3TDHB

Structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
104
Chain Sequence
b'MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
total genus 16
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3tdhB01
3T4NB 2QRCB 2OOYB 2QREB 3TE5B 2QLVB 2QR1B 3TDHB 2QRDB 2OOXB
chains in the Genus database with same CATH superfamily
1VQO1 1YHQZ 3GTPI 3EERA 2YU9I 4E32A 2OTL1 4TNUA 2NVYI 4HGYA 3CCS1 1Y8CA 3GTMI 4A3GI 1PFTA 3D6WA 3H0GI 2IZ4A 1YITZ 1VQ7Z 2VUMI 2V3VA 3OW2Z 1ZH1A 3PO3I 5C44I 3KIHA 4EWCA 2JA5I 4HH4A 1QXFA 1TWFI 5A2Qf 3I561 1QF8A 1Q862 3NFZA 1W2BZ 2M6NA 2HU9A 1KD11 2JA6I 3KIFA 1YUAA 2JIQA 3M4OI 1I50I 4X6AI 1WIIA 1TWCI 4DK1A 3CCUZ 3CPWY 3CMAZ 2RHBA 2KI7B 5LL6f 3CME1 4NB8A 2O53A 2PM9A 3BG1B 2QRCB 4QTTA 1VQ4Z 1VQ5Z 2K3RA 3QWUA 2IV2X 1FDIA 2QRDB 2P28A 5C4JI 1VLAA 2GTHA 3M3YI 1P9NA 2I3CA 3CMA1 3S15I 2PK7A 4XX2A 2YADA 3GTJI 1QVFZ 4RVDA 3GTLI 4RVFA 5FLXf 3HOVI 1VQ81 2E2II 1K9M1 4CL1A 3HOXI 3NH4A 1USPB 3CCQ1 2QLVB 2JIOA 2Q51A 2OZKA 4RS4A 3JAMb 5IT9f 3S2HI 2LIYA 2M48A 3I551 1YI21 1Q16A 1S7MA 3S14I 3BG0B 1X0TA 4RVGA 4DGLA 3I4NI 2QA41 3HOWI 5C3EI 4NBEA 1YUKA 3J80f 3OW2Y 4RV9A 2KPIA 1QVGY 1K83I 1K731 1Q822 2QKDA 2QEX1 1NJI1 1M1K1 1JJ2Z 5C4XI 2F4MA 1NP6A 1K8A1 4NBCA 1YI2Z 1VQ6Z 3NH8A 5A2Qb 1RLYA 3FQMA 2NVQI 3G4SZ 2JUBA 1VQK1 3S16I 2DE5A 2OOXB 2JR6A 3D9XA 3CCRZ 3HOUI 1R9TI 3CC7Z 1S72Z 3G71Z 4BXXI 3J81b 3PO2I 1WZNA 1QVFY 3S1NI 2NVTI 2OOYB 5AN9F 3CCJZ 3EEDA 3CCQZ 2JA8I 2JMOA 2R6MA 1USPA 2Q4ZA 3CCM1 1YJ91 2E2JI 3CPWZ 2W03A 3CXCY 1YJWZ 1Q811 3TE5B 1YJNZ 1VQ71 3VMIA 2E9HA 3I07A 2VUGA 1Q861 1M901 4A3BI 3FQQA 2EGTA 3U50C 1KD12 3VMHA 2RPRA 4MRIA 4A3DI 1YHQ1 4HGZA 3JAMf 1JJ2Y 3NDIA 3G4S1 3CCLZ 2V45A 4A3CI 4A3JI 3CC2Z 4MD9A 4E2ZA 2QEXZ 1VQPZ 2OTJ1 2BJOA 1Z01A 4NBFA 4NOZA 4NBDA 2DE7A 2R92I 1Y1VI 3HOZI 4RVHA 1VQLZ 1YJW1 1YJN1 3H3VJ 2OTLZ 2JS4A 5T67A 4A93I 3I4MI 3F3PC 3G6E1 4A3FI 2V8IA 2VPXA 