3KIHA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib2-d2-15)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
90
Chain Sequence
GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGYLYAVSKDKLYKAPPPQSDTDNWIARATEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-bladed beta-propeller lectin
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
total genus 12
structure length 90
sequence length 92
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kihA00
3KIFA 3KIHA
chains in the Genus database with same CATH superfamily
2QRCB 2B63I 2NVTI 4NBEA 2KPIA 2JIRA 3CCJZ 2QKDA 1W2BZ 2NVYI 1Z02A 4RVFA 1YJW1 1QVFZ 1Z03A 3D6WA 1JJ2Y 2YU9I 1ML8A 2E2HI 2W04A 1S7MA 3QWUA 2VPXA 4Y52I 4A3II 3OW2Z 4MD7A 2ZAEB 2V8JA 3D2LA 3CC21 1QYPA 3GTQI 3PO2I 3D9XA 1KC82 2V8IA 2QEX1 3CPWZ 3VB9A 5T64A 1YUKA 3H3VJ 1KRLA 5T67A 3CCM1 3S1RI 2O4HA 5IT9b 3TE5B 1VQNZ 3I551 2DE5A 2OOXB 3T4NB 3CCR1 3CC71 4TNUA 2JIMA 2JR6A 1VQ81 3U50C 4NOZA 1TWHI 1Q7Y1 3IF8A 4A3CI 1M1K2 3CMEZ 1YITZ 3S15I 4E2WA 3MONA 4BBRI 1KD12 2G2KA 2K3RA 3KIFA 5C4XI 4RVGA 3I561 2P28A 1YI21 3I4NI 5IT9f 1NP6A 3S2HI 1TFIA 2JIPA 1QVGY 4HGYA 3GTOI 3G6EZ 1JJ2Z 1WCMI 4HGZA 1SIWA 2E9HA 2AYDA 2RPRA 1TWFI 1DL6A 3CCE1 3NFZA 2VPZA 1NUIA 2V45A 3CCSZ 4RV9A 3HOVI 5A2Qb 5D1OA 1TWCI 4MH4A 1X3ZA 1YJNZ 2H85A 1RNIA 4NFRA 4A3GI 1QXFA 5IP9I 2AKLA 3CCJ1 3RZOI 1FDIA 1KC81 4E2YA 4BY7I 4NBFA 1VQMZ 3S14I 2R7ZI 2PK7A 2RHBA 1K732 2O53A 1S72Z 2DE6A 5A2Qf 1X0TA 1VQ4Z 1M1K1 2DE7A 2RT9A 1Y8CA 3I4MI 4RVDA 3PO3S 3JAMf 4E31A 1KD11 4BY1I 2VF1A 1QVGZ 1VQN1 1WIIA 3IR7A 4NB9A 1Q822 1YIJZ 5FLMI 3S1QI 3P5JB 1YJ9Z 1Y1WI 3BG0B 1VQKZ 3CME1 1YIT1 2P3YA 2VUGA 5D1OB 3S1NI 4NBAA 4E2ZA 2OTLZ 1N2FA 4E32A 1VQPZ 1Q862 2IV2X 4BBSI 1I50I 3G6E1 4RVHA 5IP7I 2E7ZA 2I3CA 2JIOA 4A3BI 2EGTA 1WJ2A 2JA6I 1USPB 4S1TA 1VLAA 2QLVB 4NBHA 1VQOZ 3EEDA 3CCS1 1K83I 3CXCY 5AN9F 1K731 1TWAI 3J80b 3CCUZ 2V3VA 3FKII 4A3EI 1YJN1 