3KIHA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib2-d2-15)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
90
Chain Sequence
GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGYLYAVSKDKLYKAPPPQSDTDNWIARATEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords 5-bladed beta-propeller lectin
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
total genus 12
structure length 90
sequence length 92
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kihA00
3KIHA 3KIFA
chains in the Genus database with same CATH superfamily
3FKII 1QVGY 4A3CI 3G71Z 3CCQ1 3CPWY 1ZB9A 3VB9A 2PM9A 1K8A2 1VQ8Z 2JIQA 3MZLB 2KPIA 1RLYA 1VQ91 3D6WA 3EEDA 1RO2A 4QTTA 2K3RA 1KRLA 3GCFA 2K5RA 4DGLA 2NVQI 2OOXB 1RO4A 1JJ2Z 3CD61 4EWCA 1PFTA 3CCJZ 1KC82 1VQKZ 1Q862 1YJNZ 4A3KI 4NBEA 3CCL1 4HGZA 1VQM1 1K8A1 1QXFA 4MRIA 1W2BZ 5T67A 4A3LI 1N8R2 3GTJI 1YJN1 4A3II 2E2HI 1P9NA 5D1OA 1AA6A 3GTPI 5IP7I 1Q16A 3CXCZ 1YITZ 3I4MI 5FLXb 1TWFI 4E2ZA 4NH1C 2JIMA 2R6MA 2JIPA 2WB1A 1Z02A 4E33A 1S7MA 1USPB 1YIT1 2KI7B 1VQ7Z 4MXUA 1Q822 1YJWZ 1Q7Y1 2NVTI 2V8KA 3J80b 1N8R1 4A3DI 3ESWA 2F4MA 5FLMI 1YI2Z 1VQLZ 1Y1VS 3NH5A 2OTJ1 2VPXA 2JMOA 5C44I 2YU9I 1VQ41 2M48A 1NP6A 2H85A 3BG1B 3PO2I 5LL6f 3NH4A 3S2HI 2R93I 3G4SZ 3S16I 3S17I 2JA8I 3GTKI 4A3EI 1Y8CA 1Q821 2RBLA 1QF8A 2NVXI 3P5JB 2DE6A 1N2FA 2IZ3A 3OW2Y 1JJ2Y 3CCUZ 2V8IA 2ZAEB 3CC71 3JAMb 3CCVZ 4E30A 1X0TA 5AN9F 2JIRA 4NBDA 1FDIA 3S2DI 2Y0SA 3J7A4 2VPYA 4BBRI 4DK1A 4E31A 1VQN1 1NJI2 3HOVI 1K9M2 2HF1A 2VF1A 1Z01A 2W04A 3HOZI 4NBGA 5IP9I 4DQYB 1X3WA 4A3BI 3CC4Z 4TNUA 2OZKA 3CMAZ 3J81b 3I561 3HOUI 4NB8A 3IR7A 2E7ZA 3G711 1TWCI 1TWHI 3F3PC 1VQ81 3CMA1 1NJI1 1K9M1 2QREB 1WJ2A 1YUAA 2JS4A 3T4NB 2NAPA 1S72Z 1YUKA 4RV9A 2J6AA 3IFUA 2AYDA 3G6EZ 3CCEZ 3EERA 3CCJ1 1VQK1 1VQ6Z 3HOWI 1QVFY 1S721 2JIOA 2O53A 4AYBA 2E2JI 4E32A 1K83I 1TFIA 1L1OC 3IF8A 1VQOZ 3CCRZ 1KC81 5FLXf 3HOXI 1Q861 4MD9A 