3TDHB

Structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 16
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3tdhB01
2QRCB 3TDHB 3TE5B 2OOXB 2QRDB 2QREB 2OOYB 2QLVB 2QR1B 3T4NB
chains in the Genus database with same CATH superfamily
1L1OC 3J80f 4NOZA 3CPWY 3J7A4 1LQLA 1KQSY 3S2HI 1M1K2 1ZB9A 3CCMZ 3J81f 5C3EI 4Y7NI 3CC21 5D1OB 1Q16A 1Q811 3HOVI 3CCR1 1S72Z 1YUKA 1FDIA 1VQ41 1M1K1 1VQM1 3CCJZ 2E7ZA 1YJN1 3GTLI 3FKII 2V45A 3RZDI 3GTMI 3CCS1 3CMA1 3H3VJ 5A2Qf 5IT9b 2QEX1 5T67A 3CC71 4S1TA 3MZLB 1K731 2QRDB 1M902 3I55Z 1TWFI 3JAMb 4Y52I 2JIOA 1RLYA 5IT9f 1I6HI 1TWCI 1Y1VI 2LFUA 3PO3S 1NUIA 2O4HA 1TWAI 1YIJZ 2OTJ1 2RPRA 2RHBA 5FLXb 2O53A 3CXCZ 1TWGI 4NH1C 1VQ91 1Z01A 2LIYA 3GTGI 1SFOI 3QWUA 2AKLA 1I3QI 1JJ2Y 2NVYI 1VQ5Z 3CD61 3I4MI 5FLXf 2PK7A 3Q87A 1RO4A 2JMOA 3S14I 2QRCB 2H85A 4RVGA 1YJWZ 4DGLA 4A3JI 1Y1WI 1USPB 2RT9A 3F3FC 3CCVZ 3S1NI 2E2II 1YITZ 2JA7I 2E2HI 1RNIA 3U50C 3NH4A 4A3MI 1X3ZA 4E32A 4BBRI 3MZKB 1QVFZ 2QR1B 3VMHA 1KRLA 1QVFY 5C4JI 2P28A 1FDOA 2VPWA 3G4SZ 1VQO1 3HOYI 1Q7Y1 1YHQZ 2AYDA 3GTMS 2QA4Z 4A3KI 3FQMA 1K9M1 3PO2I 1X3WA 3I56Z 5D1OA 3GTKI 2Q51A 2V8KA 2F4OA 4MD8A 5IP7I 3S1MI 2I3CA 1VQNZ 3GKQA 2OOXB 3CCL1 3CCJ1 1VQKZ 3EERA 1NJI1 1Q812 3S1RI 1TFIA 2F4MA 2IZ3A 3GTQI 1VQ71 3K7AI 1Y1VS 1VLAA 3CC4Z 3TDHB 1WJ2A 1QXFA 2JA5I 2JA6I 1I50I 3CCEZ 2LEXA 1WZNA 4MRIA 3IR7A 1YI2Z 2OTLZ 1S7MA 4E33A 2GTIA 4MD9A 1N8R1 2JIRA 5T6BA 1QYPA 3I551 5A2Qb 3P5JB 1AA6A 2VPYA 2DE6A 4NBBA 3IFUA 2J6AA 2BJOA 2K5RA 3VTNA 1K732 3HOZI 1SIWA 3OW2Z 3NDIA 2W03A 1KC81 4AYBA 2QLVB 1TWHI 1VQ8Z 3G711 1DL6A 4BY1I 3IF8A 2JA8I 2RBLA 3OW2Y 2NVQI 4QTTA 4EWCA 1KD12 1YJ91 3VB9A 3CMEZ 2R93I 2JS4A 1VQ51 4MONA 4NBCA 1RO0A 1RO2A 2JNYA 5IP9I 4RVFA 5CM2M 4BBSI 2V3VA 1YJW1 2DE5A 1N2FA 4NBDA 4NBGA 1KD11 1K8A1 3CCV1 3NH5A 2OOYB 4CL1A 3CC2Z 3HOUI 3NH8A 4E2ZA 2V8IA 4BXXI 3CXCY 2IV2X 4HH4A 2P3YA 1VQMZ 