1S72Z

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s72Z00
1JJ2Y 1M1K1 1VQMZ 3CCJ1 3CXCZ 1QVFZ 3CMA1 1KQSY 1YIJZ 1S721 1VQ61 3CCE1 2QEX1 3CC7Z 1K9M1 3G4SZ 3CC41 1VQ71 1VQ91 2QA41 1YI2Z 3G6EZ 1VQO1 3CCEZ 2QEXZ 3CCSZ 1VQ41 1JJ2Z 3CC4Z 1VQ9Z 2QA4Z 1QVGY 1M901 1VQ51 1VQOZ 3CCLZ 1M1K2 1KQSZ 3OW2Z 1VQLZ 1W2BY 1YJ91 1Q861 1VQ4Z 3CME1 1Q7Y1 1VQ81 3CCMZ 1K732 1VQ5Z 3CCU1 2OTL1 1VQP1 1YJNZ 1VQK1 3CCQ1 1YHQ1 1NJI1 2OTJ1 3CCJZ 3CCR1 1QVGZ 1Q811 3CMAZ 1VQPZ 1S72Z 1VQ6Z 3CD61 1K8A1 1W2BZ 3CPWY 3G711 1M902 1VQ7Z 1N8R1 1VQN1 3CCV1 1KD11 1Q7Y2 1Q821 3I551 1VQNZ 1K9M2 3CXCY 3I561 1QVFY 3I55Z 3CPWZ 1YJ9Z 1Q812 3CMEZ 1VQ8Z 3CC21 3CCUZ 1VQM1 2OTLZ 1VQKZ 3CCQZ 1YHQZ 2OTJZ 1YIJ1 1YIT1 1KC81 3CC71 3CCRZ 3G4S1 3CC2Z 1YI21 1Q862 3CD6Z 3G6E1 3G71Z 3OW2Y 1YITZ 3CCS1 1K731 3CCVZ 1YJW1 1NJI2 3CCL1 1VQL1 1K8A2 1YJWZ 3I56Z 1KC82 1N8R2 3CCM1 1YJN1 1KD12 1Q822
chains in the Genus database with same CATH superfamily
1JJ2Y 2V8JA 2PMZA 5D1PA 4E30A 1QVFZ 4NBBA 1VQ61 3VB9A 2IV2X 4RVHA 2PK7A 1TWAI 3GTQI 3S1NI 2JA5I 2H85A 2NVTI 2YADA 1X0TA 2QEXZ 3HOWI 4A3LI 2P28A 1VQ41 3CC4Z 3J80b 1WIIA 1VLAA 1M901 1VQ51 4NB9A 5IP7I 3ESWA 1M1K2 4Y52I 3PO3S 1W2BY 2GTIA 4MRIA 5CM2M 4QTUA 4A3EI 3D6WA 1K732 2B63I 2IZ3A 4E2XA 3CCQ1 2JA6I 2JIOA 3S16I 3CCR1 1QVGZ 3CMAZ 1S72Z 3CD61 2VPWA 2NAPA 1DL6A 3G711 2VUMI 3NH8A 4BBRI 1Y1VI 2Q51A 1Q7Y2 2E2HI 4A3FI 1Z03A 1TWCI 3F3FC 2VF1A 4NBHA 4E31A 3IFUA 2JS4A 4DGLA 3I561 3CXCY 2JR6A 3FQMA 3CMEZ 2V8KA 2I3CA 1RNIA 3LUSA 1PFTA 2JIRA 1VQKZ 4BY7I 2OTJZ 3GCFA 1RO4A 3CC2Z 3EERA 2R92I 5AN9F 1I3QI 3MZKB 1X3WA 2EGTA 2K3RA 1ML8A 4XX2A 1TWFI 2WB1A 4DK1A 4A3KI 3S1RI 2E9HA 3EEDA 4BBSI 2K5RA 2QKDA 4HH4A 3KIHA 1WJ2A 3I07A 1WCMI 3J81f 1QXFA 1KC82 2VUGA 2KI7B 3F3PC 1M1K1 1VQMZ 3CXCZ 