4A3LI 5D1PA 3MZLB 3MZKB 2WAQA 5T6BA 3G71Z 1VQLZ 1Y1VS 4NBDA 3S2DI 3IFUA 4A3DI 1VQM1 1RQFA 3BG1B 2QR1B 4DGLA 2RIQA 3NH8A 2GTHA 2JA8I 2GU2A 3FQMA 2LIYA 1Q821 1S721 3S17I 3CD6Z 2M6NA 3CMAZ 3J80f 4A93I 3EERA 3F3PC 3NDJA 3CC4Z 1VQ41 4MD9A 4DK1A 3HKZA 2JMOA 1VQ6Z 4NBGA 1PFTA 2E2II 1ZH1A 3JAMb 2QA4Z 2Y0SA 3S16I 2JIQA 3HOZI 3HOUI 1YIJ1 1Q861 4A3FI 3CQZI 1YJ91 1VQK1 1I6HI 1VQ7Z 3CXCZ 2R93I 5C44I 3K7AI 1USPA 2Q4ZA 1RLYA 4EWCA 3CCLZ 2OZKA 1WW9A 1M902 2OTL1 2M48A 3NDIA 1L1OC 5FLXf 4NB8A 3CCV1 2WB1A 1I3QI 1VQP1 3F3FC 3H0GI 1R9TI 2IZ4A 3VMIA 2JUBA 3J81b 2R92I 2OTJZ 3HOWI 3ESWA 3G4SZ 1JWHC 2E2JI 1NJI2 3KIHA 3NH4A 2IZ3A 1VQO1 1ZB8A 2OOYB 4AYBA 4E2XA 1VQ9Z 1FDOA 1Y1VI 4MONA 4NBBA 3GTMS 3HOYI 4BXXI 2JS4A 3CCU1 1YHQZ 2K5RA 2W03A 3LUSA 1Q812 2JA7I 3CCVZ 3IX0A 2NAPA 4HH4A 2Q51A 3GTJI 3J81f 1VQ5Z 3G711 1K8A2 1VQL1 1P9NA 3VMGA 4RS4A 1KQSY 1RO2A 2GTIA 3I07A 1QF8A 3CCQZ 1X3WA 5CM2M 1LQLA 1ZB9A 2JA5I 1Q16A 4E33A 3CD61 2HF1A 3CMA1 2NVQI 2J6AA 4X6AI 3CC41 1N8R2 4NH1C 1VQ61 3Q87A 2R6MA 1YJWZ 4QTTA 4QTUA 2QREB 3GTGI 2LEXA 1K9M2 2QA41 2JNYA 3GTLI 1M901 5C3EI 3VTNA 3CC2Z 4MD8A 5LL6f 4MRIA 3S1MI 3PO3I 2VPYA 3HOXI 3GCFA 3GKQA 1VQ71 2QEXZ 1AA6A 1NJI1 1TWGI 3CCL1 1W2BY 3CCMZ 3I55Z 2HU9A 2PMZA 4MXUA 4CL1A 3CCRZ 3CC7Z 1QVFY 5FLXb 1VQ8Z 4A3MI 2YADA 1KQSZ 3M4OI 1RO4A 4DQYB 1Q811 3FQQA 1WZNA 2F4OA 3J7A4 3GTMI 2OTJ1 2VUMI 1K8A1 3G4S1 3OW2Y 3GTPI 2RBLA 4XX2A 1RO0A 2QRDB 2KI7B 3M3YI 2BJOA 2F4MA 1YUAA 2LFUA 2V8KA 1VQ91 3I56Z 1YI2Z 3CPWY 4E30A 3GTKI 2PM9A 4A3KI 1YHQ1 1Q7Y2 2VPWA 1SFOI 3TDHB 1N8R1 3RZDI 2NVXI 5C4JI 1VQ51 3NH5A 4NBCA 3CCEZ 1K9M1 3VMHA 3CCQ1 4A3JI 4Y7NI 1Z01A
chains in the Genus database with same CATH topology
