4A93I

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I02
5FLMI 4A3GI 2DE6A 2JA8I 4X6AI 3I4MI 2PK7A 1TWFI 3PO3I 4A3CI 3CQZI 1WCMI 5IP7I 3H0GI 1ML8A 1VLAA 3FKII 3GKQA 1RLYA 3Q87A 3HOZI 3I07A 4NBAA 4Y52I 4NBBA 5C4XI 2J6AA 4A93I 3LUSA 4NB9A 3VB9A 2F4OA 4BY1I 2E2JI 2KPIA 3RZDI 1Y1WI 4A3KI 2JS4A 4NBEA 1R9TI 4QTTA 3D6WA 3S15I 4NBFA 4A3JI 3S17I 2R93I 2P3YA 4A3LI 5C4JI 2DE5A 4NBCA 4NB8A 4NBHA 2YU9I 5IP9I 3RZOI 3GTKI 1USPA 2RBLA 3EERA 4NOZA 3K7AI 2E2II 3H3VJ 3S16I 4A3EI 3HOXI 4MH4A 3GTPI 1Y1VI 3PO2I 3GTGI 1I50I 4A3II 1QYPA 2BJOA 2DE7A 2JA6I 2NVYI 1RO4A 2JNYA 4A3FI 2R92I 1TWGI 3GTJI 1DL6A 1TWAI 2F4MA 4QTUA 2JR6A 5CM2M 3M3YI 1X3ZA 2VUMI 3GTQI 2NVXI 4NBDA 3I4NI 1ZB8A 1X3WA 2AKLA 4A3DI 3S2DI 4Y7NI 1TWHI 3ESWA 2R7ZI 1TFIA 1WW9A 2E2HI 1USPB 1LQLA 3S1RI 1SFOI 4XX2A 5C3EI 3S2HI 3GTLI 2JA5I 4A3BI 3HOVI 1TWCI 1L1OC 1N2FA 3GTMS 2NVTI 3HOWI 3S1QI 3HOYI 2K5RA 1PFTA 4BY7I 2JA7I 3U50C 3VMHA 2B63I 3HOUI 2HF1A 5C44I 3GCFA 1NUIA 3S14I 3S1NI 1K83I 3S1MI 2NVQI 3PO3S 1YUAA 4NBGA 1I6HI 3GTMI 3VMGA 3M4OI 4BBSI 4A3MI 4BXXI 3VMIA 1Y1VS 4BBRI 3GTOI 1I3QI 1ZB9A
chains in the Genus database with same CATH superfamily
5FLMI 2QEX1 3CCE1 1NP6A 3CCLZ 2LIYA 3PO3I 3CQZI 1WCMI 3GKQA 3Q87A 1RLYA 3I07A 4Y52I 5C4XI 2VF1A 2J6AA 1YIJ1 1JJ2Z 1VQ5Z 2GTIA 3CCQZ 1VQLZ 4BY1I 1Q821 2KPIA 4A3KI 4QTTA 3S15I 2E9HA 4A3JI 2V8KA 1NJI1 3OW2Z 3JAMf 1K8A1 1USPA 3EERA 2PM9A 4MD7A 2QLVB 4NOZA 4E2XA 2WB1A 4E30A 3S16I 1QYPA 1Q16A 2DE7A 2QR1B 2NVYI 2JIPA 1RO4A 2Q51A 2JUBA 1X0TA 1YJW1 2R92I 1S7MA 3GTJI 1TWAI 2M6NA 3J81f 4RVGA 4DQYB 3CPWZ 3I4NI 4HGZA 2W04A 1X3WA 1FDIA 3ESWA 2R7ZI 1Q822 3F3FC 5C3EI 5LL6f 1VQ81 2OTJZ 4A3BI 4CL1A 1N2FA 1RNIA 1K8A2 3HOWI 3J80f 3QWUA 3S1QI 2K5RA 2GTHA 1Q861 3MONA 5T67A 3HOUI 5C44I 1VQO1 2LFUA 1VQ9Z 3S1MI 1KQSZ 4NBGA 1VQL1 2QA4Z 2OOYB 5A2Qf 4BXXI 3JAMb 2NAPA 4EWCA 1FDOA 4A3GI 4RV9A 2JA8I 3NH5A 3I4MI 2PK7A 4X6AI 4E31A 1P9NA 2OTLZ 2JIQA 1QVFY 1N8R1 1ML8A 3FKII 1YI21 3I561 4NBBA 3G71Z 1YITZ 3CCUZ 3LUSA 4NB9A 1W2BY 2F4OA 3J81b 2V3VA 4E33A 1R9TI 2JS4A 1Q862 2WAQA 3D6WA 1K731 2R93I 2VUGA 5IP9I 3RZOI 2R6MA 2RBLA 1VQ71 1VQPZ 4HGYA 4E2ZA 2VPWA 3K7AI 1S721 3H3VJ 2O53A 4RS4A 4MH4A 4RVDA 