3TDHB

Structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Carbon catabolite-derepressing protein kinase
total genus 16
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3tdhB01
2QR1B 2QRCB 2QRDB 3TE5B 3T4NB 3TDHB 2QLVB 2QREB 2OOYB 2OOXB
chains in the Genus database with same CATH superfamily
1X3WA 3I561 2I3CA 4NH1C 5IP9I 3HOUI 4QTTA 2IV2X 2JIOA 1YIT1 1TWCI 4NBAA 3CC7Z 3I4MI 2VPXA 2Q51A 2V3VA 2E2JI 1NP6A 2GTIA 5T6BA 3IFUA 1QF8A 3JAMf 2NVTI 1VQ81 1S7MA 5CM2M 1Y1WI 4E30A 2VUGA 3T4NB 3KIHA 3LUSA 2RPRA 1YITZ 3OW2Y 3CC2Z 2VPWA 1K9M2 3GTJI 3NH4A 2OOYB 3CCV1 4NOZA 2QA41 3HOWI 2IZ3A 2QEX1 4NBFA 2OTJZ 2KPIA 5D1PA 1VQM1 3NDIA 3GCFA 3G71Z 3CCRZ 1JJ2Y 2R93I 4NBDA 3S16I 2LIYA 3CC21 3CC41 1S721 1YJW1 4DQYB 4A3DI 1W2BY 1L1OC 3CCMZ 3I4NI 1VQOZ 2OZKA 3CMAZ 1YIJ1 2KI7B 4MH4A 3IF8A 4NBBA 2JNYA 2YADA 3I07A 1KRLA 1VQ41 1N8R2 2QLVB 3CCR1 1AA6A 1I6HI 2K5RA 1VQ71 1DL6A 4HH4A 1ZB9A 2NVQI 2E2HI 2W03A 1YJWZ 1YJNZ 5IT9f 5C4XI 1RLYA 1X0TA 4BBSI 2PM9A 1WZNA 2W04A 1YIJZ 1TWHI 4A3GI 2RT9A 1Q811 3J81b 3S2DI 2JIMA 3CD61 1VQ4Z 4NBEA 3VB9A 1WIIA 1Y1VS 4NB9A 4E2ZA 3VMGA 4S1TA 2VPYA 3BG1B 5FLXf 3M3YI 1WCMI 1K9M1 3CXCZ 3CPWZ 1VQNZ 3NDJA 3HOYI 1LQLA 3CMEZ 1VQ91 4MXUA 3G6E1 3J81f 1Z03A 3CCS1 1RO0A 4NBHA 4A93I 1TWFI 2QRCB 1QVGZ 2VUMI 3FKII 1YUKA 2V8JA 1JJ2Z 3ESWA 3PO3I 3G4S1 2V45A 1VQO1 1VQKZ 3S1MI 1VQN1 1W2BZ 3S1NI 2RIQA 3S1QI 3HOVI 1VQ7Z 4MD7A 1VQL1 3M4OI 5LL6f 2E7ZA 1Y1VI 4RV9A 3H0GI 3GTKI 2JA5I 2P28A 1I3QI 3CCUZ 3CCE1 2F4MA 4RVGA 2P3YA 3CXCY 3S17I 2QA4Z 3IR7A 2YU9I 4NBGA 3TE5B 2R7ZI 4AYBA 1KQSY 1VQ61 3Q87A 3CCSZ 1VQMZ 3D2LA 1YJ9Z 3FQMA 3CC71 4A3II 1WJ2A 4RVFA 1Z02A 1QVGY 1ZB8A 4DK1A 2JIQA 3G4SZ 4A3BI 1TFIA 1VQK1 4A3EI 3MZLB 3I55Z 2Y0SA 1VQ6Z 1SIWA 5IT9b 1QVFZ 3CCL1 2JS4A 1K732 2V8KA 3K7AI 2GU2A 5FLMI 1VQ51 1KC81 1N8R1 1RO2A 3GTMS 2JUBA 2AYDA 2QREB 2E9HA 2O53A 2RHBA 3EEDA 2O4HA 1YI2Z 2VPZA 1SFOI 1YUAA 