2PK7A 5T6BA 2GTIA 1I6HI 5A2Qf 1Q812 2HU9A 2QKDA 3J80f 1QVGZ 1SIWA 1TWAI 1KQSY 3QWUA 3CPWZ 3NDJA 4HH4A 4A3FI 1VQ71 3H0GI 1YIJZ 5IT9b 4S1TA 4NBFA 1YJW1 3H3VJ 2LEXA 4MD7A 4NB9A 1VQL1 1YI21 1USPA 1FDOA 2O4HA 2M6NA 3HKZA 1Y1WI 1YHQZ 3CMEZ 2OTLZ 2P3YA 3S1MI 1JWHC 3I07A 2JA5I 3G4S1 3FQMA 4QTUA 3GTMS 1VLAA 3M3YI 3RZDI 1YHQ1 3PO3I 1ML8A 5CM2M 3CCSZ 1M902 2RIQA 3RZOI 4HGYA 1Y1VI 2VUMI 2AKLA 3CCMZ 5D1PA 3MZKB 1W2BY 3IX0A 3CCU1 2QEXZ 1SFOI 1DL6A 4RVHA 4BY1I 3K7AI 2B63I 2IZ4A 3CCV1 3NDIA 3CXCY 4NBHA 2QA4Z 2VPWA 3I4NI 2OOYB 1VQPZ 3S1NI 3I55Z 1ZH1A 1M901 3TDHB 1YJ9Z 4NFRA 3VMHA 2V45A 4RS4A 2DE5A 3J81f 1WZNA 4RVGA 2LFUA 3NH8A 1M1K2 3D9XA 4MONA 1RNIA 3CC41 1VQ9Z 2RHBA 4NOZA 2JR6A 5T64A 2DE7A 1K732 2R7ZI 4XX2A 4NBAA 1WIIA 3HOYI 1RQFA 3CD6Z 4Y52I 1I3QI 1VQ5Z 2R92I 2QLVB 3GKQA 5C4XI 3CCLZ 3MONA 5D1OB 2W03A 1VQMZ 3FQQA 1M1K1 3OW2Z 2VPZA 2V8JA 1VQ51 4A3GI 4BXXI 4NBBA 3G6E1 3CCE1 1K731 1NUIA 3GTGI 1VQ61 3GTQI 4BBSI 3CC2Z 4RVDA 2RPRA 3D2LA 4A3JI 1Q7Y2 2E9HA 3U50C 1VQO1 3CCR1 1KD12 2QRCB 2WAQA 3CC21 1RO0A 2P28A 2F4OA 2PMZA 2RT9A 3S14I 2V3VA 5IT9f 2VUGA 3TE5B 2I3CA 3S15I 3KIHA 2OTJZ 5C3EI 2BJOA 1VQ4Z 5A2Qb 3PO3S 2YADA 2NVYI 1YIJ1 4Y7NI 1Q811 4E2WA 1KD11 2Q4ZA 3GTOI 3S1QI 3S1RI 4BY7I 1ZB8A 3M4OI 1QYPA 1LQLA 3CME1 2IV2X 2OTL1 1WW9A 3NFZA 1I50I 2GTHA 2GU2A 4A3MI 4X6AI 2LIYA 1QVFZ 2G2KA 4MH4A 2E2II 3VMIA 3JAMf 2Q51A 4NBCA 2JA6I 3CCS1 4CL1A 3CC7Z 2JUBA 4E2YA 3Q87A 3CCM1 1R9TI 3VTNA 3CQZI 1X3ZA 2JA7I 2QEX1 4MD8A 1VQNZ 1KQSZ 1Z03A 2QRDB 1TWGI 3CCQZ 3GTMI 3VMGA 3GTLI 3F3FC 2JNYA 1WCMI 2QA41 4E2XA 3LUSA 4A93I 2QR1B 4RVFA 1VQP1 3I551 3BG0B 1YJ91 5C4JI 3I56Z 2EGTA 3KIFA
chains in the Genus database with same CATH topology