3J80b 1Y1VI 3GTGI 2OTJ1 3G6E1 3CCM1 1RO0A 4E32A 1TWGI 4E2WA 4RVHA 2JR6A 4NFRA 3FQQA 3CCSZ 3T4NB 1N8R2 1X3ZA 3M3YI 4MONA 3GTQI 4MXUA 4NBDA 1Z01A 1ZB8A 5A2Qb 1VQ91 1WIIA 1WW9A 3CC2Z 2O4HA 1VQN1 2P28A 3S1RI 2QA41 3S2HI 1K732 5D1OB 3GTLI 1L1OC 1QXFA 2E7ZA 1KC81 3NFZA 1VQM1 1JJ2Y 2NVTI 2GU2A 1YJ91 3CMEZ 2OTL1 1VQ41 2HF1A 3TE5B 4MD9A 1YHQZ 5IT9f 3S14I 3CCRZ 3OW2Y 1K83I 1VQ6Z 2NVQI 2RHBA 2V8IA 4BBSI 1YUKA 4A3MI 2JMOA 1QVGZ 1K9M1 4BBRI 3GTOI 3D2LA 1NJI2 1YJNZ 2OOXB 1ZB9A 2QEXZ 4RVFA 2YADA 3CCEZ 3CCL1 3IF8A 2DE6A 1TWFI 1SIWA 3MZKB 1RQFA 5IP7I 3CXCZ 1Y8CA 2M48A 2QREB 4MD8A 4NBAA 2IZ3A 3KIHA 3CPWY 1KC82 2OZKA 4A93I 1YIJZ 5T6BA 1VQ51 3VB9A 3CCQ1 2Y0SA 3EEDA 2V45A 4NBFA 1QF8A 2JIMA 3S17I 2P3YA 5C4JI 4NBCA 4NB8A 3BG0B 3CCS1 2PMZA 2JIRA 3GTKI 3CD6Z 2KI7B 3G4SZ 2E2II 1K9M2 1I50I 4A3II 3CCJZ 3HKZA 1KQSY 2JA6I 2IZ4A 5AN9F 1Q7Y1 1KD11 5IT9b 1DL6A 2F4MA 4QTUA 3CME1 4TNUA 3IR7A 1YHQ1 2AKLA 2H85A 3CCR1 3S2DI 4A3DI 1VQ61 1TFIA 2E2HI 1USPB 1SFOI 4XX2A 1Q811 1M901 1VQ8Z 2VPXA 3GTMS 3IFUA 3CMAZ 2RPRA 4DGLA 1KRLA 1PFTA 4BY7I 2JA7I 3U50C 3VTNA 2B63I 4NH1C 3CC7Z 2QRCB 3GCFA 1VQOZ 3S1NI 2I3CA 4HH4A 3PO3S 3I55Z 5D1PA 1YUAA 3CC4Z 1I6HI 1Q7Y2 1JWHC 1KD12 3VMGA 3VMIA 1Y1VS 2VPZA 1I3QI 4MRIA 2G2KA 3NH4A 3CD61 4A3CI 3G4S1 3H0GI 3CCVZ 1VLAA 5FLXf 3HOZI 1YI2Z 1Q812 3I56Z 3BG1B 1M902 2QRDB 3G711 1M1K1 1YIT1 1VQKZ 3CCU1 3CCJ1 2E2JI 3RZDI 1Y1WI 4NBEA 4DK1A 3P5JB 4A3LI 3TDHB 2DE5A 2LEXA 1WZNA 4NBHA 2YU9I 2EGTA 3J7A4 1VQ7Z 1VQP1 4E2YA 2VPYA 5D1OA 2V8JA 2K3RA 2Q4ZA 1S72Z 4A3EI 3HOXI 3GTPI 2QKDA 3F3PC 3PO2I 2BJOA 1AA6A 3NDJA 3G6EZ 2JNYA 3CCMZ 4A3FI 3CMA1 1QVFZ 1Z02A 2ZAEB 1ZH1A 1QVGY 5CM2M 2VUMI 3CC71 2NVXI 3NH8A 2RT9A 1M1K2 2RIQA 1W2BZ 5T64A 4Y7NI 1TWHI 3I551 3FQMA 3CC41 1VQNZ 3CC21 1LQLA 3CXCY 2HU9A 2JA5I 3HOVI 1TWCI 3NDIA 1VQMZ 1YJWZ 5FLXb 3IX0A 3HOYI 3MZLB 1YJ9Z 2W03A 3VMHA 1VQ4Z 4S1TA 1NUIA 3CCV1 1WJ2A 1Z03A 1VQK1 3KIFA 3GTMI 2AYDA 3M4OI 2JIOA 1RO2A 3D9XA 4AYBA 1YJN1 2IV2X
chains in the Genus database with same CATH topology