5FLMI 2V8JA 1FDOA 3S1MI 1RQFA 2DE6A 3GTKI 1QVGZ 1Q812 3HKZA 2NAPA 2IZ3A 3MONA 5CM2M 3GKQA 3J81f 1VQMZ 3CC71 2Y0SA 2NVXI 5FLXb 1Y1WI 3CCR1 2JNYA 3GTMS 2OTJZ 4NH1C 1SIWA 4A3KI 1VQOZ 5IT9b 3CCVZ 1Z03A 2P3YA 3F3FC 3G6EZ 1K732 2VPZA 1KC82 1VQNZ 4Y7NI 3VB9A 1N2FA 3GTGI 2WB1A 1TWHI 1WW9A 1K8A2 1Q7Y1 3CMEZ 4BBSI 3P5JB 3CCE1 2HF1A 2VPYA 4QTUA 4E31A 4E2YA 4MD8A 2QA4Z 4MD7A 2QR1B 1N8R1 1I3QI 1VQP1 1ZB8A 2WAQA 1AA6A 3S1QI 4E2WA 3CXCZ 1SFOI 2JIRA 1VQ91 3VTNA 2RIQA 3K7AI 1X3WA 4NB9A 1RO4A 1YIT1 4MH4A 1Y1VS 3NDJA 2QREB 3IFUA 1VQL1 3S17I 1ZB9A 1YIJZ 4A3MI 1VQM1 2JIMA 4AYBA 5D1OB 4E2XA 1S721 4BY1I 1JWHC 1X3ZA 1WCMI 3IF8A 4NFRA 5D1PA 1YJ9Z 3I56Z 2E7ZA 3GTOI 1W2BY 4A3LI 1TWGI 5T64A 1RO0A 1VQ51 2F4OA 3D2LA 4E30A 1KC81 4NBGA 2R7ZI 1M902 3CC4Z 3CQZI 1VQ8Z 3GTQI 2RT9A 2VF1A 4NBBA 3IR7A 1WJ2A 3S1RI 4A3EI 2LFUA 4DQYB 4NBAA 1KRLA 2H85A 5IP7I 1LQLA 1KQSZ 1Z02A 3RZDI 1ML8A 2GTIA 4Y52I 2J6AA 2RBLA 2K5RA 3RZOI 2JA7I 4MXUA 3ESWA 3CD61 2AYDA 1QYPA 3T4NB 1K9M2 3MZLB 2W04A 1NUIA 3IX0A 2JIPA 2E2HI 1RO2A 3CCSZ 3J80b 1YIJ1 2G2KA 2AKLA 3GCFA 5T6BA 3HOYI 5IP9I 3I55Z 3CC21 4BY7I 1VQ9Z 3CCJ1 4BBRI 3CD6Z 2B63I 3CCL1 1TFIA 1VQ61 2GU2A 2VPWA 4S1TA 3S2DI 2ZAEB 2O4HA 1VQ41 1RNIA 1DL6A 5D1OA 2V8KA 1Q821 1NJI2 4MONA 1M1K2 4A3II 3MZKB 2R93I 3CCEZ 3NH5A 3G711 3VMGA 1TWAI 3CCU1 3CC41 1L1OC 1VQN1 2PMZA 1VQKZ 1Q7Y2 4NBHA 1KQSY 3Q87A 3CCMZ 1I6HI 3LUSA 4E33A 3J7A4 3PO3S 3TDHB 3FKII 1N8R2 3CCV1 2LEXA
chains in the Genus database with same CATH topology
1VQO1 1YHQZ 3GTPI 3EERA 2YU9I 4E32A 2OTL1 4TNUA 2NVYI 4HGYA 3CCS1 3GTMI 4A3GI 1PFTA 3D6WA 3H0GI 2IZ4A 1YITZ 1VQ7Z 2VUMI 3OW2Z 1ZH1A 3PO3I 5C44I 3KIHA 4EWCA 2JA5I 4HH4A 1TWFI 5A2Qf 3I561 1QF8A 1Q862 3NFZA 1W2BZ 2M6NA 2HU9A 1KD11 2JA6I 3KIFA 1YUAA 3M4OI 1I50I 4X6AI 1WIIA 1TWCI 4DK1A 3CCUZ 3CPWY 3CMAZ 2RHBA 2KI7B 5LL6f 3CME1 4NB8A 2O53A 2PM9A 3BG1B 2QRCB 4QTTA 1VQ4Z 1VQ5Z 2K3RA 3QWUA 2QRDB 