4X6AI 3CMA1 2ZAEB 3PO3I 1S721 3CCE1 3CC7Z 1RLYA 1VQ91 2QA41 3S14I 4A3DI 4CL1A 1VQO1 4MD7A 4NBEA 4A3MI 2W04A 3PO2I 5C4JI 3J81b 3J80f 1QVGY 2QLVB 1KQSZ 4AYBA 2W03A 5D1OA 1USPB 3NH4A 2JUBA 3CME1 1Q7Y1 2F4MA 2F4OA 3CQZI 3HOZI 2Q4ZA 3BG0B 4A3JI 1Y1WI 1VQK1 3RZDI 4NH1C 1S7MA 2OTJ1 1ZB9A 3S17I 3GTLI 3M3YI 2DE6A 3T4NB 3D2LA 1VQPZ 1K8A1 1WZNA 1L1OC 2VPXA 1Y8CA 1RO2A 1KD11 2V8IA 3GTMS 3HKZA 3GTOI 3MONA 1VQNZ 3IR7A 2JA8I 3I4MI 3I55Z 5FLMI 3CPWZ 5C44I 3CCUZ 4A3II 1VQM1 3KIFA 1K83I 3M4OI 3S1MI 4BY1I 1YHQZ 4EWCA 1YIT1 1KC81 3CC71 3TDHB 2GU2A 3GTKI 1R9TI 2E2JI 3VMGA 3VMHA 2OZKA 1WW9A 2O53A 1K8A2 1Z01A 1YJWZ 1Q16A 3IF8A 5T67A 1X3ZA 2AYDA 2HF1A 2RPRA 4E2YA 4MD9A 1NP6A 4TNUA 2P3YA 1KD12 2V3VA 4E33A 1QF8A 4NFRA 5IT9f 4E2WA 3H3VJ 2J6AA 1KQSY 2JNYA 1YIJZ 3GTGI 2VPZA 2QEX1 2R7ZI 5FLXf 3CC41 3GTJI 1FDIA 3CCSZ 1TFIA 5A2Qf 1JWHC 2O4HA 2LFUA 3NH5A 3U50C 2E2II 2WAQA 2RIQA 1VQ4Z 3RZOI 1VQ5Z 5IT9b 3I4NI 3CCU1 2E7ZA 1YJNZ 3GTMI 1YHQ1 5FLXb 2LEXA 3NDIA 3CCJZ 1Y1VS 2KPIA 3BG1B 3CPWY 3JAMf 4E2ZA 5A2Qb 4RS4A 1VQ7Z 3S1QI 3S2DI 4RVFA 2NVYI 2JMOA 3J7A4 4A3CI 4A93I 3Q87A 4A3BI 1YUAA 4MD8A 4HGYA 1TWGI 2AKLA 2IZ4A 2HU9A 1YJ9Z 2OOXB 1Q812 1P9NA 4RVDA 3HOUI 1VQ8Z 5D1OB 3FKII 3CC21 2OTLZ 3JAMb 1YIJ1 5IP9I 3S15I 2QRCB 3GTPI 3OW2Y 1LQLA 3CCS1 2RBLA 5T64A 2M6NA 3CCVZ 1TWHI 2DE7A 2QR1B 4RVGA 3MZLB 2R6MA 4NBCA 4Y7NI 4MXUA 2QRDB 3GKQA 2Y0SA 3HOYI 4QTTA 1YJN1 1I6HI 2G2KA 1I50I 3IX0A 3CCJ1 2OOYB 1FDOA 2VPYA 1RQFA 1K9M1 3G4SZ 1VQ71 2R93I 1YI2Z 2YU9I 3G6EZ 3CCEZ 2PM9A 3QWUA 1JJ2Z 5LL6f 1VQ9Z 2QA4Z 4BXXI 3HOXI 1VQOZ 3CCLZ 3OW2Z 1VQLZ 4MONA 1YJ91 1Q861 1YUKA 4NBFA 1VQ81 3CCMZ 1ZH1A 1N2FA 2OTL1 3D9XA 1VQP1 3H0GI 2QREB 2JIPA 5C4XI 1NJI1 2NVXI 2GTHA 1KRLA 1Q811 2M48A 4RV9A 1VQ6Z 1W2BZ 1M902 4DQYB 1SFOI 