3KIHA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib2-d2-15)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
90
Chain Sequence
GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGYLYAVSKDKLYKAPPPQSDTDNWIARATEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-bladed beta-propeller lectin
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
total genus 12
structure length 90
sequence length 92
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kihA00
3KIHA 3KIFA
chains in the Genus database with same CATH superfamily
4NBGA 3HOWI 1VQLZ 2QRDB 3CCMZ 3HKZA 5D1OA 2W03A 5T67A 1KC82 3BG1B 3M4OI 4BY1I 1WJ2A 2NVXI 2QEXZ 3CPWZ 3CC2Z 3P5JB 3IFUA 3S1RI 2WB1A 4MD7A 1VQ91 2V8IA 1VQK1 3HOVI 3GTJI 2VPYA 1YITZ 1RO2A 5C4XI 1Y1VS 2E2JI 2VPXA 1S7MA 1W2BZ 1Y8CA 2RBLA 3G71Z 3F3PC 2VUGA 1TWFI 2Y0SA 1VQ8Z 2P3YA 5C3EI 1Q821 1QYPA 2YADA 3EEDA 3J80b 4S1TA 1PFTA 1K83I 3NH4A 3GTPI 3GKQA 5FLXb 4A93I 2E9HA 3NH8A 2OOXB 2JMOA 4NBHA 2WAQA 3I551 1USPB 3NH5A 3OW2Y 3ESWA 3S17I 1VQNZ 5IP9I 1NJI1 1N8R2 2VF1A 1RNIA 4A3BI 2W04A 3CMEZ 1QXFA 4AYBA 5D1PA 3MONA 5FLXf 5C4JI 2IZ4A 4NBFA 2JIMA 1VQL1 3CCM1 4Y52I 3I4MI 4A3II 4A3KI 3S1NI 3QWUA 3GTQI 2QEX1 3CC21 2RT9A 3HOYI 2PM9A 2HU9A 4NB9A 2AKLA 4A3JI 3TDHB 1YIT1 1JWHC 3NFZA 2VPWA 1SIWA 3PO3I 1M1K2 3J81f 3G711 1TFIA 4E2WA 2F4OA 1VQ81 1VQPZ 1QVGY 3RZDI 2GU2A 4RV9A 1AA6A 3VTNA 1DL6A 4QTUA 3GTOI 1K9M2 3S2HI 3CD6Z 4A3FI 3K7AI 3PO3S 2JA8I 3D2LA 4RVFA 1ZH1A 2R6MA 3FQQA 4MXUA 4NFRA 3CME1 3CC7Z 2HF1A 2QRCB 1Q862 3MZKB 1M902 4RS4A 5C44I 4NBDA 2V8KA 3VMHA 5D1OB 4RVGA 3PO2I 2H85A 3IF8A 2NAPA 1L1OC 3NDJA 3GTMS 2NVTI 2O53A 3JAMb 2JNYA 2O4HA 3CXCY 2VPZA 1KD11 1X3ZA 3JAMf 2BJOA 1S72Z 1VQMZ 3HOXI 1VQ6Z 1RQFA 2QLVB 1VQP1 1N8R1 2LFUA 2JR6A 1QVFY 2R92I 3CCVZ 3CD61 2V45A 3G4SZ 1QVGZ 1Q811 4NB8A 3J80f 1Q7Y1 1KQSY 3CC71 2IZ3A 4RVDA 4BY7I 4A3LI 3GCFA 3BG0B 3MZLB 4EWCA 1JJ2Y 3IR7A 1USPA 2G2KA 2PK7A 