2P28A 5C4JI 1VLAA 2GTHA 3M3YI 1P9NA 2I3CA 3CMA1 3S15I 2PK7A 4XX2A 2YADA 3GTJI 1QVFZ 4RVDA 3GTLI 4RVFA 5FLXf 3HOVI 1VQ81 2E2II 1K9M1 4CL1A 3HOXI 3NH4A 1USPB 3CCQ1 2QLVB 2Q51A 2OZKA 4RS4A 3JAMb 5IT9f 3S2HI 2LIYA 2M48A 3I551 1YI21 1S7MA 3S14I 3BG0B 1X0TA 4RVGA 4DGLA 3I4NI 2QA41 3HOWI 5C3EI 4NBEA 1YUKA 3J80f 3OW2Y 4RV9A 2KPIA 1QVGY 1K83I 1K731 1Q822 2QKDA 2QEX1 1NJI1 1M1K1 1JJ2Z 5C4XI 2F4MA 1NP6A 1K8A1 4NBCA 1YI2Z 1VQ6Z 3NH8A 5A2Qb 1RLYA 3FQMA 2NVQI 3G4SZ 2JUBA 1VQK1 3S16I 2DE5A 2OOXB 2JR6A 3D9XA 3CCRZ 3HOUI 1R9TI 3CC7Z 1S72Z 3G71Z 4BXXI 3J81b 3PO2I 1QVFY 3S1NI 2NVTI 2OOYB 5AN9F 3CCJZ 3EEDA 3CCQZ 2JA8I 2JMOA 2R6MA 1USPA 2Q4ZA 3CCM1 1YJ91 2E2JI 2W03A 3CXCY 3CPWZ 1YJWZ 1Q811 3TE5B 1YJNZ 1VQ71 3VMIA 2E9HA 3I07A 2VUGA 1Q861 1M901 4A3BI 3FQQA 2EGTA 3U50C 1KD12 3VMHA 2RPRA 4MRIA 4A3DI 1YHQ1 4HGZA 3JAMf 1JJ2Y 3NDIA 3G4S1 3CCLZ 4A3CI 4A3JI 3CC2Z 4MD9A 4E2ZA 2QEXZ 1VQPZ 2OTJ1 2BJOA 1Z01A 4NBFA 4NOZA 4NBDA 2DE7A 2R92I 1Y1VI 3HOZI 1VQLZ 4RVHA 1YJW1 1YJN1 3H3VJ 2OTLZ 2JS4A 5T67A 4A93I 3I4MI 3F3PC 3G6E1 4A3FI 2V8IA 5FLMI 2V8JA 3S1MI 1RQFA 2DE6A 3GTKI 1QVGZ 1Q812 3HKZA 2IZ3A 3MONA 5CM2M 3GKQA 3J81f 1VQMZ 3CC71 2Y0SA 2NVXI 5FLXb 1Y1WI 3CCR1 2JNYA 3GTMS 2OTJZ 4NH1C 4A3KI 1VQOZ 5IT9b 3CCVZ 1Z03A 2P3YA 3F3FC 3G6EZ 1K732 1KC82 1VQNZ 4Y7NI 3VB9A 1N2FA 3GTGI 2WB1A 1TWHI 1WW9A 1K8A2 1Q7Y1 3CMEZ 4BBSI 3P5JB 3CCE1 2HF1A 4QTUA 4E2YA 4E31A 4MD8A 2QA4Z 4MD7A 2QR1B 1N8R1 1I3QI 1VQP1 1ZB8A 2WAQA 3S1QI 4E2WA 3CXCZ 1SFOI 1VQ91 3VTNA 2RIQA 3K7AI 1X3WA 4NB9A 1RO4A 1YIT1 4MH4A 1Y1VS 3NDJA 2QREB 3IFUA 1VQL1 3S17I 1ZB9A 1YIJZ 4A3MI 1VQM1 4AYBA 5D1OB 4E2XA 1S721 4BY1I 1JWHC 1X3ZA 1WCMI 3IF8A 4NFRA 5D1PA 1YJ9Z 3I56Z 3GTOI 1W2BY 4A3LI 1TWGI 5T64A 1RO0A 1VQ51 2F4OA 4E30A 1KC81 4NBGA 2R7ZI 1M902 3CC4Z 3CQZI 1VQ8Z 3GTQI 2RT9A 2VF1A 4NBBA 3S1RI 4A3EI 2LFUA 4DQYB 4NBAA 1KRLA 2H85A 5IP7I 1LQLA 1KQSZ 1Z02A 3RZDI 1ML8A 2GTIA 