5FLMI 2QEX1 3CCE1 1NP6A 3CCLZ 2LIYA 3PO3I 3CQZI 1WCMI 3GKQA 3Q87A 1RLYA 3I07A 4Y52I 5C4XI 2VF1A 2J6AA 1YIJ1 1JJ2Z 1VQ5Z 2GTIA 3CCQZ 1VQLZ 4BY1I 1Q821 2KPIA 4A3KI 4QTTA 3S15I 2E9HA 4A3JI 2V8KA 1NJI1 3OW2Z 3JAMf 1K8A1 1USPA 3EERA 2PM9A 4MD7A 2QLVB 4NOZA 4E2XA 2WB1A 4E30A 3S16I 1QYPA 2DE7A 2QR1B 2NVYI 1RO4A 2Q51A 2JUBA 1X0TA 1YJW1 2R92I 1S7MA 3GTJI 1TWAI 2M6NA 3J81f 4RVGA 4DQYB 3CPWZ 3I4NI 4HGZA 2W04A 1X3WA 3ESWA 2R7ZI 1Q822 3F3FC 5C3EI 5LL6f 1VQ81 2OTJZ 4A3BI 4CL1A 1N2FA 1RNIA 1K8A2 3HOWI 3J80f 3QWUA 3S1QI 2K5RA 2GTHA 1Q861 3MONA 5T67A 3HOUI 5C44I 1VQO1 2LFUA 1VQ9Z 3S1MI 1KQSZ 4NBGA 1VQL1 2QA4Z 2OOYB 5A2Qf 4BXXI 3JAMb 4EWCA 4A3GI 4RV9A 2JA8I 3NH5A 3I4MI 2PK7A 4X6AI 4E31A 1P9NA 2OTLZ 1QVFY 1N8R1 1ML8A 3FKII 1YI21 3I561 4NBBA 3G71Z 1YITZ 3CCUZ 3LUSA 4NB9A 1W2BY 2F4OA 3J81b 4E33A 1R9TI 2JS4A 1Q862 2WAQA 3D6WA 1K731 2R93I 2VUGA 5IP9I 3RZOI 2R6MA 2RBLA 1VQ71 1VQPZ 4HGYA 4E2ZA 3K7AI 1S721 3H3VJ 2O53A 4RS4A 4MH4A 4RVDA 3J80b 1Y1VI 3GTGI 2OTJ1 3G6E1 3CCM1 1RO0A 4E32A 1TWGI 4E2WA 4RVHA 2JR6A 4NFRA 3FQQA 3CCSZ 3T4NB 1N8R2 1X3ZA 3M3YI 4MONA 3GTQI 4MXUA 4NBDA 1Z01A 1ZB8A 5A2Qb 1VQ91 1WIIA 1WW9A 3CC2Z 2O4HA 1VQN1 2P28A 3S1RI 2QA41 3S2HI 1K732 5D1OB 3GTLI 1L1OC 1KC81 3NFZA 1VQM1 1JJ2Y 2NVTI 2GU2A 1YJ91 3CMEZ 2OTL1 1VQ41 2HF1A 3TE5B 4MD9A 1YHQZ 5IT9f 3S14I 3CCRZ 3OW2Y 1K83I 1VQ6Z 2NVQI 2RHBA 2V8IA 4BBSI 1YUKA 4A3MI 2JMOA 1QVGZ 1K9M1 4BBRI 3GTOI 1NJI2 1YJNZ 2OOXB 1ZB9A 2QEXZ 4RVFA 2YADA 3CCEZ 3CCL1 3IF8A 2DE6A 1TWFI 3MZKB 1RQFA 5IP7I 3CXCZ 2M48A 2QREB 4MD8A 4NBAA 2IZ3A 3KIHA 3CPWY 1KC82 2OZKA 4A93I 1YIJZ 5T6BA 1VQ51 3VB9A 3CCQ1 2Y0SA 3EEDA 4NBFA 1QF8A 3S17I 2P3YA 5C4JI 4NBCA 4NB8A 3BG0B 3CCS1 2PMZA 3GTKI 3CD6Z 2KI7B 3G4SZ 2E2II 1K9M2 1I50I 4A3II 3CCJZ 3HKZA 1KQSY 2JA6I 2IZ4A 5AN9F 1Q7Y1 1KD11 5IT9b 1DL6A 2F4MA 4QTUA 3CME1 4TNUA 1YHQ1 2AKLA 2H85A 3CCR1 3S2DI 4A3DI 1VQ61 1TFIA 2E2HI 1USPB 1SFOI 4XX2A 1Q811 1M901 1VQ8Z 3GTMS 3IFUA 3CMAZ 2RPRA 4DGLA 1KRLA 1PFTA 4BY7I 2JA7I 3U50C 3VTNA 2B63I 4NH1C 3CC7Z 2QRCB 3GCFA 1VQOZ 3S1NI 2I3CA 4HH4A 3PO3S 3I55Z 5D1PA 1YUAA 3CC4Z 1I6HI 1Q7Y2 1JWHC 1KD12 3VMGA 3VMIA 1Y1VS 1I3QI 4MRIA 2G2KA 3NH4A 3CD61 4A3CI 3G4S1 3H0GI 3CCVZ 1VLAA 5FLXf 3HOZI 1YI2Z 1Q812 3I56Z 3BG1B 1M902 2QRDB 3G711 1M1K1 1YIT1 1VQKZ 3CCU1 3CCJ1 2E2JI 3RZDI 1Y1WI 4NBEA 4DK1A 3P5JB 4A3LI 3TDHB 2DE5A 4NBHA 2YU9I 2EGTA 