3NDJA 5FLMI 1YJNZ 3BG1B 1Y8CA 2R92I 1P9NA 4NBFA 5AN9F 1Z02A 3G6E1 2QEXZ 2KI7B 2JUBA 1YHQ1 4NBAA 3RZOI 4DK1A 2VUGA 4E31A 2QA41 1WW9A 2OZKA 2VPZA 3S17I 2GU2A 1ML8A 1ZH1A 1Q7Y2 3I561 1QVGZ 4E30A 1VQN1 1ZB8A 1VQLZ 1VQK1 1K9M2 4NFRA 2Q4ZA 2R7ZI 2NAPA 4HGYA 3VMIA 3S1QI 3S15I 1RQFA 1VQ9Z 3CCM1 3CCE1 3D9XA 1NJI2 1VQPZ 2VUMI 2M6NA 2HU9A 4NBHA 1S721 3CCQZ 1WCMI 5C4XI 3M4OI 2PMZA 4RVHA 5C44I 4RVDA 3CCUZ 1N8R2 3F3PC 1NP6A 3KIHA 1VQ81 4BY7I 4NB9A 1X0TA 2NVTI 3I4NI 1VQ6Z 2YADA 1KC82 1PFTA 2HF1A 4E2XA 2E2JI 4MXUA 1Z03A 4E2WA 3S2DI 2QKDA 1VQOZ 4DQYB 3D2LA 1YIJ1 4A3LI 3T4NB 2KPIA 1Q861 3I07A 2Y0SA 2R6MA 4HGZA 2K3RA 2NVXI 4NB8A 1K8A2 3M3YI 3CQZI 4RV9A 3VMGA 3CCLZ 2WB1A 2QREB 2G2KA 2DE7A 4XX2A 1VQ7Z 2JIMA 4A93I 3D6WA 2JR6A 1USPA 1YIT1 2PM9A 4A3GI 1Q822 1K83I 3CCRZ 4MD7A 4X6AI 1VQ4Z 3GTPI 3GCFA 3NFZA 1VQL1 2M48A 4A3EI 1W2BZ 1JJ2Z 3CCSZ 1WIIA 3CMAZ 3G71Z 3G4S1 1Q821 2B63I 3JAMf 1R9TI 3HOXI 1M901 3IX0A 2JIQA 4TNUA 3GTJI 1VQP1 1YJ9Z 1W2BY 3CC7Z 4A3FI 3EEDA 2JIPA 3CCQ1 4NBEA 3H0GI 2EGTA 3CCU1 1QVGY 2OTJZ 2WAQA 4A3CI 4MH4A 4A3II 5T64A 3CC41 3BG0B 1VQ61 1YI21 2OTL1 1YUAA 3ESWA 3CD6Z 3LUSA 3PO3I 2YU9I 3TE5B 4QTUA 2E9HA 3HKZA 5D1PA 2RIQA 1QF8A 2VPXA 2W04A 3KIFA 3G6EZ 2GTHA 4A3BI 2ZAEB 3FQQA 2VF1A 3J80b 3S16I 3GTOI 2IZ4A 3MONA 3CME1 4A3DI 3HOWI 4RS4A 3J81b 3CPWZ 1Q862 1JWHC 1KQSZ 4E2YA 5LL6f 2V8JA
chains in the Genus database with same CATH topology
1L1OC 3J80f 4NOZA 3CPWY 3J7A4 1LQLA 1KQSY 3S2HI 1M1K2 1ZB9A 3CCMZ 3J81f 5C3EI 4Y7NI 3CC21 5D1OB 1Q811 3HOVI 3CCR1 1S72Z 1YUKA 1VQ41 1M1K1 1VQM1 3CCJZ 1YJN1 3GTLI 3FKII 3RZDI 3GTMI 3CCS1 3CMA1 3H3VJ 5A2Qf 5IT9b 2QEX1 5T67A 3CC71 4S1TA 3MZLB 1K731 2QRDB 1M902 3I55Z 1TWFI 3JAMb 4Y52I 1RLYA 5IT9f 1I6HI 1TWCI 1Y1VI 2LFUA 3PO3S 1NUIA 2O4HA 1TWAI 1YIJZ 2OTJ1 2RPRA 2RHBA 5FLXb 2O53A 3CXCZ 1TWGI 4NH1C 1VQ91 1Z01A 2LIYA 3GTGI 1SFOI 3QWUA 2AKLA 1I3QI 1JJ2Y 2NVYI 