2QRCB 2B63I 2NVTI 4NBEA 2KPIA 3CCJZ 2QKDA 1W2BZ 2NVYI 1Z02A 4RVFA 1YJW1 1QVFZ 1Z03A 3D6WA 1JJ2Y 2YU9I 1ML8A 2E2HI 2W04A 1S7MA 3QWUA 4Y52I 4A3II 3OW2Z 4MD7A 2ZAEB 2V8JA 3CC21 3GTQI 1QYPA 3PO2I 3D9XA 1KC82 2V8IA 2QEX1 3CPWZ 3VB9A 5T64A 1YUKA 3H3VJ 1KRLA 5T67A 3CCM1 3S1RI 2O4HA 5IT9b 3TE5B 1VQNZ 3I551 2DE5A 2OOXB 3T4NB 3CCR1 3CC71 4TNUA 2JR6A 1VQ81 3U50C 4NOZA 1TWHI 1Q7Y1 3IF8A 4A3CI 1M1K2 3CMEZ 1YITZ 3S15I 4E2WA 3MONA 4BBRI 1KD12 2G2KA 2K3RA 3KIFA 5C4XI 4RVGA 3I561 2P28A 1YI21 3I4NI 5IT9f 1NP6A 3S2HI 1TFIA 1QVGY 4HGYA 3GTOI 3G6EZ 1JJ2Z 1WCMI 4HGZA 2E9HA 2RPRA 1TWFI 1DL6A 3CCE1 3NFZA 1NUIA 3CCSZ 4RV9A 3HOVI 5A2Qb 5D1OA 1TWCI 4MH4A 1X3ZA 1YJNZ 2H85A 1RNIA 4NFRA 4A3GI 5IP9I 3CCJ1 2AKLA 3RZOI 1KC81 4E2YA 4BY7I 4NBFA 1VQMZ 3S14I 2R7ZI 2PK7A 2RHBA 1K732 2O53A 1S72Z 2DE6A 5A2Qf 1X0TA 1VQ4Z 1M1K1 2DE7A 2RT9A 3I4MI 4RVDA 3PO3S 3JAMf 4E31A 1KD11 4BY1I 2VF1A 1QVGZ 1VQN1 1WIIA 4NB9A 1Q822 1YIJZ 5FLMI 3S1QI 3P5JB 1YJ9Z 1Y1WI 3BG0B 1VQKZ 3CME1 1YIT1 2P3YA 2VUGA 5D1OB 3S1NI 4NBAA 4E2ZA 2OTLZ 1N2FA 4E32A 1VQPZ 1Q862 4BBSI 1I50I 3G6E1 4RVHA 5IP7I 2I3CA 4A3BI 2EGTA 2JA6I 1USPB 4S1TA 1VLAA 2QLVB 4NBHA 1VQOZ 3EEDA 3CCS1 1K83I 3CXCY 5AN9F 1K731 1TWAI 3J80b 3CCUZ 3FKII 4A3EI 1YJN1 4A3LI 5D1PA 3MZLB 3MZKB 2WAQA 5T6BA 3G71Z 1VQLZ 1Y1VS 4NBDA 3S2DI 3IFUA 4A3DI 1VQM1 1RQFA 3BG1B 2QR1B 4DGLA 2RIQA 3NH8A 2GTHA 2JA8I 2GU2A 3FQMA 2LIYA 1Q821 1S721 3S17I 3CD6Z 2M6NA 3CMAZ 3J80f 4A93I 3EERA 3F3PC 3NDJA 3CC4Z 1VQ41 4MD9A 4DK1A 3HKZA 2JMOA 1VQ6Z 4NBGA 1PFTA 2E2II 1ZH1A 3JAMb 2QA4Z 2Y0SA 3S16I 3HOZI 3HOUI 1YIJ1 1Q861 4A3FI 3CQZI 1YJ91 1VQK1 1I6HI 1VQ7Z 3CXCZ 2R93I 5C44I 3K7AI 1USPA 2Q4ZA 1RLYA 4EWCA 3CCLZ 2OZKA 1WW9A 1M902 2OTL1 2M48A 3NDIA 1L1OC 5FLXf 4NB8A 3CCV1 2WB1A 1I3QI 1VQP1 3F3FC 3H0GI 1R9TI 2IZ4A 3VMIA 2JUBA 3J81b 2R92I 2OTJZ 3HOWI 3ESWA 3G4SZ 1JWHC 2E2JI 1NJI2 3KIHA 3NH4A 2IZ3A 1VQO1 1ZB8A 2OOYB 4AYBA 4E2XA 1VQ9Z 1Y1VI 4MONA 4NBBA 3GTMS 3HOYI 4BXXI 2JS4A 3CCU1 1YHQZ 2K5RA 2W03A 3LUSA 1Q812 2JA7I 3CCVZ 3IX0A 4HH4A 2Q51A 3GTJI 3J81f 1VQ5Z 3G711 1K8A2 1VQL1 1P9NA 3VMGA 4RS4A 1KQSY 1RO2A 2GTIA 3I07A 1QF8A 3CCQZ 1X3WA 5CM2M 1LQLA 1ZB9A 2JA5I 