4Y52I 2J6AA 2RBLA 2K5RA 3RZOI 2JA7I 4MXUA 3ESWA 3CD61 1QYPA 3T4NB 1K9M2 3MZLB 2W04A 1NUIA 3IX0A 2E2HI 1RO2A 3CCSZ 3J80b 1YIJ1 2G2KA 2AKLA 3GCFA 5T6BA 3HOYI 5IP9I 3I55Z 3CC21 4BY7I 1VQ9Z 3CCJ1 4BBRI 3CD6Z 2B63I 3CCL1 1TFIA 1VQ61 2GU2A 4S1TA 3S2DI 2ZAEB 2O4HA 1VQ41 1RNIA 1DL6A 5D1OA 2V8KA 1Q821 1NJI2 4MONA 1M1K2 4A3II 3MZKB 2R93I 3CCEZ 3NH5A 3G711 3VMGA 1TWAI 3CCU1 3CC41 1L1OC 1VQN1 2PMZA 1VQKZ 1Q7Y2 4NBHA 1KQSY 3Q87A 3CCMZ 1I6HI 3LUSA 4E33A 3J7A4 3PO3S 3TDHB 3FKII 1N8R2 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4N B;  2QRC B;  2OOY B;  2QRE B;  3TE5 B;  2QLV B;  2QR1 B;  3TDH B;  2QRD B;  2OOX B; 
#chains in the Genus database with same CATH topology
 1VQO 1;  1YHQ Z;  3GTP I;  3EER A;  2YU9 I;  4E32 A;  2OTL 1;  4TNU A;  2NVY I;  4HGY A;  3CCS 1;  1Y8C A;  3GTM I;  4A3G I;  1PFT A;  3D6W A;  3H0G I;  2IZ4 A;  1YIT Z;  1VQ7 Z;  2VUM I;  2V3V A;  3OW2 Z;  1ZH1 A;  3PO3 I;  5C44 I;  3KIH A;  4EWC A;  2JA5 I;  4HH4 A;  1QXF A;  1TWF I;  5A2Q f;  3I56 1;  1QF8 A;  1Q86 2;  3NFZ A;  1W2B Z;  2M6N A;  2HU9 A;  1KD1 1;  2JA6 I;  3KIF A;  1YUA A;  2JIQ A;  3M4O I;  1I50 I;  4X6A I;  1WII A;  1TWC I;  4DK1 A;  3CCU Z;  3CPW Y;  3CMA Z;  2RHB A;  2KI7 B;  5LL6 f;  3CME 1;  4NB8 A;  2O53 A;  2PM9 A;  3BG1 B;  2QRC B;  4QTT A;  1VQ4 Z;  1VQ5 Z;  2K3R A;  3QWU A;  2IV2 X;  1FDI A;  2QRD B;  2P28 A;  5C4J I;  1VLA A;  2GTH A;  3M3Y I;  1P9N A;  2I3C A;  3CMA 1;  3S15 I;  2PK7 A;  4XX2 A;  2YAD A;  3GTJ I;  1QVF Z;  4RVD A;  3GTL I;  4RVF A;  5FLX f;  3HOV I;  1VQ8 1;  2E2I I;  1K9M 1;  4CL1 A;  3HOX I;  3NH4 A;  1USP B;  3CCQ 1;  2QLV B;  2JIO A;  2Q51 A;  2OZK A;  4RS4 A;  3JAM b;  5IT9 f;  3S2H I;  2LIY A;  2M48 A;  3I55 1;  1YI2 1;  1Q16 A;  1S7M A;  3S14 I;  3BG0 B;  1X0T A;  4RVG A;  4DGL A;  3I4N I;  2QA4 1;  3HOW I;  5C3E I;  4NBE A;  1YUK A;  3J80 f;  3OW2 Y;  4RV9 A;  2KPI