3TDHB

Structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Carbon catabolite-derepressing protein kinase
total genus 16
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3tdhB01
2OOYB 2QRDB 2QR1B 3TE5B 2QREB 3T4NB 2QLVB 2OOXB 2QRCB 3TDHB
chains in the Genus database with same CATH superfamily
3J81b 2OZKA 3IF8A 1NP6A 2NVYI 1VQ5Z 2LIYA 5C3EI 3GCFA 3HOVI 5A2Qf 3CMAZ 3CC41 1VQKZ 1YJ9Z 1VQ4Z 4NOZA 1VQ51 1K83I 1Q811 1VQ41 3HOWI 5T64A 2V45A 3I561 5IT9b 2ZAEB 3NFZA 2LEXA 3CCJ1 1W2BY 2OTJZ 1ZB9A 1Q821 3CC21 1VQOZ 2AKLA 2VPYA 3TE5B 4A3JI 1N8R1 1VQ81 4RS4A 1Y1VS 1QXFA 1VQL1 4BY1I 3CD61 1P9NA 4E2ZA 4MONA 2JR6A 2JA8I 2EGTA 1YIJ1 1Q812 1LQLA 3MZLB 2Y0SA 3GKQA 1RLYA 1VQ91 1VQNZ 2DE6A 2V8JA 2JA6I 1NJI1 3D2LA 2QA4Z 1Q861 1YHQ1 3GTOI 1VQMZ 1SFOI 2GTIA 3NH4A 5LL6f 1SIWA 2F4OA 3I551 1TWGI 1Y1VI 3G4SZ 1JJ2Z 2JIRA 1NUIA 2VF1A 3CPWY 1USPB 3P5JB 3KIHA 3G71Z 3CCLZ 1S72Z 1YUKA 5IT9f 2R92I 3VMGA 5D1OB 2QRDB 2LFUA 4E33A 1KRLA 1TWCI 4BXXI 5CM2M 2E2JI 1JWHC 2PK7A 1L1OC 2R93I 3MZKB 2JNYA 1RO2A 4TNUA 4NBBA 1VLAA 2OTJ1 3GTJI 1WZNA 2M6NA 3GTKI 1M1K2 3GTPI 4X6AI 4S1TA 1RO0A 3CC7Z 3CCL1 1RNIA 4MD7A 2VPZA 4XX2A 4NFRA 2QEXZ 1TWAI 3CCEZ 2PM9A 1WCMI 3BG1B 4E32A 1WJ2A 1K8A2 1YJWZ 4Y52I 3PO3S 3T4NB 4A3DI 3CMEZ 1KQSY 2JIMA 2YADA 4NBGA 4BBSI 2BJOA 3CCR1 2RBLA 4A93I 2I3CA 5C4XI 1NJI2 2DE5A 3EERA 3J80b 2WB1A 3CXCY 3G6E1 3OW2Z 3HOYI 2IV2X 4NBFA 3CC4Z 4RVGA 2PMZA 2QA41 1QYPA 2VUGA 2GU2A 1Z03A 3S1MI 4HGZA 4QTTA 1W2BZ 2H85A 4RVHA 3CCJZ 1K731 3CCU1 3HOUI 3S15I 1USPA 3EEDA 4E2YA 3CCQZ 4E30A 1RO4A 3JAMb 2VPXA 5D1PA 2R7ZI 4NB8A 3RZOI 3F3FC 5C4JI 1X0TA 1Q7Y2 2V3VA 2YU9I 2NVQI 3S1NI 4MRIA 3VTNA 3GTQI 1N2FA 2O4HA 4NBHA 3CCSZ 5IP9I 5T6BA 3H0GI 4AYBA 4RVDA 2E2HI 3CCVZ 1Q822 1KD11 3I07A 4DGLA 2VUMI 4A3BI 2GTHA 3H3VJ 2B63I 1DL6A 3VMIA 2HF1A 3HOXI 3CC71 1S7MA 2NAPA 2QRCB 5T67A 2K3RA 2AYDA 2JIOA 2JA5I 3NH5A 3NH8A 2IZ3A 3D9XA 