4E33A 3CD61 2HF1A 3CMA1 2NVQI 2J6AA 4X6AI 3CC41 1N8R2 4NH1C 1VQ61 3Q87A 2R6MA 1YJWZ 4QTTA 4QTUA 2QREB 3GTGI 1K9M2 2QA41 2JNYA 3GTLI 1M901 5C3EI 3VTNA 3CC2Z 4MD8A 5LL6f 4MRIA 3S1MI 3PO3I 3HOXI 3GCFA 3GKQA 1VQ71 2QEXZ 1NJI1 1TWGI 3CCL1 1W2BY 3CCMZ 3I55Z 2HU9A 2PMZA 4MXUA 4CL1A 3CCRZ 3CC7Z 1QVFY 5FLXb 1VQ8Z 4A3MI 2YADA 1KQSZ 3M4OI 1RO4A 4DQYB 1Q811 3FQQA 2F4OA 3J7A4 3GTMI 2OTJ1 2VUMI 1K8A1 3G4S1 3OW2Y 3GTPI 2RBLA 4XX2A 1RO0A 2QRDB 2KI7B 3M3YI 2BJOA 2F4MA 1YUAA 2LFUA 2V8KA 1VQ91 3I56Z 1YI2Z 3CPWY 4E30A 3GTKI 2PM9A 4A3KI 1YHQ1 1Q7Y2 1SFOI 3TDHB 1N8R1 3RZDI 2NVXI 5C4JI 1VQ51 3NH5A 4NBCA 3CCEZ 1K9M1 3VMHA 3CCQ1 4A3JI 4Y7NI 1Z01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIF A;  3KIH A; 
#chains in the Genus database with same CATH topology
 2QRC B;  2B63 I;  2NVT I;  4NBE A;  2KPI A;  2JIR A;  3CCJ Z;  2QKD A;  1W2B Z;  2NVY I;  1Z02 A;  4RVF A;  1YJW 1;  1QVF Z;  1Z03 A;  3D6W A;  1JJ2 Y;  2YU9 I;  1ML8 A;  2E2H I;  2W04 A;  1S7M A;  3QWU A;  2VPX A;  4Y52 I;  4A3I I;  3OW2 Z;  4MD7 A;  2ZAE B;  2V8J A;  3D2L A;  3CC2 1;  1QYP A;  3GTQ I;  3PO2 I;  3D9X A;  1KC8 2;  2V8I A;  2QEX 1;  3CPW Z;  3VB9 A;  5T64 A;  1YUK A;  3H3V J;  1KRL A;  5T67 A;  3CCM 1;  3S1R I;  2O4H A;  5IT9 b;  3TE5 B;  1VQN Z;  3I55 1;  2DE5 A;  2OOX B;  3T4N B;  3CCR 1;  3CC7 1;  4TNU A;  2JIM A;  2JR6 A;  1VQ8 1;  3U50 C;  4NOZ A;  1TWH I;  1Q7Y 1;  3IF8 A;  4A3C I;  1M1K 2;  3CME Z;  1YIT Z;  3S15 I;  4E2W A;  3MON A;  4BBR I;  1KD1 2;  2G2K A;  2K3R A;  3KIF A;  5C4X I;  4RVG A;  3I56 1;  2P28 A;  1YI2 1;  3I4N I;  5IT9 f;  1NP6 A;  3S2H I;  1TFI A;  2JIP A;  1QVG Y;  4HGY A;  3GTO I;  3G6E Z;  1JJ2 Z;  1WCM I;  4HGZ A;  1SIW A;  2E9H A;  2AYD A;  2RPR A;  1TWF I;  1DL6 A;  3CCE 1;  3NFZ A;  2VPZ A;  1NUI A;  2V45 A;  3CCS Z;  4RV9 A;  3HOV I;  5A2Q b;  5D1O A;  1TWC I;  4MH4 A;  1X3Z A;  1YJN Z;  2H85 A;  1RNI A;  