1VQ5Z 3CD61 3I4MI 5FLXf 2PK7A 3Q87A 1RO4A 2JMOA 3S14I 2QRCB 2H85A 4RVGA 1YJWZ 4DGLA 4A3JI 1Y1WI 1USPB 2RT9A 3F3FC 3CCVZ 3S1NI 2E2II 1YITZ 2JA7I 2E2HI 1RNIA 3U50C 3NH4A 4A3MI 1X3ZA 4E32A 4BBRI 3MZKB 1QVFZ 2QR1B 3VMHA 1KRLA 1QVFY 5C4JI 2P28A 3G4SZ 1VQO1 3HOYI 1Q7Y1 1YHQZ 3GTMS 2QA4Z 4A3KI 3FQMA 1K9M1 3PO2I 1X3WA 3I56Z 5D1OA 3GTKI 2Q51A 2V8KA 2F4OA 4MD8A 5IP7I 3S1MI 2I3CA 1VQNZ 3GKQA 2OOXB 3CCL1 3CCJ1 1VQKZ 3EERA 1NJI1 1Q812 3S1RI 1TFIA 2F4MA 2IZ3A 3GTQI 1VQ71 3K7AI 1Y1VS 1VLAA 3CC4Z 3TDHB 2JA5I 2JA6I 1I50I 3CCEZ 4MRIA 1YI2Z 2OTLZ 1S7MA 4E33A 2GTIA 4MD9A 1N8R1 5T6BA 1QYPA 3I551 5A2Qb 3P5JB 2DE6A 4NBBA 3IFUA 2J6AA 2BJOA 2K5RA 3VTNA 1K732 3HOZI 3OW2Z 3NDIA 2W03A 1KC81 4AYBA 2QLVB 1TWHI 1VQ8Z 3G711 1DL6A 4BY1I 3IF8A 2JA8I 2RBLA 3OW2Y 2NVQI 4QTTA 4EWCA 1KD12 1YJ91 3VB9A 3CMEZ 2R93I 2JS4A 1VQ51 4MONA 4NBCA 1RO0A 1RO2A 2JNYA 5IP9I 4RVFA 5CM2M 4BBSI 1YJW1 2DE5A 1N2FA 4NBDA 4NBGA 1KD11 1K8A1 3CCV1 3NH5A 2OOYB 4CL1A 3CC2Z 3HOUI 3NH8A 4E2ZA 2V8IA 4BXXI 3CXCY 4HH4A 2P3YA 1VQMZ 3NDJA 5FLMI 1YJNZ 3BG1B 2R92I 1P9NA 4NBFA 5AN9F 1Z02A 3G6E1 2QEXZ 2KI7B 2JUBA 1YHQ1 4NBAA 3RZOI 4DK1A 2VUGA 4E31A 2QA41 1WW9A 2OZKA 3S17I 2GU2A 1ML8A 1ZH1A 1Q7Y2 3I561 1QVGZ 4E30A 1VQN1 1ZB8A 1VQLZ 1VQK1 1K9M2 4NFRA 2Q4ZA 2R7ZI 4HGYA 3VMIA 3S1QI 3S15I 1RQFA 1VQ9Z 3CCM1 3CCE1 3D9XA 1NJI2 1VQPZ 2VUMI 2M6NA 2HU9A 4NBHA 1S721 1WCMI 3CCQZ 5C4XI 3M4OI 2PMZA 4RVHA 5C44I 4RVDA 3CCUZ 1N8R2 3F3PC 1NP6A 3KIHA 1VQ81 4BY7I 4NB9A 1X0TA 2NVTI 3I4NI 1VQ6Z 2YADA 1KC82 1PFTA 2HF1A 4E2XA 2E2JI 4MXUA 1Z03A 4E2WA 3S2DI 2QKDA 1VQOZ 4DQYB 1YIJ1 4A3LI 3T4NB 2KPIA 1Q861 3I07A 2Y0SA 2R6MA 4HGZA 2K3RA 2NVXI 4NB8A 1K8A2 3M3YI 3CQZI 4RV9A 3VMGA 3CCLZ 2WB1A 2QREB 2G2KA 2DE7A 4XX2A 1VQ7Z 4A93I 3D6WA 2JR6A 1USPA 1YIT1 2PM9A 4A3GI 1Q822 1K83I 3CCRZ 4MD7A 4X6AI 1VQ4Z 3GTPI 3GCFA 3NFZA 1VQL1 2M48A 4A3EI 1W2BZ 1JJ2Z 3CCSZ 1WIIA 3CMAZ 3G71Z 3G4S1 