4RV9A 3I56Z 3IFUA 5AN9F 2Q51A 3RZDI 2G2KA 4A3FI 4NBDA 3S2HI 1VQ8Z 1VQK1 2M48A 2K5RA 1YJNZ 3FKII 3I4MI 3FQMA 3G711 3F3PC 1K732 4HGYA 3GTMS 2P3YA 1TFIA 3KIFA 1YI2Z 4NH1C 2JIQA 1VQ71 4A3KI 2DE7A 1YJW1 1I3QI 1VQPZ 1VQLZ 3I4NI 3HKZA 2IZ4A 1QVGZ 3NDIA 3CCUZ 2E2II 1Q7Y1 2NVTI 2RT9A 3J81f 4DQYB 4NBEA 2P28A 3FQQA 2QKDA 3I55Z 1YIJZ 3Q87A 5FLMI 2E9HA 2VPWA 3IX0A 1Y1WI 3PO3I 2RPRA 1R9TI 1TWHI 1YI21 3TDHB 2OTLZ 1YHQZ 4E31A 1M902 2QR1B 2W03A 2JS4A 1YUAA 3GTLI 4A3CI 1TWFI 1PFTA 1M1K1 3CC2Z 1VQO1 1QVFY 1Q16A 1YIT1 1QVGY 4NB9A 1YJN1 3ESWA 1S721 3BG0B 3G4S1 3D6WA 1K9M2 2KPIA 2QLVB 1QF8A 3CMA1 1K9M1 3GTMI 5IP7I 2JIPA 4MD8A 1VQ7Z 2QEX1 1KC82 3CME1 1VQ61 1QVFZ 3PO2I 1ZB8A 4NBCA 1KD12 2OOYB 1I50I 3CPWZ 3CCRZ 3M4OI 2QREB 1KQSZ 3S1RI 5FLXf 3CCV1 4BBRI 3HOZI 1M901 3S14I 3CCQ1 1Q862 1KC81 2WAQA 4A3EI 3J7A4 3MONA 2JA7I 4RVFA 4A3MI 1WIIA 3S2DI 1VQ6Z 3CQZI 3U50C 1Z01A 1VQP1 4HH4A 5D1OA 3S1QI 4A3II 1VQM1 2W04A 4QTUA 4E2WA 3K7AI 4MD9A 3S17I 1K8A1 1X3WA 1YJ91 2Q4ZA 2V8IA 3LUSA 2O53A 4MH4A 2JMOA 3CCMZ 5FLXb 3CXCZ 3OW2Y 1VQN1 1RQFA 1FDOA 2J6AA 2JUBA 1ZH1A 3CCM1 5C44I 5A2Qb 3VMHA 2OTL1 3G6EZ 4A3LI 4E2XA 3M3YI 2KI7B 3GTGI 2R6MA 3CD6Z 2NVXI 4BY7I 2OOXB 2F4MA 3CCS1 1Y8CA 4NBAA 4DK1A 4Y7NI 3S16I 1ML8A 1WW9A 2HU9A 3QWUA 2RHBA 3J80f 1FDIA 2E7ZA 1I6HI 4MXUA 1VQ9Z 1N8R2 4EWCA 2V8KA 1AA6A 3CCE1 3VB9A 3NDJA 1Z02A 1JJ2Y 1YITZ 4A3GI 1X3ZA 3IR7A 3JAMf 2RIQA 4CL1A
chains in the Genus database with same CATH topology
3J81b 2OZKA 3IF8A 1NP6A 2NVYI 1VQ5Z 2LIYA 5C3EI 3GCFA 3HOVI 5A2Qf 3CMAZ 3CC41 1VQKZ 1YJ9Z 1VQ4Z 4NOZA 1VQ51 1K83I 1Q811 1VQ41 3HOWI 5T64A 3I561 5IT9b 2ZAEB 3NFZA 3CCJ1 1W2BY 2OTJZ 1ZB9A 1Q821 3CC21 1VQOZ 2AKLA 3TE5B 4A3JI 1VQ81 1N8R1 4RS4A 1Y1VS 1VQL1 4BY1I 3CD61 1P9NA 4E2ZA 4MONA 2JR6A 2JA8I 2EGTA 1YIJ1 1Q812 1LQLA 3MZLB 2Y0SA 3GKQA 1RLYA 1VQ91 1VQNZ 2DE6A 2V8JA 2JA6I 1NJI1 2QA4Z 1Q861 1YHQ1 3GTOI 1VQMZ 1SFOI 