;  1VQ9 1;  3CD6 Z;  3J81 f;  5T67 A;  3MON A;  1TWH I;  2WAQ A;  4NBE A;  1VQ7 1;  3CCQ 1;  3D6W A;  1TFI A;  3I4M I;  2JIO A;  2QLV B;  1Q82 2;  2AKL A;  1JWH C;  3CCS Z;  5C44 I;  3GCF A;  3Q87 A;  3OW2 Z;  3J7A 4;  3CCV 1;  4BBS I;  2P3Y A;  3CCU 1;  5FLX f;  3GTJ I;  1YJ9 1;  3VMH A;  3EED A;  1VQK 1;  2WB1 A;  3CD6 1;  3F3P C;  1K8A 2;  3HOY I;  3JAM f;  3CCM Z;  1M1K 1;  5T64 A;  2K5R A;  3CC2 1;  2JA5 I;  3CCS 1;  1RLY A;  1YIJ Z;  2W03 A;  2OTL 1;  1VQ4 1;  3M4O I;  4NBF A;  1VQP Z;  2OZK A;  1YUA A;  2G2K A;  1Q86 2;  1TWC I;  1NJI 2;  1YHQ Z;  3IF8 A;  2IV2 X;  4DK1 A;  1USP A;  2JMO A;  1X3W A;  2E2J I;  2LIY A;  3J80 b;  3CCR 1;  2KPI A;  1Y1V I;  1N2F A;  1X0T A;  2PM9 A;  2RHB A;  4CL1 A;  1NP6 A;  2NVX I;  2RPR A;  2O4H A;  1YIJ 1;  1K83 I;  1JJ2 Y;  2JS4 A;  4HH4 A;  2HF1 A;  1W2B Z;  2AYD A;  3HOW I;  1YHQ 1;  3VMG A;  2ZAE B;  1S7M A;  3G71 1;  4HGY A;  2PK7 A;  2V8J A;  1M90 1;  3I55 Z;  1Y1V S;  3NDI A;  4A3G I;  3G4S Z;  3S14 I;  1YI2 1;  3CCE 1;  1YJN Z;  2JNY A;  1YIT Z;  1I6H I;  2M48 A;  5D1P A;  2E2H I;  3S1N I;  1FDO A;  3G6E Z;  1L1O C;  3J80 f;  1K9M 1;  1KD1 2;  4NBD A;  1QXF A;  3H0G I;  3I4N I;  1QVG Z;  3PO2 I;  3G4S 1;  2RBL A;  3GTO I;  1VQ7 Z;  3CCQ Z;  3IR7 A;  2M6N A;  1QVF Y;  2IZ4 A;  5C3E I;  1ML8 A;  2K3R A;  5AN9 F;  1KRL A;  3LUS A;  3CXC Y;  3NDJ A;  2W04 A;  4NB9 A;  4RVF A;  5C4J I;  1VQM Z;  1VQO Z;  3CCU Z;  3CC4 Z;  5CM2 M;  1YJ9 Z;  2EGT A;  2QEX 1;  1N8R 1;  1VQK Z;  2OTJ 1;  3VMI A;  4RS4 A;  2B63 I;  3T4N B;  4A3D I;  4A3I I;  3I56 Z;  3F3F C;  4NBG A;  2R6M A;  3CC2 Z;  2O53 A;  3GKQ A;  2Y0S A;  2NAP A;  1AA6 A;  2OTL Z;  1VQ4 Z;  2Q4Z A;  4A3F I;  3VTN A;  3CC7 1;  2DE6 A;  2E9H A;  1Y8C A;  3U50 C;  1VQM 1;  1VQO 1;  3CC4 1;  2VPX A;  3NH4 A;  2QRC B;  3NH8 A;  3CCR Z;  2IZ3 A;  4RV9 A;  1VQ8 Z;  2GU2 A;  1KC8 1;  3HOZ I;  1ZB9 A;  4NFR A;  1KQS Z;  2H85 A;  1SIW A;  3PO3 I;  4MON A;  3I56 1;  2NVT I;  4MRI A;  1Z02 A;  1DL6 A;  2QRD B;  1JJ2 Z;  3HKZ A;  3CPW Y;  5IT9 b;  1ZH1 A;  2JUB A;  4NH1 C;  3MZL B;  3G71 Z;  4E30 A;  1SFO I;  4MD7 A;  3GTM I;  5IP9 I;  2DE7 A;  3FQM A;  4A3C I;  2JA6 I;  4DGL A;  1YI2 Z;  1VQ8 1;  3GTQ I;  3PO3 S;  3CCE Z;  5IP7 I;  2QRE B;  2RIQ A;  4QTU A;  1Q82 1;  3OW2 Y;  1K73 2;  3CMA 1;  1I3Q I;  2RT9 A;  1WZN A;  1TWA I;  2NVQ I;  2OOX B;  3GTM S;  1Q7Y 2;  4A3J I;  3GTL I;  3NFZ A;  4E33 A;  1WII A;  3FKI I;  4MXU A;  2JA7 I;  3RZD I;  4NBB A;  2JIR A;  4S1T A;  5IT9 f;  4E2X A;  3HOX I;  2QKD A;  3TE5 B;  3H3V J;  4RVH A;  2PMZ A;  3I07 A;  1VQ5 Z;  3EER A;  3CME 1;  1VQL Z;  1Q86 1;  1NJI 1;  1Q81 2;  2GTI A;  4E2Y A;  2QEX Z;  1TWF I;  2QR1 B;  2I3C A;  2OTJ Z;  1WCM I;  1R9T I;  4NBC A;  1USP B;  4A3K I;  3S1M I;  1Z03 A;  2R93 I;  3TDH B;  2DE5 A;  2E7Z A;  3IFU A;  2E2I I;  1W2B Y;  4A3B I;  4HGZ A;  2JR6 A;  3K7A I;  4NBH A;  1X3Z A;  3CC7 Z;  1VQ5 1;  1YJW 1;  2JA8 I;  1VQL 1;  4AYB A;  4E31 A;  2F4M A;  3S2H I;  1NUI A;  2LEX A;  5FLM I;  4MH4 A;  1KC8 2;  1VQN 1;  3S1R I;  2V8I A;  4NOZ A;  1M1K 2;  5LL6 f;  3IX0 A;  3S1Q I;  3S17 I;  1RO4 A;  1TWG I;  3VB9 A;  3CCJ Z;  4BY1 I;  2JIP A;  4TNU A;  1KD1 1;  1Q16 A;  2JIM A;  1QVG Y;  4E2Z A;  4A3E I;  3P5J B;  1Y1W I;  3D2L A;  3HOU I;  1LQL A;  3CCL Z;  3CMA Z;  4BBR I;  1YUK A;  3CCJ 1;  2V8K A;  4MD8 A;  3HOV I;  4E2W A;  5T6B A;  1M90 2;  3D9X A;  2VPZ A;  2HU9 A;  2J6A A;  2P28 A;  3MZK B;  4EWC A;  1QYP A;  1ZB8 A;  1RQF A;  3NH5 A;  2R92 I;  4XX2 A;  4BY7 I;  1PFT A;  3CCL 1;  1QF8 A;  3KIH A;  1K9M 2;  2Q51 A;  3CME Z;  2YAD A;  4RVG A;  3FQQ A;  3M3Y I;  3BG1 B;  3GTG I;  5C4X I;  2VPW A;  2V45 A;  1RO2 A;  2OOY B;  1KQS Y;  2V3V A;  3CCM 1;  4Y52 I;  1VQ6 Z;  1K8A 1;  1RNI A;  2VUG A;  3CQZ I;  5A2Q b;  1QVF Z;  5D1O A; 
#chains in the Genus database with same CATH homology