2QA4Z 2OTJZ 3CQZI 2LIYA 1M1K1 4E2YA 3F3FC 1Q822 2DE6A 4NBBA 2OOYB 2F4MA 3CC41 3EERA 1NP6A 3S1QI 1YHQZ 3HOUI 3CPWY 1FDIA 1K9M1 2R93I 1K8A1 2JIPA 1K732 1NJI2 3J7A4 1RO0A 1YJWZ 1Z02A 4A3CI 1WW9A 3I4NI 1WZNA 1S721 2E7ZA 4MD9A 1VQM1 5FLMI 1TWHI 1VQ61 4BBSI 4E32A 1FDOA 1VQ4Z 3NDIA 3CMA1 4QTTA 1I3QI 2ZAEB 1I50I 4HH4A 1Q861 3CCV1 1Q16A 1M901 3CCJZ 3G4S1 4BBRI 1KC81 2GTIA 3FKII 4HGYA 4X6AI 5IP7I 2VUMI 2DE7A 2NVQI 1KRLA 1NUIA 1WCMI 2DE5A 3RZOI 1ML8A 4A3EI 3VB9A 3OW2Z 4E33A 1P9NA 2QKDA 2E2HI 2NVYI 2JUBA 3S15I 3KIFA 1VQ51 5T64A 1KQSZ 1YJN1 2QA41 3CCEZ 2QREB 2OTJ1 1VQOZ 3G6EZ 3H0GI 1QF8A 1YJ9Z 2EGTA 1JJ2Z 3FQMA 3Q87A 1TWAI 3KIHA 4TNUA 1X3WA 5CM2M 3CCSZ 2RIQA 3CC4Z 3CCU1 3I07A 4MD8A 1YHQ1 2I3CA 3I56Z 1YUAA 1Y1VI 4NBEA 5A2Qb 1VLAA 2OTLZ 1I6HI 2KPIA 2AYDA 2PMZA 2IV2X 2Q51A 1YJW1 1Y1WI 2JA7I 4BXXI 3GTLI 4DK1A 1VQ41 3CMAZ 3CCRZ 5A2Qf 2RHBA 3VMGA 1YI2Z 3CCJ1 2M6NA 5AN9F 1WIIA 1YUKA 3CCLZ 1ZB9A 1YIJZ 4NOZA 3GTGI 1R9TI 2J6AA 1VQ7Z 3D9XA 4MH4A 2JIRA 1VQ5Z 4MONA 3GTKI 4A3GI 1YJNZ 1KD12 3CCQZ 2K5RA 2GTHA 3CCE1 3S1MI 1VQO1 2V3VA 3G6E1 5IT9b 4NH1C 1YJ91 1K731 4MRIA 4A3DI 3HOZI 1TWCI 2OZKA 3CCS1 1Z03A 4E30A 3CCUZ 5T6BA 2LEXA 3TE5B 3LUSA 3I561 5IT9f 4A3MI 4E31A 1Q812 2OTL1 2QR1B 4NBAA 4E2XA 2KI7B 2JIOA 1Q7Y2 3T4NB 3S2DI 3U50C 3CXCZ 3J81b 2JA5I 1N2FA 2K3RA 1ZB8A 1VQ9Z 1VQKZ 4E2ZA 1SFOI 2P28A 3IX0A 2JS4A 1W2BY 1TWGI 3CCR1 1YI21 2RPRA 3VMIA 4NBCA 1QVFZ 2M48A 4DQYB 3CCL1 3S14I 2E2II 1YIJ1 1RO4A 5LL6f 4XX2A 2Q4ZA 2JIQA 3D6WA 4DGLA 1VQ71 3H3VJ 4CL1A 1X0TA 1K8A2 4HGZA 1RLYA 2B63I 1Z01A 3CCQ1 4Y7NI 2R7ZI 3I55Z 2V8JA 1VQN1 3M3YI 1LQLA 3S16I 2YU9I 4RVHA 2JA6I 3GTMI
chains in the Genus database with same CATH topology
4NBGA 3HOWI 1VQLZ 2QRDB 3CCMZ 3HKZA 5D1OA 2W03A 5T67A 1KC82 3BG1B 3M4OI 4BY1I 2NVXI 2QEXZ 3CPWZ 3CC2Z 3P5JB 3IFUA 3S1RI 2WB1A 4MD7A 1VQ91 2V8IA 1VQK1 3HOVI 3GTJI 1YITZ 1RO2A 5C4XI 1Y1VS 2E2JI 1S7MA 1W2BZ 2RBLA 3G71Z 3F3PC 2VUGA 1TWFI 2Y0SA 1VQ8Z 2P3YA 5C3EI 1Q821 1QYPA 2YADA 3EEDA 3J80b 4S1TA 1PFTA 1K83I 3NH4A 3GTPI 3GKQA 5FLXb 4A93I 2E9HA 3NH8A 2OOXB 2JMOA 4NBHA 2WAQA 3I551 3OW2Y 1USPB 3NH5A 3ESWA 3S17I 1VQNZ 5IP9I 1NJI1 1N8R2 2VF1A 1RNIA 4A3BI 2W04A 3CMEZ 4AYBA 5D1PA 3MONA 5FLXf 5C4JI 2IZ4A 4NBFA 1VQL1 3CCM1 4Y52I 3I4MI 4A3II 4A3KI 3S1NI 3QWUA 3GTQI 2QEX1 3CC21 2RT9A 3HOYI 2PM9A 2HU9A 4NB9A 2AKLA 4A3JI 3TDHB 1YIT1 1JWHC 3NFZA 3PO3I 1M1K2 3J81f 3G711 1TFIA 4E2WA 2F4OA 1VQ81 1VQPZ 1QVGY 3RZDI 2GU2A 4RV9A 1DL6A 3VTNA 4QTUA 3GTOI 1K9M2 3S2HI 3CD6Z 4A3FI 3K7AI 3PO3S 2JA8I 4RVFA 1ZH1A 2R6MA 3FQQA 4MXUA 4NFRA 3CME1 3CC7Z 2HF1A 2QRCB 1Q862 3MZKB 1M902 4RS4A 5C44I 4NBDA 2V8KA 3VMHA 5D1OB 4RVGA 3PO2I 2H85A 3IF8A 1L1OC 3NDJA 3GTMS 2NVTI 2O53A 3JAMb 2JNYA 2O4HA 3CXCY 1KD11 1X3ZA 3JAMf 2BJOA 1S72Z 1VQMZ 3HOXI 1VQ6Z 1RQFA 2QLVB 1VQP1 1N8R1 2LFUA 2JR6A 1QVFY 2R92I 3CCVZ 3CD61 3G4SZ 1QVGZ 1Q811 4NB8A 3J80f 1Q7Y1 1KQSY 3CC71 2IZ3A 4RVDA 4BY7I 4A3LI 3GCFA 3BG0B 3MZLB 4EWCA 1JJ2Y 1USPA 2G2KA 2PK7A 2QA4Z 2OTJZ 3CQZI 2LIYA 1M1K1 4E2YA 3F3FC 1Q822 2DE6A 4NBBA 2OOYB 2F4MA 3CC41 3EERA 1NP6A 3S1QI 1YHQZ 3HOUI 3CPWY 1K9M1 2R93I 1K8A1 1K732 1NJI2 3J7A4 1RO0A 1YJWZ 1Z02A 4A3CI 1WW9A 3I4NI 1S721 1VQM1 4MD9A 5FLMI 1TWHI 1VQ61 4BBSI 4E32A 1VQ4Z 3NDIA 3CMA1 4QTTA 1I3QI 2ZAEB 1I50I 4HH4A 1Q861 3CCV1 1M901 3CCJZ 3G4S1 4BBRI 1KC81 2GTIA 3FKII 4HGYA 4X6AI 5IP7I 2VUMI 2DE7A 2NVQI 1KRLA 1NUIA 1WCMI 2DE5A 3RZOI 1ML8A 4A3EI 3VB9A 3OW2Z 4E33A 1P9NA 2QKDA 2E2HI 2NVYI 2JUBA 3S15I 3KIFA 1VQ51 5T64A 1KQSZ 1YJN1 2QA41 3CCEZ 2QREB 2OTJ1 1VQOZ 3G6EZ 3H0GI 1QF8A 1YJ9Z 2EGTA 1JJ2Z 3FQMA 3Q87A 1TWAI 3KIHA 4TNUA 1X3WA 5CM2M 3CCSZ 2RIQA 3CC4Z 3CCU1 3I07A 4MD8A 1YHQ1 2I3CA 3I56Z 1YUAA 1Y1VI 4NBEA 5A2Qb 1VLAA 2OTLZ 1I6HI 2KPIA 2PMZA 2JA7I 1YJW1 2Q51A 1Y1WI 4BXXI 3GTLI 4DK1A 1VQ41 3CMAZ 3CCRZ 5A2Qf 2RHBA 3VMGA 1YI2Z 3CCJ1 2M6NA 5AN9F 1WIIA 1YUKA 3CCLZ 1ZB9A 1YIJZ 