1Q821 2B63I 3JAMf 1R9TI 3HOXI 1M901 3IX0A 4TNUA 3GTJI 1VQP1 1YJ9Z 1W2BY 3CC7Z 4A3FI 3EEDA 3CCQ1 4NBEA 3H0GI 2EGTA 3CCU1 1QVGY 2OTJZ 2WAQA 4A3CI 4MH4A 4A3II 5T64A 3CC41 3BG0B 1VQ61 1YI21 2OTL1 1YUAA 3ESWA 3CD6Z 3LUSA 3PO3I 2YU9I 3TE5B 4QTUA 2E9HA 3HKZA 5D1PA 2RIQA 1QF8A 2W04A 3KIFA 3G6EZ 2GTHA 4A3BI 2ZAEB 3FQQA 2VF1A 3J80b 3S16I 3GTOI 2IZ4A 3MONA 3CME1 4A3DI 3HOWI 4RS4A 3J81b 3CPWZ 1Q862 1JWHC 1KQSZ 4E2YA 5LL6f 2V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRC B;  3TDH B;  3TE5 B;  2OOX B;  2QRD B;  2QRE B;  2OOY B;  2QLV B;  2QR1 B;  3T4N B; 
#chains in the Genus database with same CATH topology
 1L1O C;  3J80 f;  4NOZ A;  3CPW Y;  3J7A 4;  1LQL A;  1KQS Y;  3S2H I;  1M1K 2;  1ZB9 A;  3CCM Z;  3J81 f;  5C3E I;  4Y7N I;  3CC2 1;  5D1O B;  1Q16 A;  1Q81 1;  3HOV I;  3CCR 1;  1S72 Z;  1YUK A;  1FDI A;  1VQ4 1;  1M1K 1;  1VQM 1;  3CCJ Z;  2E7Z A;  1YJN 1;  3GTL I;  3FKI I;  2V45 A;  3RZD I;  3GTM I;  3CCS 1;  3CMA 1;  3H3V J;  5A2Q f;  5IT9 b;  2QEX 1;  5T67 A;  3CC7 1;  4S1T A;  3MZL B;  1K73 1;  2QRD B;  1M90 2;  3I55 Z;  1TWF I;  3JAM b;  4Y52 I;  2JIO A;  1RLY A;  5IT9 f;  1I6H I;  1TWC I;  1Y1V I;  2LFU A;  3PO3 S;  1NUI A;  2O4H A;  1TWA I;  1YIJ Z;  2OTJ 1;  2RPR A;  2RHB A;  5FLX b;  2O53 A;  3CXC Z;  1TWG I;  4NH1 C;  1VQ9 1;  1Z01 A;  2LIY A;  3GTG I;  1SFO I;  3QWU A;  2AKL A;  1I3Q I;  1JJ2 Y;  2NVY I;  1VQ5 Z;  3CD6 1;  3I4M I;  5FLX f;  2PK7 A;  3Q87 A;  1RO4 A;  2JMO A;  3S14 I;  2QRC B;  2H85 A;  4RVG A;  1YJW Z;  4DGL A;  4A3J I;  1Y1W I;  1USP B;  2RT9 A;  3F3F C;  3CCV Z;  3S1N I;  2E2I I;  1YIT Z;  2JA7 I;  2E2H I;  1RNI A;  3U50 C;  3NH4 A;  4A3M I;  1X3Z A;  4E32 A;  4BBR I;  3MZK B;  1QVF Z;  2QR1 B;  3VMH A;  1KRL A;  1QVF Y;  5C4J I;  2P28 A;  1FDO A;  2VPW A;  3G4S Z;  1VQO 1;  3HOY I;  1Q7Y 1;  1YHQ Z;  2AYD A;  3GTM S;  2QA4 Z;  4A3K