 4QTT A;  4DQY B;  2YU9 I;  3RZO I;  1VQP 1;  4A93 I;  3CXC Z;  1YJW Z;  1N8R 2;  2NVY I;  4Y7N I;  4RVD A;  3S2D I;  1VQN Z;  4NB8 A;  3GTP I;  3BG0 B;  1VQ6 1;  3J81 b;  4MD9 A;  1WW9 A;  2LFU A;  2F4O A;  1K73 1;  4A3L I;  2VF1 A;  4BXX I;  1S72 Z;  3S15 I;  4X6A I;  2QA4 Z;  2R7Z I;  1VQ9 Z;  3GTK I;  5A2Q f;  3I55 1;  1P9N A;  2KI7 B;  1Q7Y 1;  5FLX b;  1I50 I;  1YJN 1;  3ESW A;  3KIF A;  2VUM I;  4A3M I;  4E32 A;  1YIT 1;  2GTH A;  4NBA A;  1VLA A;  3CCV Z;  3JAM b;  3G6E 1;  5D1O B;  1Z01 A;  3CPW Z;  2BJO A;  3S16 I;  3QWU A;  1S72 1;  1RO0 A;  2QA4 1;  1Q81 1;  1VQ9 1;  3CD6 Z;  3J81 f;  5T67 A;  3MON A;  1TWH I;  2WAQ A;  4NBE A;  1VQ7 1;  3CCQ 1;  3D6W A;  1TFI A;  3I4M I;  2QLV B;  1Q82 2;  2AKL A;  1JWH C;  3CCS Z;  5C44 I;  3GCF A;  3Q87 A;  3OW2 Z;  3J7A 4;  3CCV 1;  4BBS I;  2P3Y A;  3CCU 1;  5FLX f;  3GTJ I;  1YJ9 1;  3VMH A;  3EED A;  1VQK 1;  2WB1 A;  3CD6 1;  3F3P C;  1K8A 2;  3HOY I;  3JAM f;  3CCM Z;  1M1K 1;  5T64 A;  2K5R A;  3CC2 1;  2JA5 I;  3CCS 1;  1RLY A;  1YIJ Z;  2W03 A;  2OTL 1;  1VQ4 1;  3M4O I;  4NBF A;  1VQP Z;  2OZK A;  1YUA A;  2G2K A;  1Q86 2;  1TWC I;  1NJI 2;  1YHQ Z;  3IF8 A;  4DK1 A;  1USP A;  2JMO A;  1X3W A;  2E2J I;  2LIY A;  3J80 b;  3CCR 1;  2KPI A;  1Y1V I;  1N2F A;  1X0T A;  2PM9 A;  2RHB A;  4CL1 A;  1NP6 A;  2NVX I;  2RPR A;  2O4H A;  1YIJ 1;  1K83 I;  1JJ2 Y;  2JS4 A;  4HH4 A;  2HF1 A;  1W2B Z;  3HOW I;  1YHQ 1;  3VMG A;  2ZAE B;  1S7M A;  3G71 1;  4HGY A;  2PK7 A;  2V8J A;  1M90 1;  3I55 Z;  1Y1V S;  3NDI A;  4A3G I;  3G4S Z;  3S14 I;  1YI2 1;  3CCE 1;  1YJN Z;  2JNY A;  1YIT Z;  1I6H I;  2M48 A;  5D1P A;  2E2H I;  3S1N I;  3G6E Z;  1L1O C;  3J80 f;  1K9M 1;  1KD1 2;  4NBD A;  3H0G I;  3I4N I;  1QVG Z;  3PO2 I;  3G4S 1;  2RBL A;  3GTO I;  1VQ7 Z;  3CCQ Z;  2M6N A;  1QVF Y;  2IZ4 A;  5C3E I;  1ML8 A;  2K3R A;  5AN9 F;  1KRL A;  3LUS A;  3CXC Y;  3NDJ A;  2W04 A;  4NB9 A;  4RVF A;  5C4J I;  1VQM Z;  1VQO Z;  3CCU Z;  3CC4 Z;  5CM2 M;  1YJ9 Z;  2EGT A;  2QEX 1;  1N8R 1;  1VQK Z;  2OTJ 1;  3VMI A;  4RS4 A;  2B63 I;  3T4N B;  4A3D I;  4A3I I;  3I56 Z;  3F3F C;  4NBG A;  2R6M A;  3CC2 Z;  2O53 A;  3GKQ A;  2Y0S A;  2OTL Z;  1VQ4 Z;  2Q4Z A;  