4NOZA 3GTGI 1R9TI 2J6AA 1VQ7Z 3D9XA 4MH4A 1VQ5Z 4MONA 3GTKI 4A3GI 1YJNZ 1KD12 3CCQZ 2K5RA 2GTHA 3CCE1 3S1MI 1VQO1 3G6E1 5IT9b 4NH1C 1YJ91 1K731 4MRIA 4A3DI 3HOZI 1TWCI 2OZKA 3CCS1 1Z03A 4E30A 3CCUZ 5T6BA 3TE5B 3LUSA 3I561 5IT9f 4A3MI 4E31A 1Q812 2OTL1 2QR1B 4NBAA 4E2XA 2KI7B 1Q7Y2 3T4NB 3S2DI 3U50C 3CXCZ 3J81b 2JA5I 1N2FA 2K3RA 1ZB8A 1VQ9Z 1VQKZ 4E2ZA 1SFOI 2P28A 3IX0A 2JS4A 1W2BY 1TWGI 3CCR1 1YI21 2RPRA 3VMIA 4NBCA 1QVFZ 2M48A 4DQYB 3CCL1 3S14I 2E2II 1YIJ1 1RO4A 5LL6f 4XX2A 2Q4ZA 3D6WA 4DGLA 1VQ71 3H3VJ 4CL1A 1X0TA 1K8A2 4HGZA 1RLYA 2B63I 1Z01A 3CCQ1 4Y7NI 2R7ZI 3I55Z 2V8JA 1VQN1 3M3YI 1LQLA 3S16I 2YU9I 4RVHA 2JA6I 3GTMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIH A;  3KIF A; 
#chains in the Genus database with same CATH topology
 4NBG A;  3HOW I;  1VQL Z;  2QRD B;  3CCM Z;  3HKZ A;  5D1O A;  2W03 A;  5T67 A;  1KC8 2;  3BG1 B;  3M4O I;  4BY1 I;  1WJ2 A;  2NVX I;  2QEX Z;  3CPW Z;  3CC2 Z;  3P5J B;  3IFU A;  3S1R I;  2WB1 A;  4MD7 A;  1VQ9 1;  2V8I A;  1VQK 1;  3HOV I;  3GTJ I;  2VPY A;  1YIT Z;  1RO2 A;  5C4X I;  1Y1V S;  2E2J I;  2VPX A;  1S7M A;  1W2B Z;  1Y8C A;  2RBL A;  3G71 Z;  3F3P C;  2VUG A;  1TWF I;  2Y0S A;  1VQ8 Z;  2P3Y A;  5C3E I;  1Q82 1;  1QYP A;  2YAD A;  3EED A;  3J80 b;  4S1T A;  1PFT A;  1K83 I;  3NH4 A;  3GTP I;  3GKQ A;  5FLX b;  4A93 I;  2E9H A;  3NH8 A;  2OOX B;  2JMO A;  4NBH A;  2WAQ A;  3I55 1;  1USP B;  3NH5 A;  3OW2 Y;  3ESW A;  3S17 I;  1VQN Z;  5IP9 I;  1NJI 1;  1N8R 2;  2VF1 A;  1RNI A;  4A3B I;  2W04 A;  3CME Z;  1QXF A;  4AYB A;  5D1P A;  3MON A;  5FLX f;  5C4J I;  2IZ4 A;  4NBF A;  2JIM A;  1VQL 1;  3CCM 1;  4Y52 I;  3I4M I;  4A3I I;  4A3K I;  3S1N I;  3QWU A;  3GTQ I;  2QEX 1;  3CC2 1;  2RT9 A;  3HOY I;  2PM9 A;  2HU9 A;  4NB9 A;  2AKL A;  4A3J I;  3TDH B;  1YIT 1;  1JWH C;  3NFZ A;  2VPW A;  1SIW A;  3PO3 I;  1M1K 2;  3J81 f;  3G71 1;  1TFI A;  