2GTIA 3NH4A 5LL6f 2F4OA 3I551 1TWGI 1Y1VI 3G4SZ 1JJ2Z 1NUIA 2VF1A 3CPWY 1USPB 3P5JB 3KIHA 3G71Z 3CCLZ 1S72Z 1YUKA 5IT9f 2R92I 3VMGA 5D1OB 2QRDB 2LFUA 4E33A 1KRLA 1TWCI 4BXXI 5CM2M 2E2JI 1JWHC 2PK7A 1L1OC 2R93I 3MZKB 2JNYA 1RO2A 4TNUA 4NBBA 1VLAA 2OTJ1 3GTJI 2M6NA 3GTKI 1M1K2 3GTPI 4X6AI 4S1TA 1RO0A 3CC7Z 3CCL1 1RNIA 4MD7A 4XX2A 4NFRA 2QEXZ 1TWAI 3CCEZ 2PM9A 1WCMI 3BG1B 4E32A 1K8A2 1YJWZ 4Y52I 3PO3S 3T4NB 4A3DI 3CMEZ 1KQSY 2YADA 4NBGA 4BBSI 2BJOA 3CCR1 2RBLA 4A93I 2I3CA 5C4XI 1NJI2 2DE5A 3EERA 3J80b 2WB1A 3CXCY 3G6E1 3OW2Z 3HOYI 4NBFA 3CC4Z 4RVGA 2PMZA 2QA41 1QYPA 2VUGA 2GU2A 1Z03A 3S1MI 4HGZA 4QTTA 1W2BZ 2H85A 4RVHA 3CCJZ 1K731 3CCU1 3HOUI 3S15I 1USPA 3EEDA 4E2YA 3CCQZ 4E30A 1RO4A 3JAMb 5D1PA 2R7ZI 4NB8A 3RZOI 3F3FC 5C4JI 1X0TA 1Q7Y2 2YU9I 2NVQI 3S1NI 4MRIA 3VTNA 3GTQI 1N2FA 2O4HA 4NBHA 3CCSZ 5IP9I 5T6BA 3H0GI 4AYBA 4RVDA 2E2HI 3CCVZ 1Q822 1KD11 3I07A 4DGLA 2VUMI 4A3BI 2GTHA 3H3VJ 2B63I 1DL6A 3VMIA 2HF1A 3HOXI 3CC71 1S7MA 2QRCB 5T67A 2K3RA 2JA5I 3NH5A 3NH8A 2IZ3A 3D9XA 4RV9A 3I56Z 3IFUA 5AN9F 2Q51A 3RZDI 2G2KA 4A3FI 4NBDA 3S2HI 1VQ8Z 1VQK1 2M48A 2K5RA 1YJNZ 3FKII 3I4MI 3FQMA 3G711 3F3PC 1K732 4HGYA 3GTMS 2P3YA 1TFIA 3KIFA 1YI2Z 4NH1C 1VQ71 4A3KI 2DE7A 1YJW1 1I3QI 1VQPZ 1VQLZ 3I4NI 3HKZA 1QVGZ 2IZ4A 3NDIA 3CCUZ 2E2II 1Q7Y1 2NVTI 2RT9A 3J81f 4DQYB 4NBEA 2P28A 3FQQA 2QKDA 3I55Z 1YIJZ 3Q87A 5FLMI 2E9HA 3IX0A 1Y1WI 3PO3I 2RPRA 1R9TI 1TWHI 1YI21 3TDHB 2OTLZ 1YHQZ 4E31A 1M902 2QR1B 2W03A 2JS4A 1YUAA 3GTLI 4A3CI 1TWFI 1PFTA 1M1K1 3CC2Z 1VQO1 1QVFY 1YIT1 1QVGY 4NB9A 1YJN1 3ESWA 1S721 3BG0B 3G4S1 3D6WA 1K9M2 2KPIA 2QLVB 1QF8A 3CMA1 1K9M1 3GTMI 5IP7I 4MD8A 1VQ7Z 2QEX1 1KC82 3CME1 1VQ61 1QVFZ 3PO2I 1ZB8A 4NBCA 1KD12 2OOYB 1I50I 3CPWZ 3CCRZ 3M4OI 2QREB 1KQSZ 3S1RI 5FLXf 3CCV1 4BBRI 3HOZI 1M901 3S14I 3CCQ1 1Q862 1KC81 2WAQA 4A3EI 3J7A4 3MONA 2JA7I 4RVFA 4A3MI 1WIIA 3S2DI 1VQ6Z 3CQZI 3U50C 