3FKII 1QVGY 4A3CI 3G71Z 3CCQ1 3CPWY 1ZB9A 3VB9A 2PM9A 1K8A2 1VQ8Z 3MZLB 2KPIA 1RLYA 1VQ91 3D6WA 3EEDA 1RO2A 4QTTA 2K3RA 1KRLA 3GCFA 2K5RA 4DGLA 2NVQI 2OOXB 1RO4A 1JJ2Z 3CD61 4EWCA 1PFTA 3CCJZ 1KC82 1VQKZ 1Q862 1YJNZ 4A3KI 4NBEA 3CCL1 4HGZA 1VQM1 1K8A1 4MRIA 1W2BZ 5T67A 4A3LI 1N8R2 3GTJI 1YJN1 4A3II 2E2HI 1P9NA 5D1OA 3GTPI 5IP7I 1YITZ 3CXCZ 3I4MI 5FLXb 1TWFI 4E2ZA 4NH1C 2R6MA 2WB1A 1Z02A 4E33A 1S7MA 1USPB 1YIT1 2KI7B 1VQ7Z 4MXUA 1Q822 1YJWZ 1Q7Y1 2NVTI 2V8KA 3J80b 1N8R1 4A3DI 3ESWA 2F4MA 5FLMI 1YI2Z 1VQLZ 1Y1VS 3NH5A 2OTJ1 2JMOA 5C44I 2YU9I 1VQ41 2M48A 1NP6A 2H85A 3BG1B 3PO2I 5LL6f 3NH4A 3S2HI 2R93I 3G4SZ 3S16I 3S17I 2JA8I 3GTKI 4A3EI 1Q821 2RBLA 1QF8A 2NVXI 3P5JB 2DE6A 1N2FA 2IZ3A 3OW2Y 1JJ2Y 3CCUZ 2V8IA 2ZAEB 3CC71 3JAMb 3CCVZ 4E30A 1X0TA 5AN9F 4NBDA 3S2DI 2Y0SA 3J7A4 4E31A 4BBRI 4DK1A 1VQN1 1NJI2 3HOVI 1K9M2 2HF1A 2VF1A 1Z01A 2W04A 3HOZI 4NBGA 5IP9I 4DQYB 1X3WA 4A3BI 3CC4Z 4TNUA 2OZKA 3CMAZ 3J81b 3I561 3HOUI 4NB8A 3G711 1TWCI 1TWHI 3F3PC 1VQ81 3CMA1 1NJI1 1K9M1 2QREB 1YUAA 2JS4A 3T4NB 1S72Z 1YUKA 4RV9A 2J6AA 3IFUA 3G6EZ 3CCEZ 3EERA 3CCJ1 1VQK1 1VQ6Z 3HOWI 1QVFY 1S721 2O53A 4AYBA 2E2JI 4E32A 1K83I 1TFIA 1L1OC 3IF8A 1VQOZ 3CCRZ 1KC81 5FLXf 3HOXI 1Q861 4MD9A 2PK7A 5T6BA 2GTIA 1I6HI 5A2Qf 1Q812 2HU9A 2QKDA 3J80f 1QVGZ 1KQSY 1TWAI 3QWUA 3CPWZ 3NDJA 4HH4A 4A3FI 1VQ71 3H0GI 1YIJZ 5IT9b 4S1TA 4NBFA 1YJW1 3H3VJ 4MD7A 4NB9A 1VQL1 1YI21 1USPA 2O4HA 2M6NA 3HKZA 1Y1WI 1YHQZ 3CMEZ 2OTLZ 2P3YA 3S1MI 1JWHC 3I07A 2JA5I 3G4S1 3FQMA 4QTUA 3GTMS 1VLAA 3M3YI 3RZDI 1YHQ1 3PO3I 1ML8A 5CM2M 3CCSZ 1M902 2RIQA 3RZOI 4HGYA 1Y1VI 2VUMI 2AKLA 3CCMZ 5D1PA 3MZKB 1W2BY 3IX0A 3CCU1 2QEXZ 1SFOI 1DL6A 4RVHA 4BY1I 3K7AI 2B63I 2IZ4A 3CCV1 3NDIA 3CXCY 4NBHA 2QA4Z 3S1NI 3I4NI 2OOYB 1VQPZ 3I55Z 1ZH1A 1M901 3TDHB 1YJ9Z 4NFRA 3VMHA 4RS4A 2DE5A 3J81f 4RVGA 2LFUA 3NH8A 1M1K2 3D9XA 4MONA 1RNIA 3CC41 1VQ9Z 2RHBA 4NOZA 2JR6A 5T64A 2DE7A 1K732 2R7ZI 4XX2A 4NBAA 1WIIA 3HOYI 1RQFA 3CD6Z 4Y52I 1I3QI 1VQ5Z 2R92I 2QLVB 3GKQA 5C4XI 3CCLZ 3MONA 5D1OB 2W03A 1VQMZ 3FQQA 1M1K1 3OW2Z 2V8JA 1VQ51 4A3GI 4BXXI 4NBBA 3G6E1 3CCE1 1K731 1NUIA 3GTGI 1VQ61 3GTQI 4BBSI 