4E2W A;  2F4O A;  1VQ8 1;  1VQP Z;  1QVG Y;  3RZD I;  2GU2 A;  4RV9 A;  1AA6 A;  3VTN A;  1DL6 A;  4QTU A;  3GTO I;  1K9M 2;  3S2H I;  3CD6 Z;  4A3F I;  3K7A I;  3PO3 S;  2JA8 I;  3D2L A;  4RVF A;  1ZH1 A;  2R6M A;  3FQQ A;  4MXU A;  4NFR A;  3CME 1;  3CC7 Z;  2HF1 A;  2QRC B;  1Q86 2;  3MZK B;  1M90 2;  4RS4 A;  5C44 I;  4NBD A;  2V8K A;  3VMH A;  5D1O B;  4RVG A;  3PO2 I;  2H85 A;  3IF8 A;  2NAP A;  1L1O C;  3NDJ A;  3GTM S;  2NVT I;  2O53 A;  3JAM b;  2JNY A;  2O4H A;  3CXC Y;  2VPZ A;  1KD1 1;  1X3Z A;  3JAM f;  2BJO A;  1S72 Z;  1VQM Z;  3HOX I;  1VQ6 Z;  1RQF A;  2QLV B;  1VQP 1;  1N8R 1;  2LFU A;  2JR6 A;  1QVF Y;  2R92 I;  3CCV Z;  3CD6 1;  2V45 A;  3G4S Z;  1QVG Z;  1Q81 1;  4NB8 A;  3J80 f;  1Q7Y 1;  1KQS Y;  3CC7 1;  2IZ3 A;  4RVD A;  4BY7 I;  4A3L I;  3GCF A;  3BG0 B;  3MZL B;  4EWC A;  1JJ2 Y;  3IR7 A;  1USP A;  2G2K A;  2PK7 A;  2QA4 Z;  2OTJ Z;  3CQZ I;  2LIY A;  1M1K 1;  4E2Y A;  3F3F C;  1Q82 2;  2DE6 A;  4NBB A;  2OOY B;  2F4M A;  3CC4 1;  3EER A;  1NP6 A;  3S1Q I;  1YHQ Z;  3HOU I;  3CPW Y;  1FDI A;  1K9M 1;  2R93 I;  1K8A 1;  2JIP A;  1K73 2;  1NJI 2;  3J7A 4;  1RO0 A;  1YJW Z;  1Z02 A;  4A3C I;  1WW9 A;  3I4N I;  1WZN A;  1S72 1;  2E7Z A;  4MD9 A;  1VQM 1;  5FLM I;  1TWH I;  1VQ6 1;  4BBS I;  4E32 A;  1FDO A;  1VQ4 Z;  3NDI A;  3CMA 1;  4QTT A;  1I3Q I;  2ZAE B;  1I50 I;  4HH4 A;  1Q86 1;  3CCV 1;  1Q16 A;  1M90 1;  3CCJ Z;  3G4S 1;  4BBR I;  1KC8 1;  2GTI A;  3FKI I;  4HGY A;  4X6A I;  5IP7 I;  2VUM I;  2DE7 A;  2NVQ I;  1KRL A;  1NUI A;  1WCM I;  2DE5 A;  3RZO I;  1ML8 A;  4A3E I;  3VB9 A;  3OW2 Z;  4E33 A;  1P9N A;  2QKD A;  2E2H I;  2NVY I;  2JUB A;  3S15 I;  3KIF A;  1VQ5 1;  5T64 A;  1KQS Z;  1YJN 1;  2QA4 1;  3CCE Z;  2QRE B;  2OTJ 1;  1VQO Z;  3G6E Z;  3H0G I;  1QF8 A;  1YJ9 Z;  2EGT A;  1JJ2 Z;  3FQM A;  3Q87 A;  1TWA I;  3KIH A;  4TNU A;  1X3W A;  5CM2 M;  3CCS Z;  