4NFR A;  4A3G I;  1QXF A;  5IP9 I;  2AKL A;  3CCJ 1;  3RZO I;  1FDI A;  1KC8 1;  4E2Y A;  4BY7 I;  4NBF A;  1VQM Z;  3S14 I;  2R7Z I;  2PK7 A;  2RHB A;  1K73 2;  2O53 A;  1S72 Z;  2DE6 A;  5A2Q f;  1X0T A;  1VQ4 Z;  1M1K 1;  2DE7 A;  2RT9 A;  1Y8C A;  3I4M I;  4RVD A;  3PO3 S;  3JAM f;  4E31 A;  1KD1 1;  4BY1 I;  2VF1 A;  1QVG Z;  1VQN 1;  1WII A;  3IR7 A;  4NB9 A;  1Q82 2;  1YIJ Z;  5FLM I;  3S1Q I;  3P5J B;  1YJ9 Z;  1Y1W I;  3BG0 B;  1VQK Z;  3CME 1;  1YIT 1;  2P3Y A;  2VUG A;  5D1O B;  3S1N I;  4NBA A;  4E2Z A;  2OTL Z;  1N2F A;  4E32 A;  1VQP Z;  1Q86 2;  2IV2 X;  4BBS I;  1I50 I;  3G6E 1;  4RVH A;  5IP7 I;  2E7Z A;  2I3C A;  2JIO A;  4A3B I;  2EGT A;  1WJ2 A;  2JA6 I;  1USP B;  4S1T A;  1VLA A;  2QLV B;  4NBH A;  1VQO Z;  3EED A;  3CCS 1;  1K83 I;  3CXC Y;  5AN9 F;  1K73 1;  1TWA I;  3J80 b;  3CCU Z;  2V3V A;  3FKI I;  4A3E I;  1YJN 1;  4A3L I;  5D1P A;  3MZL B;  3MZK B;  2WAQ A;  5T6B A;  3G71 Z;  1VQL Z;  1Y1V S;  4NBD A;  3S2D I;  3IFU A;  4A3D I;  1VQM 1;  1RQF A;  3BG1 B;  2QR1 B;  4DGL A;  2RIQ A;  3NH8 A;  2GTH A;  2JA8 I;  2GU2 A;  3FQM A;  2LIY A;  1Q82 1;  1S72 1;  3S17 I;  3CD6 Z;  2M6N A;  3CMA Z;  3J80 f;  4A93 I;  3EER A;  3F3P C;  3NDJ A;  3CC4 Z;  1VQ4 1;  4MD9 A;  4DK1 A;  3HKZ A;  2JMO A;  1VQ6 Z;  4NBG A;  1PFT A;  2E2I I;  1ZH1 A;  3JAM b;  2QA4 Z;  2Y0S A;  3S16 I;  2JIQ A;  3HOZ I;  3HOU I;  1YIJ 1;  1Q86 1;  4A3F I;  3CQZ I;  1YJ9 1;  1VQK 1;  1I6H I;  1VQ7 Z;  3CXC Z;  2R93 I;  5C44 I;  3K7A I;  1USP A;  2Q4Z A;  1RLY A;  4EWC A;  3CCL Z;  2OZK A;  1WW9 A;  1M90 2;  2OTL 1;  2M48 A;  3NDI A;  1L1O C;  5FLX f;  4NB8 A;  3CCV 1;  2WB1 A;  1I3Q I;  1VQP 1;  3F3F C;  3H0G I;  1R9T I;  2IZ4 A;  3VMI A;  2JUB A;  3J81 b;  2R92 I;  2OTJ Z;  3HOW I;  3ESW A;  3G4S Z;  1JWH C;  2E2J I;  1NJI 2;  3KIH A;  3NH4 A;  2IZ3 A;  1VQO 1;  1ZB8 A;  2OOY B;  4AYB A;  4E2X A;  1VQ9 Z;  