1Z01A 1VQP1 4HH4A 5D1OA 3S1QI 4A3II 1VQM1 2W04A 4QTUA 4E2WA 3K7AI 4MD9A 3S17I 1K8A1 1X3WA 1YJ91 2Q4ZA 2V8IA 3LUSA 2O53A 4MH4A 2JMOA 3CCMZ 5FLXb 3CXCZ 3OW2Y 1VQN1 1RQFA 2J6AA 2JUBA 1ZH1A 3CCM1 5C44I 5A2Qb 3VMHA 2OTL1 3G6EZ 4A3LI 4E2XA 3M3YI 2KI7B 3GTGI 2R6MA 3CD6Z 2NVXI 4BY7I 2OOXB 2F4MA 3CCS1 4NBAA 4DK1A 4Y7NI 3S16I 1ML8A 1WW9A 2HU9A 3QWUA 2RHBA 3J80f 1I6HI 4MXUA 1VQ9Z 1N8R2 4EWCA 2V8KA 3CCE1 3VB9A 3NDJA 1Z02A 1JJ2Y 1YITZ 4A3GI 1X3ZA 3JAMf 2RIQA 4CL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOY B;  2QRD B;  2QR1 B;  3TE5 B;  2QRE B;  3T4N B;  2QLV B;  2OOX B;  2QRC B;  3TDH B; 
#chains in the Genus database with same CATH topology
 3J81 b;  2OZK A;  3IF8 A;  1NP6 A;  2NVY I;  1VQ5 Z;  2LIY A;  5C3E I;  3GCF A;  3HOV I;  5A2Q f;  3CMA Z;  3CC4 1;  1VQK Z;  1YJ9 Z;  1VQ4 Z;  4NOZ A;  1VQ5 1;  1K83 I;  1Q81 1;  1VQ4 1;  3HOW I;  5T64 A;  2V45 A;  3I56 1;  5IT9 b;  2ZAE B;  3NFZ A;  2LEX A;  3CCJ 1;  1W2B Y;  2OTJ Z;  1ZB9 A;  1Q82 1;  3CC2 1;  1VQO Z;  2AKL A;  2VPY A;  3TE5 B;  4A3J I;  1N8R 1;  1VQ8 1;  4RS4 A;  1Y1V S;  1QXF A;  1VQL 1;  4BY1 I;  3CD6 1;  1P9N A;  4E2Z A;  4MON A;  2JR6 A;  2JA8 I;  2EGT A;  1YIJ 1;  1Q81 2;  1LQL A;  3MZL B;  2Y0S A;  3GKQ A;  1RLY A;  1VQ9 1;  1VQN Z;  2DE6 A;  2V8J A;  2JA6 I;  1NJI 1;  3D2L A;  2QA4 Z;  1Q86 1;  1YHQ 1;  3GTO I;  1VQM Z;  1SFO I;  2GTI A;  3NH4 A;  5LL6 f;  1SIW A;  2F4O A;  3I55 1;  1TWG I;  1Y1V I;  3G4S Z;  1JJ2 Z;  2JIR A;  1NUI A;  2VF1 A;  3CPW Y;  1USP B;  3P5J B;  3KIH A;  3G71 Z;  3CCL Z;  1S72 Z;  1YUK A;  5IT9 f;  2R92 I;  3VMG A;  5D1O B;  2QRD B;  2LFU A;  4E33 A;  1KRL A;  1TWC I;  4BXX I;  5CM2 M;  2E2J I;  1JWH C;  2PK7 A;  1L1O C;  2R93 I;  3MZK B;  2JNY A;  1RO2 A;  4TNU A;  4NBB A;  1VLA A;  2OTJ 1;  3GTJ I;  1WZN A;  2M6N A;  3GTK I;  1M1K 2;  3GTP I;  4X6A I;  4S1T A;  1RO0 A;  3CC7 Z;  3CCL 