1N8R1 1VQN1 4NBGA 3CCV1 1Q821 3I551 1ZB8A 4S1TA 1AA6A 3S2HI 2JA7I 1K9M2 3NDJA 1QVFY 4MH4A 5T6BA 4NOZA 4A3GI 4NBDA 2RHBA 3CCQZ 3VTNA 1QYPA 1SIWA 4HGZA 3HOVI 3CCRZ 2RT9A 3G4S1 3VMIA 1YI21 1Q862 3TE5B 3CD6Z 3G6E1 2V45A 3G71Z 2BJOA 2JIMA 1NUIA 5C3EI 1YITZ 1K731 3NFZA 4NBAA 2JIQA 1YJW1 1NJI2 3P5JB 3K7AI 1Z02A 1USPA 3CCL1 4NB8A 2DE5A 1VQL1 2NVQI 3I56Z 3FQQA 2LIYA 1N8R2 3CCM1 4E32A 1RO0A 1Q822
chains in the Genus database with same CATH topology
1JJ2Y 2V8JA 2PMZA 5D1PA 4E30A 1QVFZ 4NBBA 1VQ61 3VB9A 4RVHA 2PK7A 1TWAI 3GTQI 3S1NI 2JA5I 2H85A 2NVTI 2YADA 1X0TA 2QEXZ 3HOWI 4A3LI 2P28A 1VQ41 3CC4Z 3J80b 1WIIA 1VLAA 1M901 1VQ51 4NB9A 5IP7I 3ESWA 1M1K2 4Y52I 3PO3S 1W2BY 2GTIA 4MRIA 5CM2M 4QTUA 4A3EI 3D6WA 1K732 2B63I 2IZ3A 4E2XA 3CCQ1 2JA6I 3S16I 3CCR1 1QVGZ 3CMAZ 1S72Z 3CD61 1DL6A 3G711 2VUMI 3NH8A 4BBRI 1Y1VI 2Q51A 1Q7Y2 2E2HI 4A3FI 1Z03A 1TWCI 3F3FC 2VF1A 4NBHA 4E31A 3IFUA 2JS4A 4DGLA 3I561 3CXCY 2JR6A 3FQMA 3CMEZ 2V8KA 2I3CA 1RNIA 3LUSA 1PFTA 1VQKZ 4BY7I 2OTJZ 3GCFA 1RO4A 3CC2Z 3EERA 2R92I 5AN9F 1I3QI 3MZKB 1X3WA 2EGTA 2K3RA 1ML8A 4XX2A 1TWFI 2WB1A 4DK1A 4A3KI 3S1RI 2E9HA 3EEDA 4BBSI 2K5RA 2QKDA 4HH4A 3KIHA 3I07A 1WCMI 3J81f 1KC82 2VUGA 2KI7B 3F3PC 1M1K1 1VQMZ 3CXCZ 4X6AI 3CMA1 2ZAEB 3PO3I 1S721 3CCE1 3CC7Z 1RLYA 1VQ91 2QA41 3S14I 4A3DI 4CL1A 1VQO1 4MD7A 4NBEA 4A3MI 2W04A 3PO2I 5C4JI 3J81b 3J80f 1QVGY 2QLVB 1KQSZ 4AYBA 2W03A 5D1OA 1USPB 3NH4A 2JUBA 3CME1 1Q7Y1 2F4MA 2F4OA 3CQZI 3HOZI 2Q4ZA 3BG0B 4A3JI 1Y1WI 1VQK1 3RZDI 4NH1C 1S7MA 2OTJ1 1ZB9A 3S17I 3GTLI 3M3YI 2DE6A 3T4NB 1VQPZ 1K8A1 1L1OC 1RO2A 1KD11 2V8IA 3GTMS 3HKZA 3GTOI 3MONA 1VQNZ 2JA8I 3I4MI 3I55Z 5FLMI 3CPWZ 5C44I 3CCUZ 4A3II 1VQM1 3KIFA 1K83I 3M4OI 3S1MI 4BY1I 1YHQZ 4EWCA 1YIT1 1KC81 3CC71 3TDHB 2GU2A 