2NVXI 3H3VJ 3CD6Z 1JWHC 3CCLZ 3GTLI 2PK7A 2PMZA 1Q16A 3HOZI 1K8A2 2H85A 2JA7I 3CMA1 1Q822 4CL1A 1TWGI 5A2Qf 2EGTA 2JIRA 1Q861 5IP7I 2QRDB 3BG0B 1YJ91 2OTLZ 2HF1A 2BJOA 1KD12 3S14I 2K3RA 4BBRI 3CCQ1 5FLXb 1RNIA 1VQP1 5AN9F 3OW2Z 1YHQZ 1R9TI 1RQFA 3FQQA 4NB8A 1Q862 4RVDA 2NAPA 2QR1B 3MZKB 2HU9A 2Q4ZA 1KQSZ 2E2II 1M901 1QVFY 2R6MA 1K8A1 3J80f 1VQLZ 3CME1 1Z01A 1VQPZ 3G6EZ 3HKZA 3KIFA 2DE6A 1YI21 4MD8A 5D1OA 5T64A 1Q7Y1 3PO2I 4BXXI 3RZDI 3CCU1 1ZH1A 3VMIA 4E32A 3CCEZ 4Y7NI 3GTPI 2M48A 3MONA 2QEXZ 4A3MI 2OTJ1 1K83I 2G2KA 3I56Z 1KC82 2QKDA 3RZOI 3CPWY 2ZAEB 4E31A 1PFTA 1USPA 2OTL1 2M6NA 4HGZA 1Q812 2RBLA 3CC4Z 3GKQA 3CCQZ 1S72Z 1NJI2 3D6WA 3VTNA 2WB1A 3J7A4 3J80b 4NFRA 3F3PC 1YHQ1 4E2XA 3GTOI 3I551 1Q821 3S2HI 4BY1I 2DE5A 4E2YA 3CCVZ 4E2WA 1X3ZA 4NBCA 3QWUA 2IZ4A 3IX0A 4BY7I 4A3FI 1FDIA 3NH5A 2R92I 5D1OB 3HOXI 2NVYI 1NJI1 2GTHA 2DE7A 3F3FC 2V8IA 2JIPA 4DGLA 2LFUA 2VF1A 2JR6A 1M1K1 3D9XA 1I50I 5A2Qb 3CCM1 4RVHA 4Y52I 4A3JI 4A3LI 1USPB 1VQ9Z 3GTGI 4MD9A 1NUIA 2JA6I 4MRIA 1KD11 3EERA 2J6AA 3CQZI 5T67A 4XX2A 1VQ5Z 2B63I 3CCJ1 1P9NA 1N2FA 1YJN1 2F4OA 3NH8A 4MONA 3VMHA 5C4JI 1VQ8Z 2LEXA 3U50C 4HGYA 4A3KI 1K731 1M902 1TWAI 1QYPA 5C3EI 2WAQA 3S15I 2AKLA 3PO3S 3CCJZ 4A3CI 1FDOA 3JAMb 4RS4A 1WW9A 4EWCA 2OOXB 1M1K2 4X6AI 4E33A 1QXFA 3G711 2JMOA 1VLAA 5C44I 3NFZA 1RO4A 3S1RI 2JA8I 1Q7Y2 3GTMI 3GTQI 1Y8CA 4QTUA 1ML8A 4TNUA 3TDHB 3P5JB
chains in the Genus database with same CATH topology
1X3WA 3I561 2I3CA 4NH1C 5IP9I 3HOUI 4QTTA 1YIT1 1TWCI 4NBAA 3CC7Z 3I4MI 2Q51A 2E2JI 1NP6A 2GTIA 5T6BA 3IFUA 1QF8A 3JAMf 2NVTI 1VQ81 1S7MA 5CM2M 1Y1WI 4E30A 2VUGA 3T4NB 3KIHA 3LUSA 2RPRA 1YITZ 3OW2Y 3CC2Z 1K9M2 3GTJI 3NH4A 2OOYB 3CCV1 4NOZA 2QA41 3HOWI 2IZ3A 2QEX1 4NBFA 2OTJZ 2KPIA 5D1PA 1VQM1 3NDIA 3GCFA 3G71Z 3CCRZ 1JJ2Y 2R93I 4NBDA 3S16I 2LIYA 3CC21 3CC41 1S721 1YJW1 4DQYB 4A3DI 1W2BY 1L1OC 3CCMZ 3I4NI 1VQOZ 