2RIQ A;  3CC4 Z;  3CCU 1;  3I07 A;  4MD8 A;  1YHQ 1;  2I3C A;  3I56 Z;  1YUA A;  1Y1V I;  4NBE A;  5A2Q b;  1VLA A;  2OTL Z;  1I6H I;  2KPI A;  2AYD A;  2PMZ A;  2IV2 X;  2Q51 A;  1YJW 1;  1Y1W I;  2JA7 I;  4BXX I;  3GTL I;  4DK1 A;  1VQ4 1;  3CMA Z;  3CCR Z;  5A2Q f;  2RHB A;  3VMG A;  1YI2 Z;  3CCJ 1;  2M6N A;  5AN9 F;  1WII A;  1YUK A;  3CCL Z;  1ZB9 A;  1YIJ Z;  4NOZ A;  3GTG I;  1R9T I;  2J6A A;  1VQ7 Z;  3D9X A;  4MH4 A;  2JIR A;  1VQ5 Z;  4MON A;  3GTK I;  4A3G I;  1YJN Z;  1KD1 2;  3CCQ Z;  2K5R A;  2GTH A;  3CCE 1;  3S1M I;  1VQO 1;  2V3V A;  3G6E 1;  5IT9 b;  4NH1 C;  1YJ9 1;  1K73 1;  4MRI A;  4A3D I;  3HOZ I;  1TWC I;  2OZK A;  3CCS 1;  1Z03 A;  4E30 A;  3CCU Z;  5T6B A;  2LEX A;  3TE5 B;  3LUS A;  3I56 1;  5IT9 f;  4A3M I;  4E31 A;  1Q81 2;  2OTL 1;  2QR1 B;  4NBA A;  4E2X A;  2KI7 B;  2JIO A;  1Q7Y 2;  3T4N B;  3S2D I;  3U50 C;  3CXC Z;  3J81 b;  2JA5 I;  1N2F A;  2K3R A;  1ZB8 A;  1VQ9 Z;  1VQK Z;  4E2Z A;  1SFO I;  2P28 A;  3IX0 A;  2JS4 A;  1W2B Y;  1TWG I;  3CCR 1;  1YI2 1;  2RPR A;  3VMI A;  4NBC A;  1QVF Z;  2M48 A;  4DQY B;  3CCL 1;  3S14 I;  2E2I I;  1YIJ 1;  1RO4 A;  5LL6 f;  4XX2 A;  2Q4Z A;  2JIQ A;  3D6W A;  4DGL A;  1VQ7 1;  3H3V J;  4CL1 A;  1X0T A;  1K8A 2;  4HGZ A;  1RLY A;  2B63 I;  1Z01 A;  3CCQ 1;  4Y7N I;  2R7Z I;  3I55 Z;  2V8J A;  1VQN 1;  3M3Y I;  1LQL A;  3S16 I;  2YU9 I;  4RVH A;  2JA6 I;  3GTM I; 
#chains in the Genus database with same CATH homology
 4NBG A;  3HOW I;  1VQL Z;  2QRD B;  3CCM Z;  3HKZ A;  5D1O A;  2W03 A;  5T67 A;  1KC8 2;  3BG1 B;  3M4O I;  4BY1 I;  2NVX I;  2QEX Z;  3CPW Z;  3CC2 Z;  3P5J B;  3IFU A;  3S1R I;  2WB1 A;  4MD7 A;  1VQ9 1;  2V8I A;  1VQK 1;  3HOV I;  3GTJ I;  1YIT Z;  1RO2 A;  5C4X I;  1Y1V S;  2E2J I;  1S7M A;  1W2B Z;  2RBL A;  3G71 Z;  3F3P C;  2VUG A;  1TWF I;  2Y0S A;  1VQ8 Z;  2P3Y A;  5C3E I;  1Q82 1;  1QYP A;  2YAD A;  