A;  1QVG Y;  1K83 I;  1K73 1;  1Q82 2;  2QKD A;  2QEX 1;  1NJI 1;  1M1K 1;  1JJ2 Z;  5C4X I;  2F4M A;  1NP6 A;  1K8A 1;  4NBC A;  1YI2 Z;  1VQ6 Z;  3NH8 A;  5A2Q b;  1RLY A;  3FQM A;  2NVQ I;  3G4S Z;  2JUB A;  1VQK 1;  3S16 I;  2DE5 A;  2OOX B;  2JR6 A;  3D9X A;  3CCR Z;  3HOU I;  1R9T I;  3CC7 Z;  1S72 Z;  3G71 Z;  4BXX I;  3J81 b;  3PO2 I;  1WZN A;  1QVF Y;  3S1N I;  2NVT I;  2OOY B;  5AN9 F;  3CCJ Z;  3EED A;  3CCQ Z;  2JA8 I;  2JMO A;  2R6M A;  1USP A;  2Q4Z A;  3CCM 1;  1YJ9 1;  2E2J I;  3CPW Z;  2W03 A;  3CXC Y;  1YJW Z;  1Q81 1;  3TE5 B;  1YJN Z;  1VQ7 1;  3VMI A;  2E9H A;  3I07 A;  2VUG A;  1Q86 1;  1M90 1;  4A3B I;  3FQQ A;  2EGT A;  3U50 C;  1KD1 2;  3VMH A;  2RPR A;  4MRI A;  4A3D I;  1YHQ 1;  4HGZ A;  3JAM f;  1JJ2 Y;  3NDI A;  3G4S 1;  3CCL Z;  2V45 A;  4A3C I;  4A3J I;  3CC2 Z;  4MD9 A;  4E2Z A;  2QEX Z;  1VQP Z;  2OTJ 1;  2BJO A;  1Z01 A;  4NBF A;  4NOZ A;  4NBD A;  2DE7 A;  2R92 I;  1Y1V I;  3HOZ I;  4RVH A;  1VQL Z;  1YJW 1;  1YJN 1;  3H3V J;  2OTL Z;  2JS4 A;  5T67 A;  4A93 I;  3I4M I;  3F3P C;  3G6E 1;  4A3F I;  2V8I A;  2VPX A;  5FLM I;  2V8J A;  1FDO A;  3S1M I;  1RQF A;  2DE6 A;  3GTK I;  1QVG Z;  1Q81 2;  3HKZ A;  2NAP A;  2IZ3 A;  3MON A;  5CM2 M;  3GKQ A;  3J81 f;  1VQM Z;  3CC7 1;  2Y0S A;  2NVX I;  5FLX b;  1Y1W I;  3CCR 1;  2JNY A;  3GTM S;  2OTJ Z;  4NH1 C;  1SIW A;  4A3K I;  1VQO Z;  5IT9 b;  3CCV Z;  1Z03 A;  2P3Y A;  3F3F C;  3G6E Z;  1K73 2;  2VPZ A;  1KC8 2;  1VQN Z;  4Y7N I;  3VB9 A;  1N2F A;  3GTG I;  2WB1 A;  1TWH I;  1WW9 A;  1K8A 2;  1Q7Y 1;  3CME Z;  4BBS I;  3P5J B;  3CCE 1;  2HF1 A;  2VPY A;  4QTU A;  4E31 A;  4E2Y A;  4MD8 A;  2QA4 Z;  4MD7 A;  2QR1 B;  1N8R 1;  1I3Q I;  1VQP 1;  1ZB8 A;  2WAQ A;  1AA6 A;  3S1Q I;  4E2W A;  3CXC Z;  1SFO I;  2JIR A;  1VQ9 1;  3VTN A;  2RIQ A;  3K7A I;  1X3W A;  4NB9 A;  1RO4 A;  1YIT 1;  4MH4 A;  1Y1V