3GTKI 1R9TI 2E2JI 3VMGA 3VMHA 2OZKA 1WW9A 2O53A 1K8A2 1Z01A 1YJWZ 3IF8A 5T67A 1X3ZA 2HF1A 2RPRA 4E2YA 4MD9A 1NP6A 4TNUA 2P3YA 1KD12 4E33A 1QF8A 4NFRA 5IT9f 4E2WA 3H3VJ 2J6AA 1KQSY 2JNYA 1YIJZ 3GTGI 2QEX1 2R7ZI 5FLXf 3CC41 3GTJI 3CCSZ 1TFIA 5A2Qf 1JWHC 2O4HA 2LFUA 3NH5A 3U50C 2E2II 2WAQA 2RIQA 1VQ4Z 3RZOI 1VQ5Z 5IT9b 3I4NI 3CCU1 1YJNZ 3GTMI 1YHQ1 5FLXb 3NDIA 3CCJZ 1Y1VS 2KPIA 3BG1B 3CPWY 3JAMf 4E2ZA 5A2Qb 4RS4A 1VQ7Z 3S1QI 3S2DI 4RVFA 2NVYI 2JMOA 3J7A4 4A3CI 4A93I 3Q87A 4A3BI 1YUAA 4MD8A 4HGYA 1TWGI 2AKLA 2IZ4A 2HU9A 1YJ9Z 2OOXB 1Q812 1P9NA 4RVDA 3HOUI 1VQ8Z 5D1OB 3FKII 3CC21 2OTLZ 3JAMb 1YIJ1 5IP9I 3S15I 2QRCB 3GTPI 3OW2Y 1LQLA 3CCS1 2RBLA 5T64A 2M6NA 3CCVZ 1TWHI 2DE7A 2QR1B 4RVGA 3MZLB 2R6MA 4NBCA 4Y7NI 4MXUA 2QRDB 3GKQA 2Y0SA 3HOYI 4QTTA 1YJN1 1I6HI 2G2KA 1I50I 3IX0A 3CCJ1 2OOYB 1RQFA 1K9M1 3G4SZ 1VQ71 2R93I 1YI2Z 2YU9I 3G6EZ 3CCEZ 2PM9A 3QWUA 1JJ2Z 5LL6f 1VQ9Z 2QA4Z 4BXXI 3HOXI 1VQOZ 3CCLZ 3OW2Z 1VQLZ 4MONA 1YJ91 1Q861 1YUKA 4NBFA 1VQ81 3CCMZ 1ZH1A 1N2FA 2OTL1 3D9XA 1VQP1 3H0GI 2QREB 5C4XI 1NJI1 2NVXI 2GTHA 1KRLA 1Q811 2M48A 4RV9A 1VQ6Z 1W2BZ 1M902 4DQYB 1SFOI 1N8R1 1VQN1 4NBGA 3CCV1 1Q821 3I551 1ZB8A 4S1TA 3S2HI 2JA7I 1K9M2 3NDJA 1QVFY 4MH4A 5T6BA 4NOZA 4A3GI 4NBDA 2RHBA 3CCQZ 3VTNA 1QYPA 4HGZA 3HOVI 3CCRZ 2RT9A 3G4S1 3VMIA 1YI21 1Q862 3TE5B 3CD6Z 3G6E1 3G71Z 2BJOA 1NUIA 5C3EI 1YITZ 1K731 3NFZA 4NBAA 1YJW1 1NJI2 3P5JB 3K7AI 1Z02A 1USPA 3CCL1 4NB8A 2DE5A 1VQL1 2NVQI 3I56Z 3FQQA 2LIYA 1N8R2 3CCM1 4E32A 1RO0A 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Y;  1M1K 1;  1VQM Z;  3CCJ 1;  3CXC Z;  1QVF Z;  3CMA 1;  1KQS Y;  1YIJ Z;  1S72 1;  1VQ6 1;  3CCE 1;  2QEX 1;  3CC7 Z;  1K9M 1;  3G4S Z;  3CC4 1;  1VQ7 1;  1VQ9 1;  2QA4 1;  1YI2 Z;  3G6E