2OZKA 3CMAZ 1YIJ1 2KI7B 4MH4A 3IF8A 4NBBA 2JNYA 2YADA 3I07A 1KRLA 1VQ41 1N8R2 2QLVB 3CCR1 1I6HI 2K5RA 1VQ71 1DL6A 4HH4A 1ZB9A 2NVQI 2E2HI 2W03A 1YJWZ 1YJNZ 5IT9f 5C4XI 1RLYA 1X0TA 4BBSI 2PM9A 2W04A 1YIJZ 4A3GI 1TWHI 2RT9A 1Q811 3J81b 3S2DI 3CD61 1VQ4Z 4NBEA 3VB9A 1WIIA 1Y1VS 4NB9A 4E2ZA 3VMGA 4S1TA 3BG1B 5FLXf 3M3YI 1WCMI 1K9M1 3CXCZ 3CPWZ 1VQNZ 3NDJA 3HOYI 1LQLA 3CMEZ 1VQ91 4MXUA 3G6E1 3J81f 1Z03A 3CCS1 1RO0A 4NBHA 4A93I 1TWFI 2QRCB 1QVGZ 2VUMI 3FKII 1YUKA 2V8JA 1JJ2Z 3ESWA 3PO3I 3G4S1 1VQO1 1VQKZ 3S1MI 1VQN1 1W2BZ 3S1NI 2RIQA 3S1QI 3HOVI 1VQ7Z 4MD7A 1VQL1 3M4OI 5LL6f 1Y1VI 4RV9A 3H0GI 3GTKI 2JA5I 2P28A 1I3QI 3CCUZ 3CCE1 2F4MA 4RVGA 2P3YA 3CXCY 3S17I 2QA4Z 2YU9I 4NBGA 3TE5B 2R7ZI 4AYBA 1KQSY 1VQ61 3Q87A 3CCSZ 1VQMZ 1YJ9Z 3FQMA 3CC71 4A3II 4RVFA 1Z02A 1QVGY 1ZB8A 4DK1A 3G4SZ 4A3BI 1TFIA 1VQK1 4A3EI 3MZLB 3I55Z 2Y0SA 1VQ6Z 5IT9b 1QVFZ 3CCL1 2JS4A 1K732 2V8KA 3K7AI 2GU2A 5FLMI 1VQ51 1KC81 1N8R1 1RO2A 3GTMS 2JUBA 2QREB 2E9HA 2O53A 2RHBA 3EEDA 2O4HA 1YI2Z 1SFOI 1YUAA 2NVXI 3H3VJ 3CD6Z 1JWHC 3CCLZ 3GTLI 2PK7A 2PMZA 3HOZI 1K8A2 2H85A 2JA7I 3CMA1 1Q822 4CL1A 1TWGI 5A2Qf 2EGTA 1Q861 5IP7I 2QRDB 3BG0B 1YJ91 2OTLZ 2HF1A 2BJOA 1KD12 3S14I 2K3RA 4BBRI 3CCQ1 5FLXb 1RNIA 1VQP1 5AN9F 3OW2Z 1YHQZ 1R9TI 1RQFA 3FQQA 4NB8A 1Q862 4RVDA 2QR1B 3MZKB 2HU9A 2Q4ZA 1KQSZ 2E2II 1M901 1QVFY 2R6MA 1K8A1 3J80f 1VQLZ 3CME1 1Z01A 1VQPZ 3G6EZ 3HKZA 3KIFA 2DE6A 1YI21 4MD8A 5D1OA 5T64A 1Q7Y1 3PO2I 4BXXI 3RZDI 3CCU1 1ZH1A 3VMIA 4E32A 3CCEZ 4Y7NI 3GTPI 2M48A 3MONA 2QEXZ 4A3MI 2OTJ1 1K83I 2G2KA 3I56Z 1KC82 2QKDA 3RZOI 3CPWY 2ZAEB 4E31A 1PFTA 1USPA 2OTL1 2M6NA 4HGZA 1Q812 2RBLA 3CC4Z 1S72Z 3GKQA 3CCQZ 1NJI2 3D6WA 3VTNA 2WB1A 3J7A4 3J80b 4NFRA 3F3PC 1YHQ1 4E2XA 3GTOI 3I551 1Q821 3S2HI 4BY1I 2DE5A 4E2YA 3CCVZ 4E2WA 1X3ZA 4NBCA 3QWUA 2IZ4A 3IX0A 4BY7I 4A3FI 3NH5A 2R92I 5D1OB 3HOXI 2NVYI 1NJI1 2GTHA 2DE7A 3F3FC 2V8IA 