I;  3FQM A;  1K9M 1;  3PO2 I;  1X3W A;  3I56 Z;  5D1O A;  3GTK I;  2Q51 A;  2V8K A;  2F4O A;  4MD8 A;  5IP7 I;  3S1M I;  2I3C A;  1VQN Z;  3GKQ A;  2OOX B;  3CCL 1;  3CCJ 1;  1VQK Z;  3EER A;  1NJI 1;  1Q81 2;  3S1R I;  1TFI A;  2F4M A;  2IZ3 A;  3GTQ I;  1VQ7 1;  3K7A I;  1Y1V S;  1VLA A;  3CC4 Z;  3TDH B;  1WJ2 A;  1QXF A;  2JA5 I;  2JA6 I;  1I50 I;  3CCE Z;  2LEX A;  1WZN A;  4MRI A;  3IR7 A;  1YI2 Z;  2OTL Z;  1S7M A;  4E33 A;  2GTI A;  4MD9 A;  1N8R 1;  2JIR A;  5T6B A;  1QYP A;  3I55 1;  5A2Q b;  3P5J B;  1AA6 A;  2VPY A;  2DE6 A;  4NBB A;  3IFU A;  2J6A A;  2BJO A;  2K5R A;  3VTN A;  1K73 2;  3HOZ I;  1SIW A;  3OW2 Z;  3NDI A;  2W03 A;  1KC8 1;  4AYB A;  2QLV B;  1TWH I;  1VQ8 Z;  3G71 1;  1DL6 A;  4BY1 I;  3IF8 A;  2JA8 I;  2RBL A;  3OW2 Y;  2NVQ I;  4QTT A;  4EWC A;  1KD1 2;  1YJ9 1;  3VB9 A;  3CME Z;  2R93 I;  2JS4 A;  1VQ5 1;  4MON A;  4NBC A;  1RO0 A;  1RO2 A;  2JNY A;  5IP9 I;  4RVF A;  5CM2 M;  4BBS I;  2V3V A;  1YJW 1;  2DE5 A;  1N2F A;  4NBD A;  4NBG A;  1KD1 1;  1K8A 1;  3CCV 1;  3NH5 A;  2OOY B;  4CL1 A;  3CC2 Z;  3HOU I;  3NH8 A;  4E2Z A;  2V8I A;  4BXX I;  3CXC Y;  2IV2 X;  4HH4 A;  2P3Y A;  1VQM Z;  3NDJ A;  5FLM I;  1YJN Z;  3BG1 B;  1Y8C A;  2R92 I;  1P9N A;  4NBF A;  5AN9 F;  1Z02 A;  3G6E 1;  2QEX Z;  2KI7 B;  2JUB A;  1YHQ 1;  4NBA A;  3RZO I;  4DK1 A;  2VUG A;  4E31 A;  2QA4 1;  1WW9 A;  2OZK A;  2VPZ A;  3S17 I;  2GU2 A;  1ML8 A;  1ZH1 A;  1Q7Y 2;  3I56 1;  1QVG Z;  4E30 A;  1VQN 1;  1ZB8 A;  1VQL Z;  1VQK 1;  1K9M 2;  4NFR A;  2Q4Z A;  2R7Z I;  2NAP A;  4HGY A;  3VMI A;  3S1Q I;  3S15 I;  1RQF A;  1VQ9 Z;  3CCM 1;  3CCE 1;  3D9X A;  1NJI 2;  1VQP Z;  2VUM I;  2M6N A;  2HU9 A;  4NBH A;  1S72 1;  3CCQ Z;  1WCM I;  5C4X I;  3M4O I;  2PMZ A;  4RVH A;  5C44 I;  4RVD A;  3CCU Z;  1N8R 2;  3F3P C;  1NP6 A;  3KIH A;  1VQ8 1;  4BY7 I;  4NB9 A;  1X0T