3EED A;  3J80 b;  4S1T A;  1PFT A;  1K83 I;  3NH4 A;  3GTP I;  3GKQ A;  5FLX b;  4A93 I;  2E9H A;  3NH8 A;  2OOX B;  2JMO A;  4NBH A;  2WAQ A;  3I55 1;  3OW2 Y;  1USP B;  3NH5 A;  3ESW A;  3S17 I;  1VQN Z;  5IP9 I;  1NJI 1;  1N8R 2;  2VF1 A;  1RNI A;  4A3B I;  2W04 A;  3CME Z;  4AYB A;  5D1P A;  3MON A;  5FLX f;  5C4J I;  2IZ4 A;  4NBF A;  1VQL 1;  3CCM 1;  4Y52 I;  3I4M I;  4A3I I;  4A3K I;  3S1N I;  3QWU A;  3GTQ I;  2QEX 1;  3CC2 1;  2RT9 A;  3HOY I;  2PM9 A;  2HU9 A;  4NB9 A;  2AKL A;  4A3J I;  3TDH B;  1YIT 1;  1JWH C;  3NFZ A;  3PO3 I;  1M1K 2;  3J81 f;  3G71 1;  1TFI A;  4E2W A;  2F4O A;  1VQ8 1;  1VQP Z;  1QVG Y;  3RZD I;  2GU2 A;  4RV9 A;  1DL6 A;  3VTN A;  4QTU A;  3GTO I;  1K9M 2;  3S2H I;  3CD6 Z;  4A3F I;  3K7A I;  3PO3 S;  2JA8 I;  4RVF A;  1ZH1 A;  2R6M A;  3FQQ A;  4MXU A;  4NFR A;  3CME 1;  3CC7 Z;  2HF1 A;  2QRC B;  1Q86 2;  3MZK B;  1M90 2;  4RS4 A;  5C44 I;  4NBD A;  2V8K A;  3VMH A;  5D1O B;  4RVG A;  3PO2 I;  2H85 A;  3IF8 A;  1L1O C;  3NDJ A;  3GTM S;  2NVT I;  2O53 A;  3JAM b;  2JNY A;  2O4H A;  3CXC Y;  1KD1 1;  1X3Z A;  3JAM f;  2BJO A;  1S72 Z;  1VQM Z;  3HOX I;  1VQ6 Z;  1RQF A;  2QLV B;  1VQP 1;  1N8R 1;  2LFU A;  2JR6 A;  1QVF Y;  2R92 I;  3CCV Z;  3CD6 1;  3G4S Z;  1QVG Z;  1Q81 1;  4NB8 A;  3J80 f;  1Q7Y 1;  1KQS Y;  3CC7 1;  2IZ3 A;  4RVD A;  4BY7 I;  4A3L I;  3GCF A;  3BG0 B;  3MZL B;  4EWC A;  1JJ2 Y;  1USP A;  2G2K A;  2PK7 A;  2QA4 Z;  2OTJ Z;  3CQZ I;  2LIY A;  1M1K 1;  4E2Y A;  3F3F C;  1Q82 2;  2DE6 A;  4NBB A;  2OOY B;  2F4M A;  3CC4 1;  3EER A;  1NP6 A;  3S1Q I;  1YHQ Z;  3HOU I;  3CPW Y;  1K9M 1;  2R93 I;  1K8A 1;  1K73 2;  1NJI 2;  3J7A 4;  1RO0 A;  1YJW Z;  1Z02 A;  4A3C I;  1WW9 A;  3I4N I;  1S72 1;  1VQM 1;  4MD9 A;  5FLM I;  1TWH I;  1VQ6 1;  4BBS I;  4E32 A;  1VQ4 Z;  3NDI A;  3CMA 1;  4QTT A;  1I3Q I;  2ZAE B;  1I50 I;  4HH4 A;  1Q86 1;  3CCV 