3CC2Z 4RVDA 2RPRA 4A3JI 1Q7Y2 2E9HA 3U50C 1VQO1 3CCR1 1KD12 2QRCB 2WAQA 3CC21 1RO0A 2P28A 2F4OA 2PMZA 2RT9A 3S14I 5IT9f 2VUGA 3TE5B 2I3CA 3S15I 3KIHA 2OTJZ 5C3EI 2BJOA 1VQ4Z 5A2Qb 3PO3S 2YADA 2NVYI 1YIJ1 4Y7NI 1Q811 4E2WA 1KD11 2Q4ZA 3GTOI 3S1QI 3S1RI 4BY7I 1ZB8A 3M4OI 1QYPA 1LQLA 3CME1 2OTL1 1WW9A 3NFZA 1I50I 2GTHA 2GU2A 4A3MI 4X6AI 2LIYA 1QVFZ 2G2KA 4MH4A 2E2II 3VMIA 3JAMf 2Q51A 4NBCA 2JA6I 3CCS1 4CL1A 3CC7Z 2JUBA 4E2YA 3Q87A 3CCM1 1R9TI 3VTNA 3CQZI 1X3ZA 2JA7I 2QEX1 4MD8A 1VQNZ 1KQSZ 1Z03A 2QRDB 1TWGI 3CCQZ 3GTMI 3VMGA 3GTLI 3F3FC 2JNYA 1WCMI 2QA41 4E2XA 3LUSA 4A93I 2QR1B 4RVFA 1VQP1 3I551 3BG0B 1YJ91 5C4JI 3I56Z 2EGTA 3KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIH A;  3KIF A; 
#chains in the Genus database with same CATH topology
 3FKI I;  1QVG Y;  4A3C I;  3G71 Z;  3CCQ 1;  3CPW Y;  1ZB9 A;  3VB9 A;  2PM9 A;  1K8A 2;  1VQ8 Z;  2JIQ A;  3MZL B;  2KPI A;  1RLY A;  1VQ9 1;  3D6W A;  3EED A;  1RO2 A;  4QTT A;  2K3R A;  1KRL A;  3GCF A;  2K5R A;  4DGL A;  2NVQ I;  2OOX B;  1RO4 A;  1JJ2 Z;  3CD6 1;  4EWC A;  1PFT A;  3CCJ Z;  1KC8 2;  1VQK Z;  1Q86 2;  1YJN Z;  4A3K I;  4NBE A;  3CCL 1;  4HGZ A;  1VQM 1;  1K8A 1;  1QXF A;  4MRI A;  1W2B Z;  5T67 A;  4A3L I;  1N8R 2;  3GTJ I;  1YJN 1;  4A3I I;  2E2H I;  1P9N A;  5D1O A;  1AA6 A;  3GTP I;  5IP7 I;  1Q16 A;  3CXC Z;  1YIT Z;  3I4M I;  5FLX b;  1TWF I;  4E2Z A;  4NH1 C;  2JIM A;  2R6M A;  2JIP A;  2WB1 A;  1Z02 A;  4E33 A;  1S7M A;  1USP B;  1YIT 1;  2KI7 B;  1VQ7 Z;  4MXU A;  1Q82 2;  1YJW Z;  1Q7Y 1;  2NVT I;  2V8K A;  3J80 b;  1N8R 1;  4A3D I;  3ESW A;  2F4M A;  5FLM I;  1YI2 Z;  1VQL Z;  1Y1V S;  3NH5 A;  2OTJ 1;  2VPX A;  2JMO A;  5C44 I;  2YU9 I;  1VQ4 1;  2M48 A;  1NP6 A;  2H85 A;  3BG1 B;  3PO2 I;  5LL6 f;  3NH4 A;  3S2H I;  2R93 I;  3G4S Z;  3S16 I;  3S17 I;  2JA8 I;  3GTK I;  4A3E I;  1Y8C A;  1Q82 1;  2RBL A;  1QF8 A;  2NVX I;  