4A3F I;  3VTN A;  3CC7 1;  2DE6 A;  2E9H A;  3U50 C;  1VQM 1;  1VQO 1;  3CC4 1;  3NH4 A;  2QRC B;  3NH8 A;  3CCR Z;  2IZ3 A;  4RV9 A;  1VQ8 Z;  2GU2 A;  1KC8 1;  3HOZ I;  1ZB9 A;  4NFR A;  1KQS Z;  2H85 A;  3PO3 I;  4MON A;  3I56 1;  2NVT I;  4MRI A;  1Z02 A;  1DL6 A;  2QRD B;  1JJ2 Z;  3HKZ A;  3CPW Y;  5IT9 b;  1ZH1 A;  2JUB A;  4NH1 C;  3MZL B;  3G71 Z;  4E30 A;  1SFO I;  4MD7 A;  3GTM I;  5IP9 I;  2DE7 A;  3FQM A;  4A3C I;  2JA6 I;  4DGL A;  1YI2 Z;  1VQ8 1;  3GTQ I;  3PO3 S;  3CCE Z;  5IP7 I;  2QRE B;  2RIQ A;  4QTU A;  1Q82 1;  3OW2 Y;  1K73 2;  3CMA 1;  1I3Q I;  2RT9 A;  1TWA I;  2NVQ I;  2OOX B;  3GTM S;  1Q7Y 2;  4A3J I;  3GTL I;  3NFZ A;  4E33 A;  1WII A;  3FKI I;  4MXU A;  2JA7 I;  3RZD I;  4NBB A;  4S1T A;  5IT9 f;  4E2X A;  3HOX I;  2QKD A;  3TE5 B;  3H3V J;  4RVH A;  2PMZ A;  3I07 A;  1VQ5 Z;  3EER A;  3CME 1;  1VQL Z;  1Q86 1;  1NJI 1;  1Q81 2;  2GTI A;  4E2Y A;  2QEX Z;  1TWF I;  2QR1 B;  2I3C A;  2OTJ Z;  1WCM I;  1R9T I;  4NBC A;  1USP B;  4A3K I;  3S1M I;  1Z03 A;  2R93 I;  3TDH B;  2DE5 A;  3IFU A;  2E2I I;  1W2B Y;  4A3B I;  4HGZ A;  2JR6 A;  3K7A I;  4NBH A;  1X3Z A;  3CC7 Z;  1VQ5 1;  1YJW 1;  2JA8 I;  1VQL 1;  4AYB A;  4E31 A;  2F4M A;  3S2H I;  1NUI A;  5FLM I;  4MH4 A;  1KC8 2;  1VQN 1;  3S1R I;  2V8I A;  4NOZ A;  1M1K 2;  5LL6 f;  3IX0 A;  3S1Q I;  3S17 I;  1RO4 A;  1TWG I;  3VB9 A;  3CCJ Z;  4BY1 I;  4TNU A;  1KD1 1;  1QVG Y;  4E2Z A;  4A3E I;  3P5J B;  1Y1W I;  3HOU I;  1LQL A;  3CCL Z;  3CMA Z;  4BBR I;  1YUK A;  3CCJ 1;  2V8K A;  4MD8 A;  3HOV I;  4E2W A;  5T6B A;  1M90 2;  3D9X A;  2HU9 A;  2J6A A;  2P28 A;  3MZK B;  4EWC A;  1QYP A;  1ZB8 A;  1RQF A;  3NH5 A;  2R92 I;  4XX2 A;  4BY7 I;  1PFT A;  3CCL 1;  1QF8 A;  3KIH A;  1K9M 2;  2Q51 A;  3CME Z;  2YAD A;  4RVG A;  3FQQ A;  3M3Y I;  3BG1 B;  3GTG I;  5C4X I;  1RO2 A;  2OOY B;  1KQS Y;  3CCM 1;  4Y52 I;  1VQ6 Z;  1K8A 1;  1RNI A;  2VUG A;  3CQZ I;  5A2Q b;  1QVF Z;  5D1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...