3J7A4 1VQ7Z 1VQP1 4E2YA 5D1OA 2V8JA 2K3RA 2Q4ZA 1S72Z 4A3EI 3HOXI 3GTPI 2QKDA 3F3PC 3PO2I 2BJOA 3NDJA 3G6EZ 2JNYA 3CCMZ 4A3FI 3CMA1 1QVFZ 1Z02A 2ZAEB 1ZH1A 1QVGY 5CM2M 2VUMI 3CC71 2NVXI 3NH8A 2RT9A 1M1K2 2RIQA 1W2BZ 5T64A 4Y7NI 1TWHI 3I551 3FQMA 3CC41 1VQNZ 3CC21 1LQLA 3CXCY 2HU9A 2JA5I 3HOVI 1TWCI 3NDIA 1VQMZ 1YJWZ 5FLXb 3IX0A 3HOYI 3MZLB 1YJ9Z 2W03A 3VMHA 1VQ4Z 4S1TA 1NUIA 3CCV1 1Z03A 1VQK1 3KIFA 3GTMI 3M4OI 1RO2A 3D9XA 4AYBA 1YJN1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM I;  4A3G I;  2DE6 A;  2JA8 I;  4X6A I;  3I4M I;  2PK7 A;  1TWF I;  3PO3 I;  4A3C I;  3CQZ I;  1WCM I;  5IP7 I;  3H0G I;  1ML8 A;  1VLA A;  3FKI I;  3GKQ A;  1RLY A;  3Q87 A;  3HOZ I;  3I07 A;  4NBA A;  4Y52 I;  4NBB A;  5C4X I;  2J6A A;  4A93 I;  3LUS A;  4NB9 A;  3VB9 A;  2F4O A;  4BY1 I;  2E2J I;  2KPI A;  3RZD I;  1Y1W I;  4A3K I;  2JS4 A;  4NBE A;  1R9T I;  4QTT A;  3D6W A;  3S15 I;  4NBF A;  4A3J I;  3S17 I;  2R93 I;  2P3Y A;  4A3L I;  5C4J I;  2DE5 A;  4NBC A;  4NB8 A;  4NBH A;  2YU9 I;  5IP9 I;  3RZO I;  3GTK I;  1USP A;  2RBL A;  3EER A;  4NOZ A;  3K7A I;  2E2I I;  3H3V J;  3S16 I;  4A3E I;  3HOX I;  4MH4 A;  3GTP I;  1Y1V I;  3PO2 I;  3GTG I;  1I50 I;  4A3I I;  1QYP A;  2BJO A;  2DE7 A;  2JA6 I;  2NVY I;  1RO4 A;  2JNY A;  4A3F I;  2R92 I;  1TWG I;  3GTJ I;  1DL6 A;  1TWA I;  2F4M A;  4QTU A;  2JR6 A;  5CM2 M;  3M3Y I;  1X3Z A;  2VUM I;  3GTQ I;  2NVX I;  4NBD A;  3I4N I;  1ZB8 A;  1X3W A;  2AKL A;  4A3D I;  3S2D I;  4Y7N I;  1TWH I;  3ESW A;  2R7Z I;  1TFI A;  1WW9 A;  2E2H I;  1USP B;  1LQL A;  3S1R I;  1SFO I;  4XX2 A;  5C3E I;  3S2H I;  3GTL I;  2JA5 I;  4A3B I;  3HOV I;  1TWC I;  1L1O C;  1N2F A;  3GTM S;  2NVT I;  3HOW I;  3S1Q I;  3HOY I;  2K5R A;  1PFT A;  4BY7 I;  2JA7 I;  3U50 C;  3VMH A;  2B63 I;  3HOU I;  2HF1 A;  5C44 I;  3GCF A;  1NUI A;  3S14 I;  3S1N I;  1K83 I;  3S1M I;  2NVQ I;  3PO3 S;  1YUA A;  4NBG A;  1I6H I;  3GTM I;  3VMG A;  3M4O I;  4BBS I;  4A3M I;  4BXX I;  3VMI A;  1Y1V S;  4BBR I;  3GTO I;  1I3Q I;  1ZB9 A; 
#chains in the Genus database with same CATH topology