4DGLA 2LFUA 2VF1A 2JR6A 1M1K1 3D9XA 1I50I 5A2Qb 3CCM1 4RVHA 4Y52I 4A3JI 4A3LI 1USPB 1VQ9Z 3GTGI 4MD9A 1NUIA 2JA6I 4MRIA 1KD11 3EERA 2J6AA 3CQZI 5T67A 4XX2A 1VQ5Z 2B63I 3CCJ1 1P9NA 1N2FA 1YJN1 2F4OA 3NH8A 4MONA 3VMHA 5C4JI 1VQ8Z 3U50C 4HGYA 4A3KI 1K731 1M902 1TWAI 1QYPA 5C3EI 2WAQA 3S15I 2AKLA 3PO3S 3CCJZ 4A3CI 3JAMb 4RS4A 1WW9A 4EWCA 2OOXB 1M1K2 4X6AI 4E33A 3G711 2JMOA 1VLAA 5C44I 3NFZA 1RO4A 3S1RI 2JA8I 1Q7Y2 3GTMI 3GTQI 4QTUA 1ML8A 4TNUA 3TDHB 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QR1 B;  2QRC B;  2QRD B;  3TE5 B;  3T4N B;  3TDH B;  2QLV B;  2QRE B;  2OOY B;  2OOX B; 
#chains in the Genus database with same CATH topology
 1X3W A;  3I56 1;  2I3C A;  4NH1 C;  5IP9 I;  3HOU I;  4QTT A;  2IV2 X;  2JIO A;  1YIT 1;  1TWC I;  4NBA A;  3CC7 Z;  3I4M I;  2VPX A;  2Q51 A;  2V3V A;  2E2J I;  1NP6 A;  2GTI A;  5T6B A;  3IFU A;  1QF8 A;  3JAM f;  2NVT I;  1VQ8 1;  1S7M A;  5CM2 M;  1Y1W I;  4E30 A;  2VUG A;  3T4N B;  3KIH A;  3LUS A;  2RPR A;  1YIT Z;  3OW2 Y;  3CC2 Z;  2VPW A;  1K9M 2;  3GTJ I;  3NH4 A;  2OOY B;  3CCV 1;  4NOZ A;  2QA4 1;  3HOW I;  2IZ3 A;  2QEX 1;  4NBF A;  2OTJ Z;  2KPI A;  5D1P A;  1VQM 1;  3NDI A;  3GCF A;  3G71 Z;  3CCR Z;  1JJ2 Y;  2R93 I;  4NBD A;  3S16 I;  2LIY A;  3CC2 1;  3CC4 1;  1S72 1;  1YJW 1;  4DQY B;  4A3D I;  1W2B Y;  1L1O C;  3CCM Z;  3I4N I;  1VQO Z;  2OZK A;  3CMA Z;  1YIJ 1;  2KI7 B;  4MH4 A;  3IF8 A;  4NBB A;  2JNY A;  2YAD A;  3I07 A;  1KRL A;  1VQ4 1;  1N8R 2;  2QLV B;  3CCR 1;  1AA6 A;  1I6H I;  2K5R A;  1VQ7 1;  1DL6 A;  4HH4 A;  1ZB9 A;  2NVQ I;  2E2H I;  2W03 A;  1YJW Z;  1YJN Z;  5IT9 f;  5C4X I;  1RLY A;  1X0T A;  4BBS I;  2PM9 A;  1WZN A;  2W04 A;  1YIJ Z;  1TWH I;  4A3G I;  2RT9 A;  1Q81 1;  3J81 b;  3S2D I;  2JIM A;  3CD6 1;  1VQ4 Z;  4NBE A;  3VB9 A;  1WII A;  1Y1V S;  4NB9 A;  4E2Z A;  3VMG A;  4S1T A;  2VPY A;  