1FDO A;  1Y1V I;  4MON A;  4NBB A;  3GTM S;  3HOY I;  4BXX I;  2JS4 A;  3CCU 1;  1YHQ Z;  2K5R A;  2W03 A;  3LUS A;  1Q81 2;  2JA7 I;  3CCV Z;  3IX0 A;  2NAP A;  4HH4 A;  2Q51 A;  3GTJ I;  3J81 f;  1VQ5 Z;  3G71 1;  1K8A 2;  1VQL 1;  1P9N A;  3VMG A;  4RS4 A;  1KQS Y;  1RO2 A;  2GTI A;  3I07 A;  1QF8 A;  3CCQ Z;  1X3W A;  5CM2 M;  1LQL A;  1ZB9 A;  2JA5 I;  1Q16 A;  4E33 A;  3CD6 1;  2HF1 A;  3CMA 1;  2NVQ I;  2J6A A;  4X6A I;  3CC4 1;  1N8R 2;  4NH1 C;  1VQ6 1;  3Q87 A;  2R6M A;  1YJW Z;  4QTT A;  4QTU A;  2QRE B;  3GTG I;  2LEX A;  1K9M 2;  2QA4 1;  2JNY A;  3GTL I;  1M90 1;  5C3E I;  3VTN A;  3CC2 Z;  4MD8 A;  5LL6 f;  4MRI A;  3S1M I;  3PO3 I;  2VPY A;  3HOX I;  3GCF A;  3GKQ A;  1VQ7 1;  2QEX Z;  1AA6 A;  1NJI 1;  1TWG I;  3CCL 1;  1W2B Y;  3CCM Z;  3I55 Z;  2HU9 A;  2PMZ A;  4MXU A;  4CL1 A;  3CCR Z;  3CC7 Z;  1QVF Y;  5FLX b;  1VQ8 Z;  4A3M I;  2YAD A;  1KQS Z;  3M4O I;  1RO4 A;  4DQY B;  1Q81 1;  3FQQ A;  1WZN A;  2F4O A;  3J7A 4;  3GTM I;  2OTJ 1;  2VUM I;  1K8A 1;  3G4S 1;  3OW2 Y;  3GTP I;  2RBL A;  4XX2 A;  1RO0 A;  2QRD B;  2KI7 B;  3M3Y I;  2BJO A;  2F4M A;  1YUA A;  2LFU A;  2V8K A;  1VQ9 1;  3I56 Z;  1YI2 Z;  3CPW Y;  4E30 A;  3GTK I;  2PM9 A;  4A3K I;  1YHQ 1;  1Q7Y 2;  2VPW A;  1SFO I;  3TDH B;  1N8R 1;  3RZD I;  2NVX I;  5C4J I;  1VQ5 1;  3NH5 A;  4NBC A;  3CCE Z;  1K9M 1;  3VMH A;  3CCQ 1;  4A3J I;  4Y7N I;  1Z01 A; 
#chains in the Genus database with same CATH homology
 2QRC B;  2B63 I;  2NVT I;  4NBE A;  2KPI A;  3CCJ Z;  2QKD A;  1W2B Z;  2NVY I;  1Z02 A;  4RVF A;  1YJW 1;  1QVF Z;  1Z03 A;  3D6W A;  1JJ2 Y;  2YU9 I;  1ML8 A;  2E2H I;  2W04 A;  1S7M A;  3QWU A;  4Y52 I;  4A3I I;  3OW2 Z;  4MD7 A;  2ZAE B;  2V8J A;  3CC2 1;  3GTQ I;  1QYP A;  3PO2 I;  3D9X A;  1KC8 2;  2V8I A;  2QEX 1;  3CPW Z;  3VB9 A;  5T64 A;  1YUK A;  3H3V J;  1KRL A;  5T67 A;  3CCM 1;  3S1R I;  2O4H A;  