A;  2NVT I;  3I4N I;  1VQ6 Z;  2YAD A;  1KC8 2;  1PFT A;  2HF1 A;  4E2X A;  2E2J I;  4MXU A;  1Z03 A;  4E2W A;  3S2D I;  2QKD A;  1VQO Z;  4DQY B;  3D2L A;  1YIJ 1;  4A3L I;  3T4N B;  2KPI A;  1Q86 1;  3I07 A;  2Y0S A;  2R6M A;  4HGZ A;  2K3R A;  2NVX I;  4NB8 A;  1K8A 2;  3M3Y I;  3CQZ I;  4RV9 A;  3VMG A;  3CCL Z;  2WB1 A;  2QRE B;  2G2K A;  2DE7 A;  4XX2 A;  1VQ7 Z;  2JIM A;  4A93 I;  3D6W A;  2JR6 A;  1USP A;  1YIT 1;  2PM9 A;  4A3G I;  1Q82 2;  1K83 I;  3CCR Z;  4MD7 A;  4X6A I;  1VQ4 Z;  3GTP I;  3GCF A;  3NFZ A;  1VQL 1;  2M48 A;  4A3E I;  1W2B Z;  1JJ2 Z;  3CCS Z;  1WII A;  3CMA Z;  3G71 Z;  3G4S 1;  1Q82 1;  2B63 I;  3JAM f;  1R9T I;  3HOX I;  1M90 1;  3IX0 A;  2JIQ A;  4TNU A;  3GTJ I;  1VQP 1;  1YJ9 Z;  1W2B Y;  3CC7 Z;  4A3F I;  3EED A;  2JIP A;  3CCQ 1;  4NBE A;  3H0G I;  2EGT A;  3CCU 1;  1QVG Y;  2OTJ Z;  2WAQ A;  4A3C I;  4MH4 A;  4A3I I;  5T64 A;  3CC4 1;  3BG0 B;  1VQ6 1;  1YI2 1;  2OTL 1;  1YUA A;  3ESW A;  3CD6 Z;  3LUS A;  3PO3 I;  2YU9 I;  3TE5 B;  4QTU A;  2E9H A;  3HKZ A;  5D1P A;  2RIQ A;  1QF8 A;  2VPX A;  2W04 A;  3KIF A;  3G6E Z;  2GTH A;  4A3B I;  2ZAE B;  3FQQ A;  2VF1 A;  3J80 b;  3S16 I;  3GTO I;  2IZ4 A;  3MON A;  3CME 1;  4A3D I;  3HOW I;  4RS4 A;  3J81 b;  3CPW Z;  1Q86 2;  1JWH C;  1KQS Z;  4E2Y A;  5LL6 f;  2V8J A; 
#chains in the Genus database with same CATH homology
 1L1O C;  3J80 f;  4NOZ A;  3CPW Y;  3J7A 4;  1LQL A;  1KQS Y;  3S2H I;  1M1K 2;  1ZB9 A;  3CCM Z;  3J81 f;  5C3E I;  4Y7N I;  3CC2 1;  5D1O B;  1Q81 1;  3HOV I;  3CCR 1;  1S72 Z;  1YUK A;  1VQ4 1;  1M1K 1;  1VQM 1;  3CCJ Z;  1YJN 1;  3GTL I;  3FKI I;  3RZD I;  3GTM I;  3CCS 1;  3CMA 1;  3H3V J;  5A2Q f;  5IT9 b;  2QEX 1;  5T67 A;  3CC7 1;  4S1T A;  3MZL B;  1K73 1;  2QRD B;  1M90 2;  3I55 Z;  1TWF I;  3JAM b;  4Y52 I;  1RLY A;  5IT9 f;  1I6H I;  1TWC I;  1Y1V I;  