Z;  1VQO 1;  3CCE Z;  2QEX Z;  3CCS Z;  1VQ4 1;  1JJ2 Z;  3CC4 Z;  1VQ9 Z;  2QA4 Z;  1QVG Y;  1M90 1;  1VQ5 1;  1VQO Z;  3CCL Z;  1M1K 2;  1KQS Z;  3OW2 Z;  1VQL Z;  1W2B Y;  1YJ9 1;  1Q86 1;  1VQ4 Z;  3CME 1;  1Q7Y 1;  1VQ8 1;  3CCM Z;  1K73 2;  1VQ5 Z;  3CCU 1;  2OTL 1;  1VQP 1;  1YJN Z;  1VQK 1;  3CCQ 1;  1YHQ 1;  1NJI 1;  2OTJ 1;  3CCJ Z;  3CCR 1;  1QVG Z;  1Q81 1;  3CMA Z;  1VQP Z;  1S72 Z;  1VQ6 Z;  3CD6 1;  1K8A 1;  1W2B Z;  3CPW Y;  3G71 1;  1M90 2;  1VQ7 Z;  1N8R 1;  1VQN 1;  3CCV 1;  1KD1 1;  1Q7Y 2;  1Q82 1;  3I55 1;  1VQN Z;  1K9M 2;  3CXC Y;  3I56 1;  1QVF Y;  3I55 Z;  3CPW Z;  1YJ9 Z;  1Q81 2;  3CME Z;  1VQ8 Z;  3CC2 1;  3CCU Z;  1VQM 1;  2OTL Z;  1VQK Z;  3CCQ Z;  1YHQ Z;  2OTJ Z;  1YIJ 1;  1YIT 1;  1KC8 1;  3CC7 1;  3CCR Z;  3G4S 1;  3CC2 Z;  1YI2 1;  1Q86 2;  3CD6 Z;  3G6E 1;  3G71 Z;  3OW2 Y;  1YIT Z;  3CCS 1;  1K73 1;  3CCV Z;  1YJW 1;  1NJI 2;  3CCL 1;  1VQL 1;  1K8A 2;  1YJW Z;  3I56 Z;  1KC8 2;  1N8R 2;  3CCM 1;  1YJN 1;  1KD1 2;  1Q82 2; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  2V8J A;  2PMZ A;  5D1P A;  4E30 A;  1QVF Z;  4NBB A;  1VQ6 1;  3VB9 A;  2IV2 X;  4RVH A;  2PK7 A;  1TWA I;  3GTQ I;  3S1N I;  2JA5 I;  2H85 A;  2NVT I;  2YAD A;  1X0T A;  2QEX Z;  3HOW I;  4A3L I;  2P28 A;  1VQ4 1;  3CC4 Z;  3J80 b;  1WII A;  1VLA A;  1M90 1;  1VQ5 1;  4NB9 A;  5IP7 I;  3ESW A;  1M1K 2;  4Y52 I;  3PO3 S;  1W2B Y;  2GTI A;  4MRI A;  5CM2 M;  4QTU A;  4A3E I;  3D6W A;  1K73 2;  2B63 I;  2IZ3 A;  4E2X A;  3CCQ 1;  2JA6 I;  2JIO A;  3S16 I;  3CCR 1;  1QVG Z;  3CMA Z;  1S72 Z;  3CD6 1;  2VPW A;  2NAP A;  1DL6 A;  3G71 1;  2VUM I;  3NH8 A;  4BBR I;  1Y1V I;  2Q51 A;  1Q7Y 2;  2E2H I;  4A3F I;  1Z03 A;  1TWC I;  3F3F C;  2VF1 A;  