S;  3NDJ A;  2QRE B;  3IFU A;  1VQL 1;  3S17 I;  1ZB9 A;  1YIJ Z;  4A3M I;  1VQM 1;  2JIM A;  4AYB A;  5D1O B;  4E2X A;  1S72 1;  4BY1 I;  1JWH C;  1X3Z A;  1WCM I;  3IF8 A;  4NFR A;  5D1P A;  1YJ9 Z;  3I56 Z;  2E7Z A;  3GTO I;  1W2B Y;  4A3L I;  1TWG I;  5T64 A;  1RO0 A;  1VQ5 1;  2F4O A;  3D2L A;  4E30 A;  1KC8 1;  4NBG A;  2R7Z I;  1M90 2;  3CC4 Z;  3CQZ I;  1VQ8 Z;  3GTQ I;  2RT9 A;  2VF1 A;  4NBB A;  3IR7 A;  1WJ2 A;  3S1R I;  4A3E I;  2LFU A;  4DQY B;  4NBA A;  1KRL A;  2H85 A;  5IP7 I;  1LQL A;  1KQS Z;  1Z02 A;  3RZD I;  1ML8 A;  2GTI A;  4Y52 I;  2J6A A;  2RBL A;  2K5R A;  3RZO I;  2JA7 I;  4MXU A;  3ESW A;  3CD6 1;  2AYD A;  1QYP A;  3T4N B;  1K9M 2;  3MZL B;  2W04 A;  1NUI A;  3IX0 A;  2JIP A;  2E2H I;  1RO2 A;  3CCS Z;  3J80 b;  1YIJ 1;  2G2K A;  2AKL A;  3GCF A;  5T6B A;  3HOY I;  5IP9 I;  3I55 Z;  3CC2 1;  4BY7 I;  1VQ9 Z;  3CCJ 1;  4BBR I;  3CD6 Z;  2B63 I;  3CCL 1;  1TFI A;  1VQ6 1;  2GU2 A;  2VPW A;  4S1T A;  3S2D I;  2ZAE B;  2O4H A;  1VQ4 1;  1RNI A;  1DL6 A;  5D1O A;  2V8K A;  1Q82 1;  1NJI 2;  4MON A;  1M1K 2;  4A3I I;  3MZK B;  2R93 I;  3CCE Z;  3NH5 A;  3G71 1;  3VMG A;  1TWA I;  3CCU 1;  3CC4 1;  1L1O C;  1VQN 1;  2PMZ A;  1VQK Z;  1Q7Y 2;  4NBH A;  1KQS Y;  3Q87 A;  3CCM Z;  1I6H I;  3LUS A;  4E33 A;  3J7A 4;  3PO3 S;  3TDH B;  3FKI I;  1N8R 2;  3CCV 1;  2LEX A; 
#chains in the Genus database with same CATH homology
 1VQO 1;  1YHQ Z;  3GTP I;  3EER A;  2YU9 I;  4E32 A;  2OTL 1;  4TNU A;  2NVY I;  4HGY A;  3CCS 1;  3GTM I;  4A3G I;  1PFT A;  3D6W A;  3H0G I;  2IZ4 A;  1YIT Z;  1VQ7 Z;  2VUM I;  3OW2 Z;  1ZH1 A;  3PO3 I;  5C44 I;  3KIH A;  4EWC A;  2JA5 I;  4HH4 A;  1TWF I;  5A2Q f;  3I56 1;  1QF8 A;  1Q86 2;  3NFZ A;  1W2B Z;  2M6N A;  2HU9 A;  1KD1 1;  2JA6 I;  3KIF A;  1YUA A;  3M4O I;  1I50 I;  4X6A I;  1WII A;  1TWC I;  4DK1 A;  3CCU Z;  3CPW Y;  