1;  1RNI A;  4MD7 A;  2VPZ A;  4XX2 A;  4NFR A;  2QEX Z;  1TWA I;  3CCE Z;  2PM9 A;  1WCM I;  3BG1 B;  4E32 A;  1WJ2 A;  1K8A 2;  1YJW Z;  4Y52 I;  3PO3 S;  3T4N B;  4A3D I;  3CME Z;  1KQS Y;  2JIM A;  2YAD A;  4NBG A;  4BBS I;  2BJO A;  3CCR 1;  2RBL A;  4A93 I;  2I3C A;  5C4X I;  1NJI 2;  2DE5 A;  3EER A;  3J80 b;  2WB1 A;  3CXC Y;  3G6E 1;  3OW2 Z;  3HOY I;  2IV2 X;  4NBF A;  3CC4 Z;  4RVG A;  2PMZ A;  2QA4 1;  1QYP A;  2VUG A;  2GU2 A;  1Z03 A;  3S1M I;  4HGZ A;  4QTT A;  1W2B Z;  2H85 A;  4RVH A;  3CCJ Z;  1K73 1;  3CCU 1;  3HOU I;  3S15 I;  1USP A;  3EED A;  4E2Y A;  3CCQ Z;  4E30 A;  1RO4 A;  3JAM b;  2VPX A;  5D1P A;  2R7Z I;  4NB8 A;  3RZO I;  3F3F C;  5C4J I;  1X0T A;  1Q7Y 2;  2V3V A;  2YU9 I;  2NVQ I;  3S1N I;  4MRI A;  3VTN A;  3GTQ I;  1N2F A;  2O4H A;  4NBH A;  3CCS Z;  5IP9 I;  5T6B A;  3H0G I;  4AYB A;  4RVD A;  2E2H I;  3CCV Z;  1Q82 2;  1KD1 1;  3I07 A;  4DGL A;  2VUM I;  4A3B I;  2GTH A;  3H3V J;  2B63 I;  1DL6 A;  3VMI A;  2HF1 A;  3HOX I;  3CC7 1;  1S7M A;  2NAP A;  2QRC B;  5T67 A;  2K3R A;  2AYD A;  2JIO A;  2JA5 I;  3NH5 A;  3NH8 A;  2IZ3 A;  3D9X A;  4RV9 A;  3I56 Z;  3IFU A;  5AN9 F;  2Q51 A;  3RZD I;  2G2K A;  4A3F I;  4NBD A;  3S2H I;  1VQ8 Z;  1VQK 1;  2M48 A;  2K5R A;  1YJN Z;  3FKI I;  3I4M I;  3FQM A;  3G71 1;  3F3P C;  1K73 2;  4HGY A;  3GTM S;  2P3Y A;  1TFI A;  3KIF A;  1YI2 Z;  4NH1 C;  2JIQ A;  1VQ7 1;  4A3K I;  2DE7 A;  1YJW 1;  1I3Q I;  1VQP Z;  1VQL Z;  3I4N I;  3HKZ A;  2IZ4 A;  1QVG Z;  3NDI A;  3CCU Z;  2E2I I;  1Q7Y 1;  2NVT I;  2RT9 A;  3J81 f;  4DQY B;  4NBE A;  2P28 A;  3FQQ A;  2QKD A;  3I55 Z;  1YIJ Z;  3Q87 A;  5FLM I;  2E9H A;  2VPW A;  3IX0 A;  1Y1W I;  3PO3 I;  2RPR A;  1R9T I;  1TWH I;  1YI2 1;  3TDH B;  2OTL Z;  1YHQ Z;  4E31 A;  1M90 2;  2QR1 B;  2W03 A;  2JS4 A;  1YUA A;  3GTL I;  4A3C I;  1TWF I;  1PFT A;  1M1K 1;  