 5FLM I;  2QEX 1;  3CCE 1;  1NP6 A;  3CCL Z;  2LIY A;  3PO3 I;  3CQZ I;  1WCM I;  3GKQ A;  3Q87 A;  1RLY A;  3I07 A;  4Y52 I;  5C4X I;  2VF1 A;  2J6A A;  1YIJ 1;  1JJ2 Z;  1VQ5 Z;  2GTI A;  3CCQ Z;  1VQL Z;  4BY1 I;  1Q82 1;  2KPI A;  4A3K I;  4QTT A;  3S15 I;  2E9H A;  4A3J I;  2V8K A;  1NJI 1;  3OW2 Z;  3JAM f;  1K8A 1;  1USP A;  3EER A;  2PM9 A;  4MD7 A;  2QLV B;  4NOZ A;  4E2X A;  2WB1 A;  4E30 A;  3S16 I;  1QYP A;  1Q16 A;  2DE7 A;  2QR1 B;  2NVY I;  2JIP A;  1RO4 A;  2Q51 A;  2JUB A;  1X0T A;  1YJW 1;  2R92 I;  1S7M A;  3GTJ I;  1TWA I;  2M6N A;  3J81 f;  4RVG A;  4DQY B;  3CPW Z;  3I4N I;  4HGZ A;  2W04 A;  1X3W A;  1FDI A;  3ESW A;  2R7Z I;  1Q82 2;  3F3F C;  5C3E I;  5LL6 f;  1VQ8 1;  2OTJ Z;  4A3B I;  4CL1 A;  1N2F A;  1RNI A;  1K8A 2;  3HOW I;  3J80 f;  3QWU A;  3S1Q I;  2K5R A;  2GTH A;  1Q86 1;  3MON A;  5T67 A;  3HOU I;  5C44 I;  1VQO 1;  2LFU A;  1VQ9 Z;  3S1M I;  1KQS Z;  4NBG A;  1VQL 1;  2QA4 Z;  2OOY B;  5A2Q f;  4BXX I;  3JAM b;  2NAP A;  4EWC A;  1FDO A;  4A3G I;  4RV9 A;  2JA8 I;  3NH5 A;  3I4M I;  2PK7 A;  4X6A I;  4E31 A;  1P9N A;  2OTL Z;  2JIQ A;  1QVF Y;  1N8R 1;  1ML8 A;  3FKI I;  1YI2 1;  3I56 1;  4NBB A;  3G71 Z;  1YIT Z;  3CCU Z;  3LUS A;  4NB9 A;  1W2B Y;  2F4O A;  3J81 b;  2V3V A;  4E33 A;  1R9T I;  2JS4 A;  1Q86 2;  2WAQ A;  3D6W A;  1K73 1;  2R93 I;  2VUG A;  5IP9 I;  3RZO I;  2R6M A;  2RBL A;  1VQ7 1;  1VQP Z;  4HGY A;  4E2Z A;  2VPW A;  3K7A I;  1S72 1;  3H3V J;  2O53 A;  4RS4 A;  4MH4 A;  4RVD A;  3J80 b;  1Y1V I;  3GTG I;  2OTJ 1;  3G6E 1;  3CCM 1;  1RO0 A;  4E32 A;  1TWG I;  4E2W A;  4RVH A;  2JR6 A;  4NFR A;  3FQQ A;  3CCS Z;  3T4N B;  1N8R 2;  1X3Z A;  3M3Y I;  4MON A;  3GTQ I;  4MXU A;  4NBD A;  1Z01 A;  1ZB8 A;  5A2Q b;  1VQ9 1;  1WII A;  1WW9 A;  3CC2 Z;  2O4H A;  1VQN 1;  2P28 A;  3S1R I;  2QA4 1;  3S2H I;  1K73 2;  5D1O B;  3GTL I;  1L1O C;  1QXF A;  2E7Z A;  1KC8 1;  3NFZ A;  1VQM 1;  1JJ2 Y;  2NVT I;  2GU2 A;  1YJ9 1;  3CME Z;  2OTL 1;  1VQ4 1;  2HF1 A;  3TE5 B;  4MD9 A;  1YHQ Z;  5IT9 f;  3S14 I;  3CCR Z;  3OW2 Y;  1K83 I;  1VQ6 Z;  2NVQ I;  2RHB A;  2V8I A;  4BBS I;  1YUK A;  4A3M I;  2JMO A;  1QVG Z;  1K9M 1;  4BBR I;  3GTO I;  3D2L A;  1NJI 2;  1YJN Z;  