3BG1 B;  5FLX f;  3M3Y I;  1WCM I;  1K9M 1;  3CXC Z;  3CPW Z;  1VQN Z;  3NDJ A;  3HOY I;  1LQL A;  3CME Z;  1VQ9 1;  4MXU A;  3G6E 1;  3J81 f;  1Z03 A;  3CCS 1;  1RO0 A;  4NBH A;  4A93 I;  1TWF I;  2QRC B;  1QVG Z;  2VUM I;  3FKI I;  1YUK A;  2V8J A;  1JJ2 Z;  3ESW A;  3PO3 I;  3G4S 1;  2V45 A;  1VQO 1;  1VQK Z;  3S1M I;  1VQN 1;  1W2B Z;  3S1N I;  2RIQ A;  3S1Q I;  3HOV I;  1VQ7 Z;  4MD7 A;  1VQL 1;  3M4O I;  5LL6 f;  2E7Z A;  1Y1V I;  4RV9 A;  3H0G I;  3GTK I;  2JA5 I;  2P28 A;  1I3Q I;  3CCU Z;  3CCE 1;  2F4M A;  4RVG A;  2P3Y A;  3CXC Y;  3S17 I;  2QA4 Z;  3IR7 A;  2YU9 I;  4NBG A;  3TE5 B;  2R7Z I;  4AYB A;  1KQS Y;  1VQ6 1;  3Q87 A;  3CCS Z;  1VQM Z;  3D2L A;  1YJ9 Z;  3FQM A;  3CC7 1;  4A3I I;  1WJ2 A;  4RVF A;  1Z02 A;  1QVG Y;  1ZB8 A;  4DK1 A;  2JIQ A;  3G4S Z;  4A3B I;  1TFI A;  1VQK 1;  4A3E I;  3MZL B;  3I55 Z;  2Y0S A;  1VQ6 Z;  1SIW A;  5IT9 b;  1QVF Z;  3CCL 1;  2JS4 A;  1K73 2;  2V8K A;  3K7A I;  2GU2 A;  5FLM I;  1VQ5 1;  1KC8 1;  1N8R 1;  1RO2 A;  3GTM S;  2JUB A;  2AYD A;  2QRE B;  2E9H A;  2O53 A;  2RHB A;  3EED A;  2O4H A;  1YI2 Z;  2VPZ A;  1SFO I;  1YUA A;  2NVX I;  3H3V J;  3CD6 Z;  1JWH C;  3CCL Z;  3GTL I;  2PK7 A;  2PMZ A;  1Q16 A;  3HOZ I;  1K8A 2;  2H85 A;  2JA7 I;  3CMA 1;  1Q82 2;  4CL1 A;  1TWG I;  5A2Q f;  2EGT A;  2JIR A;  1Q86 1;  5IP7 I;  2QRD B;  3BG0 B;  1YJ9 1;  2OTL Z;  2HF1 A;  2BJO A;  1KD1 2;  3S14 I;  2K3R A;  4BBR I;  3CCQ 1;  5FLX b;  1RNI A;  1VQP 1;  5AN9 F;  3OW2 Z;  1YHQ Z;  1R9T I;  1RQF A;  3FQQ A;  4NB8 A;  1Q86 2;  4RVD A;  2NAP A;  2QR1 B;  3MZK B;  2HU9 A;  2Q4Z A;  1KQS Z;  2E2I I;  1M90 1;  1QVF Y;  2R6M A;  1K8A 1;  3J80 f;  1VQL Z;  3CME 1;  1Z01 A;  1VQP Z;  3G6E Z;  3HKZ A;  3KIF A;  2DE6 A;  1YI2 1;  4MD8 A;  5D1O A;  5T64 A;  1Q7Y 1;  3PO2 I;  4BXX I;  3RZD I;  3CCU 1;  1ZH1 A;  3VMI A;  4E32 A;  3CCE Z;  4Y7N