3CC2 Z;  1VQO 1;  1QVF Y;  1Q16 A;  1YIT 1;  1QVG Y;  4NB9 A;  1YJN 1;  3ESW A;  1S72 1;  3BG0 B;  3G4S 1;  3D6W A;  1K9M 2;  2KPI A;  2QLV B;  1QF8 A;  3CMA 1;  1K9M 1;  3GTM I;  5IP7 I;  2JIP A;  4MD8 A;  1VQ7 Z;  2QEX 1;  1KC8 2;  3CME 1;  1VQ6 1;  1QVF Z;  3PO2 I;  1ZB8 A;  4NBC A;  1KD1 2;  2OOY B;  1I50 I;  3CPW Z;  3CCR Z;  3M4O I;  2QRE B;  1KQS Z;  3S1R I;  5FLX f;  3CCV 1;  4BBR I;  3HOZ I;  1M90 1;  3S14 I;  3CCQ 1;  1Q86 2;  1KC8 1;  2WAQ A;  4A3E I;  3J7A 4;  3MON A;  2JA7 I;  4RVF A;  4A3M I;  1WII A;  3S2D I;  1VQ6 Z;  3CQZ I;  3U50 C;  1Z01 A;  1VQP 1;  4HH4 A;  5D1O A;  3S1Q I;  4A3I I;  1VQM 1;  2W04 A;  4QTU A;  4E2W A;  3K7A I;  4MD9 A;  3S17 I;  1K8A 1;  1X3W A;  1YJ9 1;  2Q4Z A;  2V8I A;  3LUS A;  2O53 A;  4MH4 A;  2JMO A;  3CCM Z;  5FLX b;  3CXC Z;  3OW2 Y;  1VQN 1;  1RQF A;  1FDO A;  2J6A A;  2JUB A;  1ZH1 A;  3CCM 1;  5C44 I;  5A2Q b;  3VMH A;  2OTL 1;  3G6E Z;  4A3L I;  4E2X A;  3M3Y I;  2KI7 B;  3GTG I;  2R6M A;  3CD6 Z;  2NVX I;  4BY7 I;  2OOX B;  2F4M A;  3CCS 1;  1Y8C A;  4NBA A;  4DK1 A;  4Y7N I;  3S16 I;  1ML8 A;  1WW9 A;  2HU9 A;  3QWU A;  2RHB A;  3J80 f;  1FDI A;  2E7Z A;  1I6H I;  4MXU A;  1VQ9 Z;  1N8R 2;  4EWC A;  2V8K A;  1AA6 A;  3CCE 1;  3VB9 A;  3NDJ A;  1Z02 A;  1JJ2 Y;  1YIT Z;  4A3G I;  1X3Z A;  3IR7 A;  3JAM f;  2RIQ A;  4CL1 A; 
#chains in the Genus database with same CATH homology
 3J81 b;  2OZK A;  3IF8 A;  1NP6 A;  2NVY I;  1VQ5 Z;  2LIY A;  5C3E I;  3GCF A;  3HOV I;  5A2Q f;  3CMA Z;  3CC4 1;  1VQK Z;  1YJ9 Z;  1VQ4 Z;  4NOZ A;  1VQ5 1;  1K83 I;  1Q81 1;  1VQ4 1;  3HOW I;  5T64 A;  3I56 1;  5IT9 b;  2ZAE B;  3NFZ A;  3CCJ 1;  1W2B Y;  2OTJ Z;  1ZB9 A;  1Q82 1;  3CC2 1;  1VQO Z;  2AKL A;  3TE5 B;  4A3J I;  1VQ8 1;  1N8R 1;  4RS4 A;  1Y1V S;  1VQL 1;  4BY1 I;  3CD6 1;  1P9N A;  4E2Z A;  4MON A;  2JR6 A;  2JA8 I;  2EGT A;  1YIJ 