3P5J B;  2DE6 A;  1N2F A;  2IZ3 A;  3OW2 Y;  1JJ2 Y;  3CCU Z;  2V8I A;  2ZAE B;  3CC7 1;  3JAM b;  3CCV Z;  4E30 A;  1X0T A;  5AN9 F;  2JIR A;  4NBD A;  1FDI A;  3S2D I;  2Y0S A;  3J7A 4;  2VPY A;  4BBR I;  4DK1 A;  4E31 A;  1VQN 1;  1NJI 2;  3HOV I;  1K9M 2;  2HF1 A;  2VF1 A;  1Z01 A;  2W04 A;  3HOZ I;  4NBG A;  5IP9 I;  4DQY B;  1X3W A;  4A3B I;  3CC4 Z;  4TNU A;  2OZK A;  3CMA Z;  3J81 b;  3I56 1;  3HOU I;  4NB8 A;  3IR7 A;  2E7Z A;  3G71 1;  1TWC I;  1TWH I;  3F3P C;  1VQ8 1;  3CMA 1;  1NJI 1;  1K9M 1;  2QRE B;  1WJ2 A;  1YUA A;  2JS4 A;  3T4N B;  2NAP A;  1S72 Z;  1YUK A;  4RV9 A;  2J6A A;  3IFU A;  2AYD A;  3G6E Z;  3CCE Z;  3EER A;  3CCJ 1;  1VQK 1;  1VQ6 Z;  3HOW I;  1QVF Y;  1S72 1;  2JIO A;  2O53 A;  4AYB A;  2E2J I;  4E32 A;  1K83 I;  1TFI A;  1L1O C;  3IF8 A;  1VQO Z;  3CCR Z;  1KC8 1;  5FLX f;  3HOX I;  1Q86 1;  4MD9 A;  2PK7 A;  5T6B A;  2GTI A;  1I6H I;  5A2Q f;  1Q81 2;  2HU9 A;  2QKD A;  3J80 f;  1QVG Z;  1SIW A;  1TWA I;  1KQS Y;  3QWU A;  3CPW Z;  3NDJ A;  4HH4 A;  4A3F I;  1VQ7 1;  3H0G I;  1YIJ Z;  5IT9 b;  4S1T A;  4NBF A;  1YJW 1;  3H3V J;  2LEX A;  4MD7 A;  4NB9 A;  1VQL 1;  1YI2 1;  1USP A;  1FDO A;  2O4H A;  2M6N A;  3HKZ A;  1Y1W I;  1YHQ Z;  3CME Z;  2OTL Z;  2P3Y A;  3S1M I;  1JWH C;  3I07 A;  2JA5 I;  3G4S 1;  3FQM A;  4QTU A;  3GTM S;  1VLA A;  3M3Y I;  3RZD I;  1YHQ 1;  3PO3 I;  1ML8 A;  5CM2 M;  3CCS Z;  1M90 2;  2RIQ A;  3RZO I;  4HGY A;  1Y1V I;  2VUM I;  2AKL A;  3CCM Z;  5D1P A;  3MZK B;  1W2B Y;  3IX0 A;  3CCU 1;  2QEX Z;  1SFO I;  1DL6 A;  4RVH A;  4BY1 I;  3K7A I;  2B63 I;  2IZ4 A;  3CCV 1;  3NDI A;  3CXC Y;  4NBH A;  2QA4 Z;  2VPW A;  3I4N I;  2OOY B;  1VQP Z;  3S1N I;  3I55 Z;  1ZH1 A;  1M90 1;  3TDH B;  1YJ9 Z;  4NFR A;  3VMH A;  2V45 A;  4RS4 A;  2DE5 A;  3J81 f;  1WZN A;  4RVG A;  2LFU A;  3NH8 A;  1M1K 2;  3D9X A;  4MON A;  1RNI A;  3CC4 1;  1VQ9 