2OOX B;  1ZB9 A;  2QEX Z;  4RVF A;  2YAD A;  3CCE Z;  3CCL 1;  3IF8 A;  2DE6 A;  1TWF I;  1SIW A;  3MZK B;  1RQF A;  5IP7 I;  3CXC Z;  1Y8C A;  2M48 A;  2QRE B;  4MD8 A;  4NBA A;  2IZ3 A;  3KIH A;  3CPW Y;  1KC8 2;  2OZK A;  4A93 I;  1YIJ Z;  5T6B A;  1VQ5 1;  3VB9 A;  3CCQ 1;  2Y0S A;  3EED A;  2V45 A;  4NBF A;  1QF8 A;  2JIM A;  3S17 I;  2P3Y A;  5C4J I;  4NBC A;  4NB8 A;  3BG0 B;  3CCS 1;  2PMZ A;  2JIR A;  3GTK I;  3CD6 Z;  2KI7 B;  3G4S Z;  2E2I I;  1K9M 2;  1I50 I;  4A3I I;  3CCJ Z;  3HKZ A;  1KQS Y;  2JA6 I;  2IZ4 A;  5AN9 F;  1Q7Y 1;  1KD1 1;  5IT9 b;  1DL6 A;  2F4M A;  4QTU A;  3CME 1;  4TNU A;  3IR7 A;  1YHQ 1;  2AKL A;  2H85 A;  3CCR 1;  3S2D I;  4A3D I;  1VQ6 1;  1TFI A;  2E2H I;  1USP B;  1SFO I;  4XX2 A;  1Q81 1;  1M90 1;  1VQ8 Z;  2VPX A;  3GTM S;  3IFU A;  3CMA Z;  2RPR A;  4DGL A;  1KRL A;  1PFT A;  4BY7 I;  2JA7 I;  3U50 C;  3VTN A;  2B63 I;  4NH1 C;  3CC7 Z;  2QRC B;  3GCF A;  1VQO Z;  3S1N I;  2I3C A;  4HH4 A;  3PO3 S;  3I55 Z;  5D1P A;  1YUA A;  3CC4 Z;  1I6H I;  1Q7Y 2;  1JWH C;  1KD1 2;  3VMG A;  3VMI A;  1Y1V S;  2VPZ A;  1I3Q I;  4MRI A;  2G2K A;  3NH4 A;  3CD6 1;  4A3C I;  3G4S 1;  3H0G I;  3CCV Z;  1VLA A;  5FLX f;  3HOZ I;  1YI2 Z;  1Q81 2;  3I56 Z;  3BG1 B;  1M90 2;  2QRD B;  3G71 1;  1M1K 1;  1YIT 1;  1VQK Z;  3CCU 1;  3CCJ 1;  2E2J I;  3RZD I;  1Y1W I;  4NBE A;  4DK1 A;  3P5J B;  4A3L I;  3TDH B;  2DE5 A;  2LEX A;  1WZN A;  4NBH A;  2YU9 I;  2EGT A;  3J7A 4;  1VQ7 Z;  1VQP 1;  4E2Y A;  2VPY A;  5D1O A;  2V8J A;  2K3R A;  2Q4Z A;  1S72 Z;  4A3E I;  3HOX I;  3GTP I;  2QKD A;  3F3P C;  3PO2 I;  2BJO A;  1AA6 A;  3NDJ A;  3G6E Z;  2JNY A;  3CCM Z;  4A3F I;  3CMA 1;  1QVF Z;  1Z02 A;  2ZAE B;  1ZH1 A;  1QVG Y;  5CM2 M;  2VUM I;  3CC7 1;  2NVX I;  3NH8 A;  2RT9 A;  1M1K 2;  2RIQ A;  1W2B Z;  5T64 A;  4Y7N I;  1TWH I;  3I55 1;  3FQM A;  3CC4 1;  1VQN Z;  3CC2 1;  1LQL A;  3CXC Y;  2HU9 A;  2JA5 I;  3HOV I;  1TWC I;  3NDI A;  1VQM Z;  1YJW Z;  5FLX b;  3IX0 A;  3HOY I;  3MZL B;  1YJ9 Z;  2W03 A;  3VMH A;  1VQ4 Z;  4S1T A;  1NUI A;  3CCV 1;  1WJ2 A;  1Z03 A;  1VQK 1;  3KIF A;  3GTM I;  2AYD A;  3M4O I;  2JIO A;  1RO2 A;  3D9X A;  4AYB A;  1YJN 1;  2IV2 X; 