2LFU A;  3PO3 S;  1NUI A;  2O4H A;  1TWA I;  1YIJ Z;  2OTJ 1;  2RPR A;  2RHB A;  5FLX b;  2O53 A;  3CXC Z;  1TWG I;  4NH1 C;  1VQ9 1;  1Z01 A;  2LIY A;  3GTG I;  1SFO I;  3QWU A;  2AKL A;  1I3Q I;  1JJ2 Y;  2NVY I;  1VQ5 Z;  3CD6 1;  3I4M I;  5FLX f;  2PK7 A;  3Q87 A;  1RO4 A;  2JMO A;  3S14 I;  2QRC B;  2H85 A;  4RVG A;  1YJW Z;  4DGL A;  4A3J I;  1Y1W I;  1USP B;  2RT9 A;  3F3F C;  3CCV Z;  3S1N I;  2E2I I;  1YIT Z;  2JA7 I;  2E2H I;  1RNI A;  3U50 C;  3NH4 A;  4A3M I;  1X3Z A;  4E32 A;  4BBR I;  3MZK B;  1QVF Z;  2QR1 B;  3VMH A;  1KRL A;  1QVF Y;  5C4J I;  2P28 A;  3G4S Z;  1VQO 1;  3HOY I;  1Q7Y 1;  1YHQ Z;  3GTM S;  2QA4 Z;  4A3K I;  3FQM A;  1K9M 1;  3PO2 I;  1X3W A;  3I56 Z;  5D1O A;  3GTK I;  2Q51 A;  2V8K A;  2F4O A;  4MD8 A;  5IP7 I;  3S1M I;  2I3C A;  1VQN Z;  3GKQ A;  2OOX B;  3CCL 1;  3CCJ 1;  1VQK Z;  3EER A;  1NJI 1;  1Q81 2;  3S1R I;  1TFI A;  2F4M A;  2IZ3 A;  3GTQ I;  1VQ7 1;  3K7A I;  1Y1V S;  1VLA A;  3CC4 Z;  3TDH B;  2JA5 I;  2JA6 I;  1I50 I;  3CCE Z;  4MRI A;  1YI2 Z;  2OTL Z;  1S7M A;  4E33 A;  2GTI A;  4MD9 A;  1N8R 1;  5T6B A;  1QYP A;  3I55 1;  5A2Q b;  3P5J B;  2DE6 A;  4NBB A;  3IFU A;  2J6A A;  2BJO A;  2K5R A;  3VTN A;  1K73 2;  3HOZ I;  3OW2 Z;  3NDI A;  2W03 A;  1KC8 1;  4AYB A;  2QLV B;  1TWH I;  1VQ8 Z;  3G71 1;  1DL6 A;  4BY1 I;  3IF8 A;  2JA8 I;  2RBL A;  3OW2 Y;  2NVQ I;  4QTT A;  4EWC A;  1KD1 2;  1YJ9 1;  3VB9 A;  3CME Z;  2R93 I;  2JS4 A;  1VQ5 1;  4MON A;  4NBC A;  1RO0 A;  1RO2 A;  2JNY A;  5IP9 I;  4RVF A;  5CM2 M;  4BBS I;  1YJW 1;  2DE5 A;  1N2F A;  4NBD A;  4NBG A;  1KD1 1;  1K8A 1;  3CCV 1;  3NH5 A;  2OOY B;  4CL1 A;  3CC2 Z;  3HOU I;  3NH8 A;  4E2Z A;  2V8I A;  4BXX I;  3CXC Y;  4HH4 A;  2P3Y A;  1VQM Z;  3NDJ A;  5FLM I;  1YJN Z;  3BG1 B;  2R92 I;  1P9N A;  4NBF A;  5AN9 F;  1Z02 A;  3G6E 1;  2QEX Z;  2KI7 B;  2JUB