1;  1Q81 2;  1LQL A;  3MZL B;  2Y0S A;  3GKQ A;  1RLY A;  1VQ9 1;  1VQN Z;  2DE6 A;  2V8J A;  2JA6 I;  1NJI 1;  2QA4 Z;  1Q86 1;  1YHQ 1;  3GTO I;  1VQM Z;  1SFO I;  2GTI A;  3NH4 A;  5LL6 f;  2F4O A;  3I55 1;  1TWG I;  1Y1V I;  3G4S Z;  1JJ2 Z;  1NUI A;  2VF1 A;  3CPW Y;  1USP B;  3P5J B;  3KIH A;  3G71 Z;  3CCL Z;  1S72 Z;  1YUK A;  5IT9 f;  2R92 I;  3VMG A;  5D1O B;  2QRD B;  2LFU A;  4E33 A;  1KRL A;  1TWC I;  4BXX I;  5CM2 M;  2E2J I;  1JWH C;  2PK7 A;  1L1O C;  2R93 I;  3MZK B;  2JNY A;  1RO2 A;  4TNU A;  4NBB A;  1VLA A;  2OTJ 1;  3GTJ I;  2M6N A;  3GTK I;  1M1K 2;  3GTP I;  4X6A I;  4S1T A;  1RO0 A;  3CC7 Z;  3CCL 1;  1RNI A;  4MD7 A;  4XX2 A;  4NFR A;  2QEX Z;  1TWA I;  3CCE Z;  2PM9 A;  1WCM I;  3BG1 B;  4E32 A;  1K8A 2;  1YJW Z;  4Y52 I;  3PO3 S;  3T4N B;  4A3D I;  3CME Z;  1KQS Y;  2YAD A;  4NBG A;  4BBS I;  2BJO A;  3CCR 1;  2RBL A;  4A93 I;  2I3C A;  5C4X I;  1NJI 2;  2DE5 A;  3EER A;  3J80 b;  2WB1 A;  3CXC Y;  3G6E 1;  3OW2 Z;  3HOY I;  4NBF A;  3CC4 Z;  4RVG A;  2PMZ A;  2QA4 1;  1QYP A;  2VUG A;  2GU2 A;  1Z03 A;  3S1M I;  4HGZ A;  4QTT A;  1W2B Z;  2H85 A;  4RVH A;  3CCJ Z;  1K73 1;  3CCU 1;  3HOU I;  3S15 I;  1USP A;  3EED A;  4E2Y A;  3CCQ Z;  4E30 A;  1RO4 A;  3JAM b;  5D1P A;  2R7Z I;  4NB8 A;  3RZO I;  3F3F C;  5C4J I;  1X0T A;  1Q7Y 2;  2YU9 I;  2NVQ I;  3S1N I;  4MRI A;  3VTN A;  3GTQ I;  1N2F A;  2O4H A;  4NBH A;  3CCS Z;  5IP9 I;  5T6B A;  3H0G I;  4AYB A;  4RVD A;  2E2H I;  3CCV Z;  1Q82 2;  1KD1 1;  3I07 A;  4DGL A;  2VUM I;  4A3B I;  2GTH A;  3H3V J;  2B63 I;  1DL6 A;  3VMI A;  2HF1 A;  3HOX I;  3CC7 1;  1S7M A;  2QRC B;  5T67 A;  2K3R A;  2JA5 I;  3NH5 A;  3NH8 A;  2IZ3 A;  3D9X A;  4RV9 A;  3I56 Z;  3IFU A;  5AN9 F;  2Q51 A;  3RZD I;  2G2K A;  4A3F I;  4NBD A;  3S2H I;  1VQ8 Z;  1VQK 1;  2M48 A;  2K5R A;  1YJN Z;  3FKI I;  3I4M I;  3FQM A;  