Z;  2RHB A;  4NOZ A;  2JR6 A;  5T64 A;  2DE7 A;  1K73 2;  2R7Z I;  4XX2 A;  4NBA A;  1WII A;  3HOY I;  1RQF A;  3CD6 Z;  4Y52 I;  1I3Q I;  1VQ5 Z;  2R92 I;  2QLV B;  3GKQ A;  5C4X I;  3CCL Z;  3MON A;  5D1O B;  2W03 A;  1VQM Z;  3FQQ A;  1M1K 1;  3OW2 Z;  2VPZ A;  2V8J A;  1VQ5 1;  4A3G I;  4BXX I;  4NBB A;  3G6E 1;  3CCE 1;  1K73 1;  1NUI A;  3GTG I;  1VQ6 1;  3GTQ I;  4BBS I;  3CC2 Z;  4RVD A;  2RPR A;  3D2L A;  4A3J I;  1Q7Y 2;  2E9H A;  3U50 C;  1VQO 1;  3CCR 1;  1KD1 2;  2QRC B;  2WAQ A;  3CC2 1;  1RO0 A;  2P28 A;  2F4O A;  2PMZ A;  2RT9 A;  3S14 I;  2V3V A;  5IT9 f;  2VUG A;  3TE5 B;  2I3C A;  3S15 I;  3KIH A;  2OTJ Z;  5C3E I;  2BJO A;  1VQ4 Z;  5A2Q b;  3PO3 S;  2YAD A;  2NVY I;  1YIJ 1;  4Y7N I;  1Q81 1;  4E2W A;  1KD1 1;  2Q4Z A;  3GTO I;  3S1Q I;  3S1R I;  4BY7 I;  1ZB8 A;  3M4O I;  1QYP A;  1LQL A;  3CME 1;  2IV2 X;  2OTL 1;  1WW9 A;  3NFZ A;  1I50 I;  2GTH A;  2GU2 A;  4A3M I;  4X6A I;  2LIY A;  1QVF Z;  2G2K A;  4MH4 A;  2E2I I;  3VMI A;  3JAM f;  2Q51 A;  4NBC A;  2JA6 I;  3CCS 1;  4CL1 A;  3CC7 Z;  2JUB A;  4E2Y A;  3Q87 A;  3CCM 1;  1R9T I;  3VTN A;  3CQZ I;  1X3Z A;  2JA7 I;  2QEX 1;  4MD8 A;  1VQN Z;  1KQS Z;  1Z03 A;  2QRD B;  1TWG I;  3CCQ Z;  3GTM I;  3VMG A;  3GTL I;  3F3F C;  2JNY A;  1WCM I;  2QA4 1;  4E2X A;  3LUS A;  4A93 I;  2QR1 B;  4RVF A;  1VQP 1;  3I55 1;  3BG0 B;  1YJ9 1;  5C4J I;  3I56 Z;  2EGT A;  3KIF A; 
#chains in the Genus database with same CATH homology
 3FKI I;  1QVG Y;  4A3C I;  3G71 Z;  3CCQ 1;  3CPW Y;  1ZB9 A;  3VB9 A;  2PM9 A;  1K8A 2;  1VQ8 Z;  3MZL B;  2KPI A;  1RLY A;  1VQ9 1;  3D6W A;  3EED A;  1RO2 A;  4QTT A;  2K3R A;  1KRL A;  3GCF A;  2K5R A;  4DGL A;  2NVQ I;  2OOX B;  1RO4 A;  1JJ2 Z;  3CD6 1;  4EWC A;  1PFT A;  3CCJ Z;  1KC8 2;  1VQK Z;  1Q86 2;  1YJN Z;  4A3K I;  4NBE A;  3CCL 1;  4HGZ A;  1VQM 1;  1K8A 1;  4MRI A;  1W2B Z;  5T67 A;  4A3L