#chains in the Genus database with same CATH homology
 5FLM I;  2QEX 1;  3CCE 1;  1NP6 A;  3CCL Z;  2LIY A;  3PO3 I;  3CQZ I;  1WCM I;  3GKQ A;  3Q87 A;  1RLY A;  3I07 A;  4Y52 I;  5C4X I;  2VF1 A;  2J6A A;  1YIJ 1;  1JJ2 Z;  1VQ5 Z;  2GTI A;  3CCQ Z;  1VQL Z;  4BY1 I;  1Q82 1;  2KPI A;  4A3K I;  4QTT A;  3S15 I;  2E9H A;  4A3J I;  2V8K A;  1NJI 1;  3OW2 Z;  3JAM f;  1K8A 1;  1USP A;  3EER A;  2PM9 A;  4MD7 A;  2QLV B;  4NOZ A;  4E2X A;  2WB1 A;  4E30 A;  3S16 I;  1QYP A;  2DE7 A;  2QR1 B;  2NVY I;  1RO4 A;  2Q51 A;  2JUB A;  1X0T A;  1YJW 1;  2R92 I;  1S7M A;  3GTJ I;  1TWA I;  2M6N A;  3J81 f;  4RVG A;  4DQY B;  3CPW Z;  3I4N I;  4HGZ A;  2W04 A;  1X3W A;  3ESW A;  2R7Z I;  1Q82 2;  3F3F C;  5C3E I;  5LL6 f;  1VQ8 1;  2OTJ Z;  4A3B I;  4CL1 A;  1N2F A;  1RNI A;  1K8A 2;  3HOW I;  3J80 f;  3QWU A;  3S1Q I;  2K5R A;  2GTH A;  1Q86 1;  3MON A;  5T67 A;  3HOU I;  5C44 I;  1VQO 1;  2LFU A;  1VQ9 Z;  3S1M I;  1KQS Z;  4NBG A;  1VQL 1;  2QA4 Z;  2OOY B;  5A2Q f;  4BXX I;  3JAM b;  4EWC A;  4A3G I;  4RV9 A;  2JA8 I;  3NH5 A;  3I4M I;  2PK7 A;  4X6A I;  4E31 A;  1P9N A;  2OTL Z;  1QVF Y;  1N8R 1;  1ML8 A;  3FKI I;  1YI2 1;  3I56 1;  4NBB A;  3G71 Z;  1YIT Z;  3CCU Z;  3LUS A;  4NB9 A;  1W2B Y;  2F4O A;  3J81 b;  4E33 A;  1R9T I;  2JS4 A;  1Q86 2;  2WAQ A;  3D6W A;  1K73 1;  2R93 I;  2VUG A;  5IP9 I;  3RZO I;  2R6M A;  2RBL A;  1VQ7 1;  1VQP Z;  4HGY A;  4E2Z A;  3K7A I;  1S72 1;  3H3V J;  2O53 A;  4RS4 A;  4MH4 A;  4RVD A;  3J80 b;  1Y1V I;  3GTG I;  2OTJ 1;  3G6E 1;  3CCM 1;  1RO0 A;  4E32 A;  1TWG I;  4E2W A;  4RVH A;  2JR6 A;  4NFR A;  3FQQ A;  3CCS Z;  3T4N B;  1N8R 2;  1X3Z A;  3M3Y I;  4MON A;  3GTQ I;  4MXU A;  4NBD A;  1Z01 A;  1ZB8 A;  5A2Q b;  1VQ9 1;  1WII A;  1WW9 A;  3CC2 Z;  2O4H A;  1VQN 1;  2P28 A;  3S1R I;  2QA4 1;  3S2H I;  1K73 2;  5D1O B;  3GTL I;  1L1O C;  1KC8 1;  3NFZ A;  1VQM 1;  1JJ2 Y;  2NVT I;  2GU2 A;  1YJ9 1;  3CME Z;  2OTL 1;  1VQ4 1;  2HF1 A;  3TE5 B;  4MD9 A;  1YHQ Z;  5IT9 f;  3S14 I;  3CCR Z;  3OW2 Y;  1K83 I;  1VQ6 Z;  2NVQ I;  2RHB A;  2V8I A;  4BBS I;  1YUK A;  4A3M I;  2JMO A;  