3G71 1;  3F3P C;  1K73 2;  4HGY A;  3GTM S;  2P3Y A;  1TFI A;  3KIF A;  1YI2 Z;  4NH1 C;  1VQ7 1;  4A3K I;  2DE7 A;  1YJW 1;  1I3Q I;  1VQP Z;  1VQL Z;  3I4N I;  3HKZ A;  1QVG Z;  2IZ4 A;  3NDI A;  3CCU Z;  2E2I I;  1Q7Y 1;  2NVT I;  2RT9 A;  3J81 f;  4DQY B;  4NBE A;  2P28 A;  3FQQ A;  2QKD A;  3I55 Z;  1YIJ Z;  3Q87 A;  5FLM I;  2E9H A;  3IX0 A;  1Y1W I;  3PO3 I;  2RPR A;  1R9T I;  1TWH I;  1YI2 1;  3TDH B;  2OTL Z;  1YHQ Z;  4E31 A;  1M90 2;  2QR1 B;  2W03 A;  2JS4 A;  1YUA A;  3GTL I;  4A3C I;  1TWF I;  1PFT A;  1M1K 1;  3CC2 Z;  1VQO 1;  1QVF Y;  1YIT 1;  1QVG Y;  4NB9 A;  1YJN 1;  3ESW A;  1S72 1;  3BG0 B;  3G4S 1;  3D6W A;  1K9M 2;  2KPI A;  2QLV B;  1QF8 A;  3CMA 1;  1K9M 1;  3GTM I;  5IP7 I;  4MD8 A;  1VQ7 Z;  2QEX 1;  1KC8 2;  3CME 1;  1VQ6 1;  1QVF Z;  3PO2 I;  1ZB8 A;  4NBC A;  1KD1 2;  2OOY B;  1I50 I;  3CPW Z;  3CCR Z;  3M4O I;  2QRE B;  1KQS Z;  3S1R I;  5FLX f;  3CCV 1;  4BBR I;  3HOZ I;  1M90 1;  3S14 I;  3CCQ 1;  1Q86 2;  1KC8 1;  2WAQ A;  4A3E I;  3J7A 4;  3MON A;  2JA7 I;  4RVF A;  4A3M I;  1WII A;  3S2D I;  1VQ6 Z;  3CQZ I;  3U50 C;  1Z01 A;  1VQP 1;  4HH4 A;  5D1O A;  3S1Q I;  4A3I I;  1VQM 1;  2W04 A;  4QTU A;  4E2W A;  3K7A I;  4MD9 A;  3S17 I;  1K8A 1;  1X3W A;  1YJ9 1;  2Q4Z A;  2V8I A;  3LUS A;  2O53 A;  4MH4 A;  2JMO A;  3CCM Z;  5FLX b;  3CXC Z;  3OW2 Y;  1VQN 1;  1RQF A;  2J6A A;  2JUB A;  1ZH1 A;  3CCM 1;  5C44 I;  5A2Q b;  3VMH A;  2OTL 1;  3G6E Z;  4A3L I;  4E2X A;  3M3Y I;  2KI7 B;  3GTG I;  2R6M A;  3CD6 Z;  2NVX I;  4BY7 I;  2OOX B;  2F4M A;  3CCS 1;  4NBA A;  4DK1 A;  4Y7N I;  3S16 I;  1ML8 A;  1WW9 A;  2HU9 A;  3QWU A;  2RHB A;  3J80 f;  1I6H I;  4MXU A;  1VQ9 Z;  1N8R 2;  4EWC A;  2V8K A;  3CCE 1;  3VB9 A;  3NDJ A;  1Z02 A;  1JJ2 Y;  1YIT Z;  4A3G I;  1X3Z A;  3JAM f;  2RIQ A;  4CL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...