1;  1M90 1;  3CCJ Z;  3G4S 1;  4BBR I;  1KC8 1;  2GTI A;  3FKI I;  4HGY A;  4X6A I;  5IP7 I;  2VUM I;  2DE7 A;  2NVQ I;  1KRL A;  1NUI A;  1WCM I;  2DE5 A;  3RZO I;  1ML8 A;  4A3E I;  3VB9 A;  3OW2 Z;  4E33 A;  1P9N A;  2QKD A;  2E2H I;  2NVY I;  2JUB A;  3S15 I;  3KIF A;  1VQ5 1;  5T64 A;  1KQS Z;  1YJN 1;  2QA4 1;  3CCE Z;  2QRE B;  2OTJ 1;  1VQO Z;  3G6E Z;  3H0G I;  1QF8 A;  1YJ9 Z;  2EGT A;  1JJ2 Z;  3FQM A;  3Q87 A;  1TWA I;  3KIH A;  4TNU A;  1X3W A;  5CM2 M;  3CCS Z;  2RIQ A;  3CC4 Z;  3CCU 1;  3I07 A;  4MD8 A;  1YHQ 1;  2I3C A;  3I56 Z;  1YUA A;  1Y1V I;  4NBE A;  5A2Q b;  1VLA A;  2OTL Z;  1I6H I;  2KPI A;  2PMZ A;  2JA7 I;  1YJW 1;  2Q51 A;  1Y1W I;  4BXX I;  3GTL I;  4DK1 A;  1VQ4 1;  3CMA Z;  3CCR Z;  5A2Q f;  2RHB A;  3VMG A;  1YI2 Z;  3CCJ 1;  2M6N A;  5AN9 F;  1WII A;  1YUK A;  3CCL Z;  1ZB9 A;  1YIJ Z;  4NOZ A;  3GTG I;  1R9T I;  2J6A A;  1VQ7 Z;  3D9X A;  4MH4 A;  1VQ5 Z;  4MON A;  3GTK I;  4A3G I;  1YJN Z;  1KD1 2;  3CCQ Z;  2K5R A;  2GTH A;  3CCE 1;  3S1M I;  1VQO 1;  3G6E 1;  5IT9 b;  4NH1 C;  1YJ9 1;  1K73 1;  4MRI A;  4A3D I;  3HOZ I;  1TWC I;  2OZK A;  3CCS 1;  1Z03 A;  4E30 A;  3CCU Z;  5T6B A;  3TE5 B;  3LUS A;  3I56 1;  5IT9 f;  4A3M I;  4E31 A;  1Q81 2;  2OTL 1;  2QR1 B;  4NBA A;  4E2X A;  2KI7 B;  1Q7Y 2;  3T4N B;  3S2D I;  3U50 C;  3CXC Z;  3J81 b;  2JA5 I;  1N2F A;  2K3R A;  1ZB8 A;  1VQ9 Z;  1VQK Z;  4E2Z A;  1SFO I;  2P28 A;  3IX0 A;  2JS4 A;  1W2B Y;  1TWG I;  3CCR 1;  1YI2 1;  2RPR A;  3VMI A;  4NBC A;  1QVF Z;  2M48 A;  4DQY B;  3CCL 1;  3S14 I;  2E2I I;  1YIJ 1;  1RO4 A;  5LL6 f;  4XX2 A;  2Q4Z A;  3D6W A;  4DGL A;  1VQ7 1;  3H3V J;  4CL1 A;  1X0T A;  1K8A 2;  4HGZ A;  1RLY A;  2B63 I;  1Z01 A;  3CCQ 1;  4Y7N I;  2R7Z I;  3I55 Z;  2V8J A;  1VQN 1;  3M3Y I;  1LQL A;  3S16 I;  2YU9 I;  4RVH A;  2JA6 I;  3GTM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...