I;  1N8R 2;  3GTJ I;  1YJN 1;  4A3I I;  2E2H I;  1P9N A;  5D1O A;  3GTP I;  5IP7 I;  1YIT Z;  3CXC Z;  3I4M I;  5FLX b;  1TWF I;  4E2Z A;  4NH1 C;  2R6M A;  2WB1 A;  1Z02 A;  4E33 A;  1S7M A;  1USP B;  1YIT 1;  2KI7 B;  1VQ7 Z;  4MXU A;  1Q82 2;  1YJW Z;  1Q7Y 1;  2NVT I;  2V8K A;  3J80 b;  1N8R 1;  4A3D I;  3ESW A;  2F4M A;  5FLM I;  1YI2 Z;  1VQL Z;  1Y1V S;  3NH5 A;  2OTJ 1;  2JMO A;  5C44 I;  2YU9 I;  1VQ4 1;  2M48 A;  1NP6 A;  2H85 A;  3BG1 B;  3PO2 I;  5LL6 f;  3NH4 A;  3S2H I;  2R93 I;  3G4S Z;  3S16 I;  3S17 I;  2JA8 I;  3GTK I;  4A3E I;  1Q82 1;  2RBL A;  1QF8 A;  2NVX I;  3P5J B;  2DE6 A;  1N2F A;  2IZ3 A;  3OW2 Y;  1JJ2 Y;  3CCU Z;  2V8I A;  2ZAE B;  3CC7 1;  3JAM b;  3CCV Z;  4E30 A;  1X0T A;  5AN9 F;  4NBD A;  3S2D I;  2Y0S A;  3J7A 4;  4E31 A;  4BBR I;  4DK1 A;  1VQN 1;  1NJI 2;  3HOV I;  1K9M 2;  2HF1 A;  2VF1 A;  1Z01 A;  2W04 A;  3HOZ I;  4NBG A;  5IP9 I;  4DQY B;  1X3W A;  4A3B I;  3CC4 Z;  4TNU A;  2OZK A;  3CMA Z;  3J81 b;  3I56 1;  3HOU I;  4NB8 A;  3G71 1;  1TWC I;  1TWH I;  3F3P C;  1VQ8 1;  3CMA 1;  1NJI 1;  1K9M 1;  2QRE B;  1YUA A;  2JS4 A;  3T4N B;  1S72 Z;  1YUK A;  4RV9 A;  2J6A A;  3IFU A;  3G6E Z;  3CCE Z;  3EER A;  3CCJ 1;  1VQK 1;  1VQ6 Z;  3HOW I;  1QVF Y;  1S72 1;  2O53 A;  4AYB A;  2E2J I;  4E32 A;  1K83 I;  1TFI A;  1L1O C;  3IF8 A;  1VQO Z;  3CCR Z;  1KC8 1;  5FLX f;  3HOX I;  1Q86 1;  4MD9 A;  2PK7 A;  5T6B A;  2GTI A;  1I6H I;  5A2Q f;  1Q81 2;  2HU9 A;  2QKD A;  3J80 f;  1QVG Z;  1KQS Y;  1TWA I;  3QWU A;  3CPW Z;  3NDJ A;  4HH4 A;  4A3F I;  1VQ7 1;  3H0G I;  1YIJ Z;  5IT9 b;  4S1T A;  4NBF A;  1YJW 1;  3H3V J;  4MD7 A;  4NB9 A;  1VQL 1;  1YI2 1;  1USP A;  2O4H A;  2M6N A;  3HKZ A;  1Y1W I;  1YHQ Z;  3CME Z;  2OTL Z;  2P3Y A;  3S1M I;  1JWH C;  3I07 A;  2JA5 I;  3G4S 1;  3FQM A;  4QTU A;  3GTM S;  1VLA A;  3M3Y I;  3RZD I;  1YHQ 1;  3PO3 I;  1ML8 A;  5CM2 