I;  3GTP I;  2M48 A;  3MON A;  2QEX Z;  4A3M I;  2OTJ 1;  1K83 I;  2G2K A;  3I56 Z;  1KC8 2;  2QKD A;  3RZO I;  3CPW Y;  2ZAE B;  4E31 A;  1PFT A;  1USP A;  2OTL 1;  2M6N A;  4HGZ A;  1Q81 2;  2RBL A;  3CC4 Z;  3GKQ A;  3CCQ Z;  1S72 Z;  1NJI 2;  3D6W A;  3VTN A;  2WB1 A;  3J7A 4;  3J80 b;  4NFR A;  3F3P C;  1YHQ 1;  4E2X A;  3GTO I;  3I55 1;  1Q82 1;  3S2H I;  4BY1 I;  2DE5 A;  4E2Y A;  3CCV Z;  4E2W A;  1X3Z A;  4NBC A;  3QWU A;  2IZ4 A;  3IX0 A;  4BY7 I;  4A3F I;  1FDI A;  3NH5 A;  2R92 I;  5D1O B;  3HOX I;  2NVY I;  1NJI 1;  2GTH A;  2DE7 A;  3F3F C;  2V8I A;  2JIP A;  4DGL A;  2LFU A;  2VF1 A;  2JR6 A;  1M1K 1;  3D9X A;  1I50 I;  5A2Q b;  3CCM 1;  4RVH A;  4Y52 I;  4A3J I;  4A3L I;  1USP B;  1VQ9 Z;  3GTG I;  4MD9 A;  1NUI A;  2JA6 I;  4MRI A;  1KD1 1;  3EER A;  2J6A A;  3CQZ I;  5T67 A;  4XX2 A;  1VQ5 Z;  2B63 I;  3CCJ 1;  1P9N A;  1N2F A;  1YJN 1;  2F4O A;  3NH8 A;  4MON A;  3VMH A;  5C4J I;  1VQ8 Z;  2LEX A;  3U50 C;  4HGY A;  4A3K I;  1K73 1;  1M90 2;  1TWA I;  1QYP A;  5C3E I;  2WAQ A;  3S15 I;  2AKL A;  3PO3 S;  3CCJ Z;  4A3C I;  1FDO A;  3JAM b;  4RS4 A;  1WW9 A;  4EWC A;  2OOX B;  1M1K 2;  4X6A I;  4E33 A;  1QXF A;  3G71 1;  2JMO A;  1VLA A;  5C44 I;  3NFZ A;  1RO4 A;  3S1R I;  2JA8 I;  1Q7Y 2;  3GTM I;  3GTQ I;  1Y8C A;  4QTU A;  1ML8 A;  4TNU A;  3TDH B;  3P5J B; 
#chains in the Genus database with same CATH homology
 1X3W A;  3I56 1;  2I3C A;  4NH1 C;  5IP9 I;  3HOU I;  4QTT A;  1YIT 1;  1TWC I;  4NBA A;  3CC7 Z;  3I4M I;  2Q51 A;  2E2J I;  1NP6 A;  2GTI A;  5T6B A;  3IFU A;  1QF8 A;  3JAM f;  2NVT I;  1VQ8 1;  1S7M A;  5CM2 M;  1Y1W I;  4E30 A;  2VUG A;  3T4N B;  3KIH A;  3LUS A;  2RPR A;  1YIT Z;  3OW2 Y;  3CC2 Z;  1K9M 2;  3GTJ I;  3NH4 A;  2OOY B;  3CCV 1;  4NOZ A;  2QA4 1;  3HOW I;  2IZ3 A;  2QEX 1;  4NBF A;  2OTJ Z;  2KPI A;  5D1P A;  1VQM 1;  3NDI A;  