3CMA Z;  2RHB A;  2KI7 B;  5LL6 f;  3CME 1;  4NB8 A;  2O53 A;  2PM9 A;  3BG1 B;  2QRC B;  4QTT A;  1VQ4 Z;  1VQ5 Z;  2K3R A;  3QWU A;  2QRD B;  2P28 A;  5C4J I;  1VLA A;  2GTH A;  3M3Y I;  1P9N A;  2I3C A;  3CMA 1;  3S15 I;  2PK7 A;  4XX2 A;  2YAD A;  3GTJ I;  1QVF Z;  4RVD A;  3GTL I;  4RVF A;  5FLX f;  3HOV I;  1VQ8 1;  2E2I I;  1K9M 1;  4CL1 A;  3HOX I;  3NH4 A;  1USP B;  3CCQ 1;  2QLV B;  2Q51 A;  2OZK A;  4RS4 A;  3JAM b;  5IT9 f;  3S2H I;  2LIY A;  2M48 A;  3I55 1;  1YI2 1;  1S7M A;  3S14 I;  3BG0 B;  1X0T A;  4RVG A;  4DGL A;  3I4N I;  2QA4 1;  3HOW I;  5C3E I;  4NBE A;  1YUK A;  3J80 f;  3OW2 Y;  4RV9 A;  2KPI A;  1QVG Y;  1K83 I;  1K73 1;  1Q82 2;  2QKD A;  2QEX 1;  1NJI 1;  1M1K 1;  1JJ2 Z;  5C4X I;  2F4M A;  1NP6 A;  1K8A 1;  4NBC A;  1YI2 Z;  1VQ6 Z;  3NH8 A;  5A2Q b;  1RLY A;  3FQM A;  2NVQ I;  3G4S Z;  2JUB A;  1VQK 1;  3S16 I;  2DE5 A;  2OOX B;  2JR6 A;  3D9X A;  3CCR Z;  3HOU I;  1R9T I;  3CC7 Z;  1S72 Z;  3G71 Z;  4BXX I;  3J81 b;  3PO2 I;  1QVF Y;  3S1N I;  2NVT I;  2OOY B;  5AN9 F;  3CCJ Z;  3EED A;  3CCQ Z;  2JA8 I;  2JMO A;  2R6M A;  1USP A;  2Q4Z A;  3CCM 1;  1YJ9 1;  2E2J I;  2W03 A;  3CXC Y;  3CPW Z;  1YJW Z;  1Q81 1;  3TE5 B;  1YJN Z;  1VQ7 1;  3VMI A;  2E9H A;  3I07 A;  2VUG A;  1Q86 1;  1M90 1;  4A3B I;  3FQQ A;  2EGT A;  3U50 C;  1KD1 2;  3VMH A;  2RPR A;  4MRI A;  4A3D I;  1YHQ 1;  4HGZ A;  3JAM f;  1JJ2 Y;  3NDI A;  3G4S 1;  3CCL Z;  4A3C I;  4A3J I;  3CC2 Z;  4MD9 A;  4E2Z A;  2QEX Z;  1VQP Z;  2OTJ 1;  2BJO A;  1Z01 A;  4NBF A;  4NOZ A;  4NBD A;  2DE7 A;  2R92 I;  1Y1V I;  3HOZ I;  1VQL Z;  4RVH A;  1YJW 1;  1YJN 1;  3H3V J;  2OTL Z;  2JS4 A;  5T67 A;  4A93 I;  3I4M I;  3F3P C;  3G6E 1;  4A3F I;  2V8I A;  5FLM I;  2V8J A;  3S1M I;  1RQF A;  2DE6 A;  3GTK I;  1QVG Z;  1Q81 2;  3HKZ A;  2IZ3 A;  3MON A;  5CM2 M;  3GKQ A;  3J81 f;  1VQM Z;  3CC7 1;  