M;  3CCS Z;  1M90 2;  2RIQ A;  3RZO I;  4HGY A;  1Y1V I;  2VUM I;  2AKL A;  3CCM Z;  5D1P A;  3MZK B;  1W2B Y;  3IX0 A;  3CCU 1;  2QEX Z;  1SFO I;  1DL6 A;  4RVH A;  4BY1 I;  3K7A I;  2B63 I;  2IZ4 A;  3CCV 1;  3NDI A;  3CXC Y;  4NBH A;  2QA4 Z;  3S1N I;  3I4N I;  2OOY B;  1VQP Z;  3I55 Z;  1ZH1 A;  1M90 1;  3TDH B;  1YJ9 Z;  4NFR A;  3VMH A;  4RS4 A;  2DE5 A;  3J81 f;  4RVG A;  2LFU A;  3NH8 A;  1M1K 2;  3D9X A;  4MON A;  1RNI A;  3CC4 1;  1VQ9 Z;  2RHB A;  4NOZ A;  2JR6 A;  5T64 A;  2DE7 A;  1K73 2;  2R7Z I;  4XX2 A;  4NBA A;  1WII A;  3HOY I;  1RQF A;  3CD6 Z;  4Y52 I;  1I3Q I;  1VQ5 Z;  2R92 I;  2QLV B;  3GKQ A;  5C4X I;  3CCL Z;  3MON A;  5D1O B;  2W03 A;  1VQM Z;  3FQQ A;  1M1K 1;  3OW2 Z;  2V8J A;  1VQ5 1;  4A3G I;  4BXX I;  4NBB A;  3G6E 1;  3CCE 1;  1K73 1;  1NUI A;  3GTG I;  1VQ6 1;  3GTQ I;  4BBS I;  3CC2 Z;  4RVD A;  2RPR A;  4A3J I;  1Q7Y 2;  2E9H A;  3U50 C;  1VQO 1;  3CCR 1;  1KD1 2;  2QRC B;  2WAQ A;  3CC2 1;  1RO0 A;  2P28 A;  2F4O A;  2PMZ A;  2RT9 A;  3S14 I;  5IT9 f;  2VUG A;  3TE5 B;  2I3C A;  3S15 I;  3KIH A;  2OTJ Z;  5C3E I;  2BJO A;  1VQ4 Z;  5A2Q b;  3PO3 S;  2YAD A;  2NVY I;  1YIJ 1;  4Y7N I;  1Q81 1;  4E2W A;  1KD1 1;  2Q4Z A;  3GTO I;  3S1Q I;  3S1R I;  4BY7 I;  1ZB8 A;  3M4O I;  1QYP A;  1LQL A;  3CME 1;  2OTL 1;  1WW9 A;  3NFZ A;  1I50 I;  2GTH A;  2GU2 A;  4A3M I;  4X6A I;  2LIY A;  1QVF Z;  2G2K A;  4MH4 A;  2E2I I;  3VMI A;  3JAM f;  2Q51 A;  4NBC A;  2JA6 I;  3CCS 1;  4CL1 A;  3CC7 Z;  2JUB A;  4E2Y A;  3Q87 A;  3CCM 1;  1R9T I;  3VTN A;  3CQZ I;  1X3Z A;  2JA7 I;  2QEX 1;  4MD8 A;  1VQN Z;  1KQS Z;  1Z03 A;  2QRD B;  1TWG I;  3CCQ Z;  3GTM I;  3VMG A;  3GTL I;  3F3F C;  2JNY A;  1WCM I;  2QA4 1;  4E2X A;  3LUS A;  4A93 I;  2QR1 B;  4RVF A;  1VQP 1;  3I55 1;  3BG0 B;  1YJ9 1;  5C4J I;  3I56 Z;  2EGT A;  3KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...