3GCF A;  3G71 Z;  3CCR Z;  1JJ2 Y;  2R93 I;  4NBD A;  3S16 I;  2LIY A;  3CC2 1;  3CC4 1;  1S72 1;  1YJW 1;  4DQY B;  4A3D I;  1W2B Y;  1L1O C;  3CCM Z;  3I4N I;  1VQO Z;  2OZK A;  3CMA Z;  1YIJ 1;  2KI7 B;  4MH4 A;  3IF8 A;  4NBB A;  2JNY A;  2YAD A;  3I07 A;  1KRL A;  1VQ4 1;  1N8R 2;  2QLV B;  3CCR 1;  1I6H I;  2K5R A;  1VQ7 1;  1DL6 A;  4HH4 A;  1ZB9 A;  2NVQ I;  2E2H I;  2W03 A;  1YJW Z;  1YJN Z;  5IT9 f;  5C4X I;  1RLY A;  1X0T A;  4BBS I;  2PM9 A;  2W04 A;  1YIJ Z;  4A3G I;  1TWH I;  2RT9 A;  1Q81 1;  3J81 b;  3S2D I;  3CD6 1;  1VQ4 Z;  4NBE A;  3VB9 A;  1WII A;  1Y1V S;  4NB9 A;  4E2Z A;  3VMG A;  4S1T A;  3BG1 B;  5FLX f;  3M3Y I;  1WCM I;  1K9M 1;  3CXC Z;  3CPW Z;  1VQN Z;  3NDJ A;  3HOY I;  1LQL A;  3CME Z;  1VQ9 1;  4MXU A;  3G6E 1;  3J81 f;  1Z03 A;  3CCS 1;  1RO0 A;  4NBH A;  4A93 I;  1TWF I;  2QRC B;  1QVG Z;  2VUM I;  3FKI I;  1YUK A;  2V8J A;  1JJ2 Z;  3ESW A;  3PO3 I;  3G4S 1;  1VQO 1;  1VQK Z;  3S1M I;  1VQN 1;  1W2B Z;  3S1N I;  2RIQ A;  3S1Q I;  3HOV I;  1VQ7 Z;  4MD7 A;  1VQL 1;  3M4O I;  5LL6 f;  1Y1V I;  4RV9 A;  3H0G I;  3GTK I;  2JA5 I;  2P28 A;  1I3Q I;  3CCU Z;  3CCE 1;  2F4M A;  4RVG A;  2P3Y A;  3CXC Y;  3S17 I;  2QA4 Z;  2YU9 I;  4NBG A;  3TE5 B;  2R7Z I;  4AYB A;  1KQS Y;  1VQ6 1;  3Q87 A;  3CCS Z;  1VQM Z;  1YJ9 Z;  3FQM A;  3CC7 1;  4A3I I;  4RVF A;  1Z02 A;  1QVG Y;  1ZB8 A;  4DK1 A;  3G4S Z;  4A3B I;  1TFI A;  1VQK 1;  4A3E I;  3MZL B;  3I55 Z;  2Y0S A;  1VQ6 Z;  5IT9 b;  1QVF Z;  3CCL 1;  2JS4 A;  1K73 2;  2V8K A;  3K7A I;  2GU2 A;  5FLM I;  1VQ5 1;  1KC8 1;  1N8R 1;  1RO2 A;  3GTM S;  2JUB A;  2QRE B;  2E9H A;  2O53 A;  2RHB A;  3EED A;  2O4H A;  1YI2 Z;  1SFO I;  1YUA A;  2NVX I;  3H3V J;  3CD6 Z;  1JWH C;  3CCL Z;  3GTL I;  2PK7 A;  2PMZ A;  3HOZ I;  1K8A 2;  2H85 A;  2JA7 I;  3CMA 1;  1Q82 2;  4CL1 A;  1TWG I;  5A2Q f;  2EGT A;  1Q86 