1QVG Z;  1K9M 1;  4BBR I;  3GTO I;  1NJI 2;  1YJN Z;  2OOX B;  1ZB9 A;  2QEX Z;  4RVF A;  2YAD A;  3CCE Z;  3CCL 1;  3IF8 A;  2DE6 A;  1TWF I;  3MZK B;  1RQF A;  5IP7 I;  3CXC Z;  2M48 A;  2QRE B;  4MD8 A;  4NBA A;  2IZ3 A;  3KIH A;  3CPW Y;  1KC8 2;  2OZK A;  4A93 I;  1YIJ Z;  5T6B A;  1VQ5 1;  3VB9 A;  3CCQ 1;  2Y0S A;  3EED A;  4NBF A;  1QF8 A;  3S17 I;  2P3Y A;  5C4J I;  4NBC A;  4NB8 A;  3BG0 B;  3CCS 1;  2PMZ A;  3GTK I;  3CD6 Z;  2KI7 B;  3G4S Z;  2E2I I;  1K9M 2;  1I50 I;  4A3I I;  3CCJ Z;  3HKZ A;  1KQS Y;  2JA6 I;  2IZ4 A;  5AN9 F;  1Q7Y 1;  1KD1 1;  5IT9 b;  1DL6 A;  2F4M A;  4QTU A;  3CME 1;  4TNU A;  1YHQ 1;  2AKL A;  2H85 A;  3CCR 1;  3S2D I;  4A3D I;  1VQ6 1;  1TFI A;  2E2H I;  1USP B;  1SFO I;  4XX2 A;  1Q81 1;  1M90 1;  1VQ8 Z;  3GTM S;  3IFU A;  3CMA Z;  2RPR A;  4DGL A;  1KRL A;  1PFT A;  4BY7 I;  2JA7 I;  3U50 C;  3VTN A;  2B63 I;  4NH1 C;  3CC7 Z;  2QRC B;  3GCF A;  1VQO Z;  3S1N I;  2I3C A;  4HH4 A;  3PO3 S;  3I55 Z;  5D1P A;  1YUA A;  3CC4 Z;  1I6H I;  1Q7Y 2;  1JWH C;  1KD1 2;  3VMG A;  3VMI A;  1Y1V S;  1I3Q I;  4MRI A;  2G2K A;  3NH4 A;  3CD6 1;  4A3C I;  3G4S 1;  3H0G I;  3CCV Z;  1VLA A;  5FLX f;  3HOZ I;  1YI2 Z;  1Q81 2;  3I56 Z;  3BG1 B;  1M90 2;  2QRD B;  3G71 1;  1M1K 1;  1YIT 1;  1VQK Z;  3CCU 1;  3CCJ 1;  2E2J I;  3RZD I;  1Y1W I;  4NBE A;  4DK1 A;  3P5J B;  4A3L I;  3TDH B;  2DE5 A;  4NBH A;  2YU9 I;  2EGT A;  3J7A 4;  1VQ7 Z;  1VQP 1;  4E2Y A;  5D1O A;  2V8J A;  2K3R A;  2Q4Z A;  1S72 Z;  4A3E I;  3HOX I;  3GTP I;  2QKD A;  3F3P C;  3PO2 I;  2BJO A;  3NDJ A;  3G6E Z;  2JNY A;  3CCM Z;  4A3F I;  3CMA 1;  1QVF Z;  1Z02 A;  2ZAE B;  1ZH1 A;  1QVG Y;  5CM2 M;  2VUM I;  3CC7 1;  2NVX I;  3NH8 A;  2RT9 A;  1M1K 2;  2RIQ A;  1W2B Z;  5T64 A;  4Y7N I;  1TWH I;  3I55 1;  3FQM A;  3CC4 1;  1VQN Z;  3CC2 1;  1LQL A;  3CXC Y;  2HU9 A;  2JA5 I;  3HOV I;  1TWC I;  3NDI A;  1VQM Z;  1YJW Z;  5FLX b;  3IX0 A;  3HOY I;  3MZL B;  1YJ9 Z;  2W03 A;  3VMH A;  1VQ4 Z;  4S1T A;  1NUI A;  3CCV 1;  1Z03 A;  1VQK 1;  3KIF A;  3GTM I;  3M4O I;  1RO2 A;  3D9X A;  4AYB A;  1YJN 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...