5IT9 b;  3TE5 B;  1VQN Z;  3I55 1;  2DE5 A;  2OOX B;  3T4N B;  3CCR 1;  3CC7 1;  4TNU A;  2JR6 A;  1VQ8 1;  3U50 C;  4NOZ A;  1TWH I;  1Q7Y 1;  3IF8 A;  4A3C I;  1M1K 2;  3CME Z;  1YIT Z;  3S15 I;  4E2W A;  3MON A;  4BBR I;  1KD1 2;  2G2K A;  2K3R A;  3KIF A;  5C4X I;  4RVG A;  3I56 1;  2P28 A;  1YI2 1;  3I4N I;  5IT9 f;  1NP6 A;  3S2H I;  1TFI A;  1QVG Y;  4HGY A;  3GTO I;  3G6E Z;  1JJ2 Z;  1WCM I;  4HGZ A;  2E9H A;  2RPR A;  1TWF I;  1DL6 A;  3CCE 1;  3NFZ A;  1NUI A;  3CCS Z;  4RV9 A;  3HOV I;  5A2Q b;  5D1O A;  1TWC I;  4MH4 A;  1X3Z A;  1YJN Z;  2H85 A;  1RNI A;  4NFR A;  4A3G I;  5IP9 I;  3CCJ 1;  2AKL A;  3RZO I;  1KC8 1;  4E2Y A;  4BY7 I;  4NBF A;  1VQM Z;  3S14 I;  2R7Z I;  2PK7 A;  2RHB A;  1K73 2;  2O53 A;  1S72 Z;  2DE6 A;  5A2Q f;  1X0T A;  1VQ4 Z;  1M1K 1;  2DE7 A;  2RT9 A;  3I4M I;  4RVD A;  3PO3 S;  3JAM f;  4E31 A;  1KD1 1;  4BY1 I;  2VF1 A;  1QVG Z;  1VQN 1;  1WII A;  4NB9 A;  1Q82 2;  1YIJ Z;  5FLM I;  3S1Q I;  3P5J B;  1YJ9 Z;  1Y1W I;  3BG0 B;  1VQK Z;  3CME 1;  1YIT 1;  2P3Y A;  2VUG A;  5D1O B;  3S1N I;  4NBA A;  4E2Z A;  2OTL Z;  1N2F A;  4E32 A;  1VQP Z;  1Q86 2;  4BBS I;  1I50 I;  3G6E 1;  4RVH A;  5IP7 I;  2I3C A;  4A3B I;  2EGT A;  2JA6 I;  1USP B;  4S1T A;  1VLA A;  2QLV B;  4NBH A;  1VQO Z;  3EED A;  3CCS 1;  1K83 I;  3CXC Y;  5AN9 F;  1K73 1;  1TWA I;  3J80 b;  3CCU Z;  3FKI I;  4A3E I;  1YJN 1;  4A3L I;  5D1P A;  3MZL B;  3MZK B;  2WAQ A;  5T6B A;  3G71 Z;  1VQL Z;  1Y1V S;  4NBD A;  3S2D I;  3IFU A;  4A3D I;  1VQM 1;  1RQF A;  3BG1 B;  2QR1 B;  4DGL A;  2RIQ A;  3NH8 A;  2GTH A;  2JA8 I;  2GU2 A;  3FQM A;  2LIY A;  1Q82 1;  1S72 1;  3S17 I;  3CD6 Z;  2M6N A;  3CMA Z;  3J80 f;  4A93 I;  3EER A;  3F3P C;  3NDJ A;  3CC4 Z;  1VQ4 1;  4MD9 A;  4DK1 A;  3HKZ A;  2JMO A;  1VQ6 Z;  4NBG A;  1PFT A;  2E2I I;  1ZH1 A;  3JAM b;  2QA4 Z;  2Y0S A;  3S16 I;  3HOZ I;  3HOU