2Y0S A;  2NVX I;  5FLX b;  1Y1W I;  3CCR 1;  2JNY A;  3GTM S;  2OTJ Z;  4NH1 C;  4A3K I;  1VQO Z;  5IT9 b;  3CCV Z;  1Z03 A;  2P3Y A;  3F3F C;  3G6E Z;  1K73 2;  1KC8 2;  1VQN Z;  4Y7N I;  3VB9 A;  1N2F A;  3GTG I;  2WB1 A;  1TWH I;  1WW9 A;  1K8A 2;  1Q7Y 1;  3CME Z;  4BBS I;  3P5J B;  3CCE 1;  2HF1 A;  4QTU A;  4E2Y A;  4E31 A;  4MD8 A;  2QA4 Z;  4MD7 A;  2QR1 B;  1N8R 1;  1I3Q I;  1VQP 1;  1ZB8 A;  2WAQ A;  3S1Q I;  4E2W A;  3CXC Z;  1SFO I;  1VQ9 1;  3VTN A;  2RIQ A;  3K7A I;  1X3W A;  4NB9 A;  1RO4 A;  1YIT 1;  4MH4 A;  1Y1V S;  3NDJ A;  2QRE B;  3IFU A;  1VQL 1;  3S17 I;  1ZB9 A;  1YIJ Z;  4A3M I;  1VQM 1;  4AYB A;  5D1O B;  4E2X A;  1S72 1;  4BY1 I;  1JWH C;  1X3Z A;  1WCM I;  3IF8 A;  4NFR A;  5D1P A;  1YJ9 Z;  3I56 Z;  3GTO I;  1W2B Y;  4A3L I;  1TWG I;  5T64 A;  1RO0 A;  1VQ5 1;  2F4O A;  4E30 A;  1KC8 1;  4NBG A;  2R7Z I;  1M90 2;  3CC4 Z;  3CQZ I;  1VQ8 Z;  3GTQ I;  2RT9 A;  2VF1 A;  4NBB A;  3S1R I;  4A3E I;  2LFU A;  4DQY B;  4NBA A;  1KRL A;  2H85 A;  5IP7 I;  1LQL A;  1KQS Z;  1Z02 A;  3RZD I;  1ML8 A;  2GTI A;  4Y52 I;  2J6A A;  2RBL A;  2K5R A;  3RZO I;  2JA7 I;  4MXU A;  3ESW A;  3CD6 1;  1QYP A;  3T4N B;  1K9M 2;  3MZL B;  2W04 A;  1NUI A;  3IX0 A;  2E2H I;  1RO2 A;  3CCS Z;  3J80 b;  1YIJ 1;  2G2K A;  2AKL A;  3GCF A;  5T6B A;  3HOY I;  5IP9 I;  3I55 Z;  3CC2 1;  4BY7 I;  1VQ9 Z;  3CCJ 1;  4BBR I;  3CD6 Z;  2B63 I;  3CCL 1;  1TFI A;  1VQ6 1;  2GU2 A;  4S1T A;  3S2D I;  2ZAE B;  2O4H A;  1VQ4 1;  1RNI A;  1DL6 A;  5D1O A;  2V8K A;  1Q82 1;  1NJI 2;  4MON A;  1M1K 2;  4A3I I;  3MZK B;  2R93 I;  3CCE Z;  3NH5 A;  3G71 1;  3VMG A;  1TWA I;  3CCU 1;  3CC4 1;  1L1O C;  1VQN 1;  2PMZ A;  1VQK Z;  1Q7Y 2;  4NBH A;  1KQS Y;  3Q87 A;  3CCM Z;  1I6H I;  3LUS A;  4E33 A;  3J7A 4;  3PO3 S;  3TDH B;  3FKI I;  1N8R 2;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...