1;  5IP7 I;  2QRD B;  3BG0 B;  1YJ9 1;  2OTL Z;  2HF1 A;  2BJO A;  1KD1 2;  3S14 I;  2K3R A;  4BBR I;  3CCQ 1;  5FLX b;  1RNI A;  1VQP 1;  5AN9 F;  3OW2 Z;  1YHQ Z;  1R9T I;  1RQF A;  3FQQ A;  4NB8 A;  1Q86 2;  4RVD A;  2QR1 B;  3MZK B;  2HU9 A;  2Q4Z A;  1KQS Z;  2E2I I;  1M90 1;  1QVF Y;  2R6M A;  1K8A 1;  3J80 f;  1VQL Z;  3CME 1;  1Z01 A;  1VQP Z;  3G6E Z;  3HKZ A;  3KIF A;  2DE6 A;  1YI2 1;  4MD8 A;  5D1O A;  5T64 A;  1Q7Y 1;  3PO2 I;  4BXX I;  3RZD I;  3CCU 1;  1ZH1 A;  3VMI A;  4E32 A;  3CCE Z;  4Y7N I;  3GTP I;  2M48 A;  3MON A;  2QEX Z;  4A3M I;  2OTJ 1;  1K83 I;  2G2K A;  3I56 Z;  1KC8 2;  2QKD A;  3RZO I;  3CPW Y;  2ZAE B;  4E31 A;  1PFT A;  1USP A;  2OTL 1;  2M6N A;  4HGZ A;  1Q81 2;  2RBL A;  3CC4 Z;  1S72 Z;  3GKQ A;  3CCQ Z;  1NJI 2;  3D6W A;  3VTN A;  2WB1 A;  3J7A 4;  3J80 b;  4NFR A;  3F3P C;  1YHQ 1;  4E2X A;  3GTO I;  3I55 1;  1Q82 1;  3S2H I;  4BY1 I;  2DE5 A;  4E2Y A;  3CCV Z;  4E2W A;  1X3Z A;  4NBC A;  3QWU A;  2IZ4 A;  3IX0 A;  4BY7 I;  4A3F I;  3NH5 A;  2R92 I;  5D1O B;  3HOX I;  2NVY I;  1NJI 1;  2GTH A;  2DE7 A;  3F3F C;  2V8I A;  4DGL A;  2LFU A;  2VF1 A;  2JR6 A;  1M1K 1;  3D9X A;  1I50 I;  5A2Q b;  3CCM 1;  4RVH A;  4Y52 I;  4A3J I;  4A3L I;  1USP B;  1VQ9 Z;  3GTG I;  4MD9 A;  1NUI A;  2JA6 I;  4MRI A;  1KD1 1;  3EER A;  2J6A A;  3CQZ I;  5T67 A;  4XX2 A;  1VQ5 Z;  2B63 I;  3CCJ 1;  1P9N A;  1N2F A;  1YJN 1;  2F4O A;  3NH8 A;  4MON A;  3VMH A;  5C4J I;  1VQ8 Z;  3U50 C;  4HGY A;  4A3K I;  1K73 1;  1M90 2;  1TWA I;  1QYP A;  5C3E I;  2WAQ A;  3S15 I;  2AKL A;  3PO3 S;  3CCJ Z;  4A3C I;  3JAM b;  4RS4 A;  1WW9 A;  4EWC A;  2OOX B;  1M1K 2;  4X6A I;  4E33 A;  3G71 1;  2JMO A;  1VLA A;  5C44 I;  3NFZ A;  1RO4 A;  3S1R I;  2JA8 I;  1Q7Y 2;  3GTM I;  3GTQ I;  4QTU A;  1ML8 A;  4TNU A;  3TDH B;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...