I;  1YIJ 1;  1Q86 1;  4A3F I;  3CQZ I;  1YJ9 1;  1VQK 1;  1I6H I;  1VQ7 Z;  3CXC Z;  2R93 I;  5C44 I;  3K7A I;  1USP A;  2Q4Z A;  1RLY A;  4EWC A;  3CCL Z;  2OZK A;  1WW9 A;  1M90 2;  2OTL 1;  2M48 A;  3NDI A;  1L1O C;  5FLX f;  4NB8 A;  3CCV 1;  2WB1 A;  1I3Q I;  1VQP 1;  3F3F C;  3H0G I;  1R9T I;  2IZ4 A;  3VMI A;  2JUB A;  3J81 b;  2R92 I;  2OTJ Z;  3HOW I;  3ESW A;  3G4S Z;  1JWH C;  2E2J I;  1NJI 2;  3KIH A;  3NH4 A;  2IZ3 A;  1VQO 1;  1ZB8 A;  2OOY B;  4AYB A;  4E2X A;  1VQ9 Z;  1Y1V I;  4MON A;  4NBB A;  3GTM S;  3HOY I;  4BXX I;  2JS4 A;  3CCU 1;  1YHQ Z;  2K5R A;  2W03 A;  3LUS A;  1Q81 2;  2JA7 I;  3CCV Z;  3IX0 A;  4HH4 A;  2Q51 A;  3GTJ I;  3J81 f;  1VQ5 Z;  3G71 1;  1K8A 2;  1VQL 1;  1P9N A;  3VMG A;  4RS4 A;  1KQS Y;  1RO2 A;  2GTI A;  3I07 A;  1QF8 A;  3CCQ Z;  1X3W A;  5CM2 M;  1LQL A;  1ZB9 A;  2JA5 I;  4E33 A;  3CD6 1;  2HF1 A;  3CMA 1;  2NVQ I;  2J6A A;  4X6A I;  3CC4 1;  1N8R 2;  4NH1 C;  1VQ6 1;  3Q87 A;  2R6M A;  1YJW Z;  4QTT A;  4QTU A;  2QRE B;  3GTG I;  1K9M 2;  2QA4 1;  2JNY A;  3GTL I;  1M90 1;  5C3E I;  3VTN A;  3CC2 Z;  4MD8 A;  5LL6 f;  4MRI A;  3S1M I;  3PO3 I;  3HOX I;  3GCF A;  3GKQ A;  1VQ7 1;  2QEX Z;  1NJI 1;  1TWG I;  3CCL 1;  1W2B Y;  3CCM Z;  3I55 Z;  2HU9 A;  2PMZ A;  4MXU A;  4CL1 A;  3CCR Z;  3CC7 Z;  1QVF Y;  5FLX b;  1VQ8 Z;  4A3M I;  2YAD A;  1KQS Z;  3M4O I;  1RO4 A;  4DQY B;  1Q81 1;  3FQQ A;  2F4O A;  3J7A 4;  3GTM I;  2OTJ 1;  2VUM I;  1K8A 1;  3G4S 1;  3OW2 Y;  3GTP I;  2RBL A;  4XX2 A;  1RO0 A;  2QRD B;  2KI7 B;  3M3Y I;  2BJO A;  2F4M A;  1YUA A;  2LFU A;  2V8K A;  1VQ9 1;  3I56 Z;  1YI2 Z;  3CPW Y;  4E30 A;  3GTK I;  2PM9 A;  4A3K I;  1YHQ 1;  1Q7Y 2;  1SFO I;  3TDH B;  1N8R 1;  3RZD I;  2NVX I;  5C4J I;  1VQ5 1;  3NH5 A;  4NBC A;  3CCE Z;  1K9M 1;  3VMH A;  3CCQ 1;  4A3J I;  4Y7N I;  1Z01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...