A;  1YHQ 1;  4NBA A;  3RZO I;  4DK1 A;  2VUG A;  4E31 A;  2QA4 1;  1WW9 A;  2OZK A;  3S17 I;  2GU2 A;  1ML8 A;  1ZH1 A;  1Q7Y 2;  3I56 1;  1QVG Z;  4E30 A;  1VQN 1;  1ZB8 A;  1VQL Z;  1VQK 1;  1K9M 2;  4NFR A;  2Q4Z A;  2R7Z I;  4HGY A;  3VMI A;  3S1Q I;  3S15 I;  1RQF A;  1VQ9 Z;  3CCM 1;  3CCE 1;  3D9X A;  1NJI 2;  1VQP Z;  2VUM I;  2M6N A;  2HU9 A;  4NBH A;  1S72 1;  1WCM I;  3CCQ Z;  5C4X I;  3M4O I;  2PMZ A;  4RVH A;  5C44 I;  4RVD A;  3CCU Z;  1N8R 2;  3F3P C;  1NP6 A;  3KIH A;  1VQ8 1;  4BY7 I;  4NB9 A;  1X0T A;  2NVT I;  3I4N I;  1VQ6 Z;  2YAD A;  1KC8 2;  1PFT A;  2HF1 A;  4E2X A;  2E2J I;  4MXU A;  1Z03 A;  4E2W A;  3S2D I;  2QKD A;  1VQO Z;  4DQY B;  1YIJ 1;  4A3L I;  3T4N B;  2KPI A;  1Q86 1;  3I07 A;  2Y0S A;  2R6M A;  4HGZ A;  2K3R A;  2NVX I;  4NB8 A;  1K8A 2;  3M3Y I;  3CQZ I;  4RV9 A;  3VMG A;  3CCL Z;  2WB1 A;  2QRE B;  2G2K A;  2DE7 A;  4XX2 A;  1VQ7 Z;  4A93 I;  3D6W A;  2JR6 A;  1USP A;  1YIT 1;  2PM9 A;  4A3G I;  1Q82 2;  1K83 I;  3CCR Z;  4MD7 A;  4X6A I;  1VQ4 Z;  3GTP I;  3GCF A;  3NFZ A;  1VQL 1;  2M48 A;  4A3E I;  1W2B Z;  1JJ2 Z;  3CCS Z;  1WII A;  3CMA Z;  3G71 Z;  3G4S 1;  1Q82 1;  2B63 I;  3JAM f;  1R9T I;  3HOX I;  1M90 1;  3IX0 A;  4TNU A;  3GTJ I;  1VQP 1;  1YJ9 Z;  1W2B Y;  3CC7 Z;  4A3F I;  3EED A;  3CCQ 1;  4NBE A;  3H0G I;  2EGT A;  3CCU 1;  1QVG Y;  2OTJ Z;  2WAQ A;  4A3C I;  4MH4 A;  4A3I I;  5T64 A;  3CC4 1;  3BG0 B;  1VQ6 1;  1YI2 1;  2OTL 1;  1YUA A;  3ESW A;  3CD6 Z;  3LUS A;  3PO3 I;  2YU9 I;  3TE5 B;  4QTU A;  2E9H A;  3HKZ A;  5D1P A;  2RIQ A;  1QF8 A;  2W04 A;  3KIF A;  3G6E Z;  2GTH A;  4A3B I;  2ZAE B;  3FQQ A;  2VF1 A;  3J80 b;  3S16 I;  3GTO I;  2IZ4 A;  3MON A;  3CME 1;  4A3D I;  3HOW I;  4RS4 A;  3J81 b;  3CPW Z;  1Q86 2;  1JWH C;  1KQS Z;  4E2Y A;  5LL6 f;  2V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...