4NBH A;  4E31 A;  3IFU A;  2JS4 A;  4DGL A;  3I56 1;  3CXC Y;  2JR6 A;  3FQM A;  3CME Z;  2V8K A;  2I3C A;  1RNI A;  3LUS A;  1PFT A;  2JIR A;  1VQK Z;  4BY7 I;  2OTJ Z;  3GCF A;  1RO4 A;  3CC2 Z;  3EER A;  2R92 I;  5AN9 F;  1I3Q I;  3MZK B;  1X3W A;  2EGT A;  2K3R A;  1ML8 A;  4XX2 A;  1TWF I;  2WB1 A;  4DK1 A;  4A3K I;  3S1R I;  2E9H A;  3EED A;  4BBS I;  2K5R A;  2QKD A;  4HH4 A;  3KIH A;  1WJ2 A;  3I07 A;  1WCM I;  3J81 f;  1QXF A;  1KC8 2;  2VUG A;  2KI7 B;  3F3P C;  1M1K 1;  1VQM Z;  3CXC Z;  4X6A I;  3CMA 1;  2ZAE B;  3PO3 I;  1S72 1;  3CCE 1;  3CC7 Z;  1RLY A;  1VQ9 1;  2QA4 1;  3S14 I;  4A3D I;  4CL1 A;  1VQO 1;  4MD7 A;  4NBE A;  4A3M I;  2W04 A;  3PO2 I;  5C4J I;  3J81 b;  3J80 f;  1QVG Y;  2QLV B;  1KQS Z;  4AYB A;  2W03 A;  5D1O A;  1USP B;  3NH4 A;  2JUB A;  3CME 1;  1Q7Y 1;  2F4M A;  2F4O A;  3CQZ I;  3HOZ I;  2Q4Z A;  3BG0 B;  4A3J I;  1Y1W I;  1VQK 1;  3RZD I;  4NH1 C;  1S7M A;  2OTJ 1;  1ZB9 A;  3S17 I;  3GTL I;  3M3Y I;  2DE6 A;  3T4N B;  3D2L A;  1VQP Z;  1K8A 1;  1WZN A;  1L1O C;  2VPX A;  1Y8C A;  1RO2 A;  1KD1 1;  2V8I A;  3GTM S;  3HKZ A;  3GTO I;  3MON A;  1VQN Z;  3IR7 A;  2JA8 I;  3I4M I;  3I55 Z;  5FLM I;  3CPW Z;  5C44 I;  3CCU Z;  4A3I I;  1VQM 1;  3KIF A;  1K83 I;  3M4O I;  3S1M I;  4BY1 I;  1YHQ Z;  4EWC A;  1YIT 1;  1KC8 1;  3CC7 1;  3TDH B;  2GU2 A;  3GTK I;  1R9T I;  2E2J I;  3VMG A;  3VMH A;  2OZK A;  1WW9 A;  2O53 A;  1K8A 2;  1Z01 A;  1YJW Z;  1Q16 A;  3IF8 A;  5T67 A;  1X3Z A;  2AYD A;  2HF1 A;  2RPR A;  4E2Y A;  4MD9 A;  1NP6 A;  4TNU A;  2P3Y A;  1KD1 2;  2V3V A;  4E33 A;  1QF8 A;  4NFR A;  5IT9 f;  4E2W A;  3H3V J;  2J6A A;  1KQS Y;  2JNY A;  1YIJ Z;  3GTG I;  2VPZ A;  2QEX 1;  2R7Z I;  5FLX f;  3CC4 1;  3GTJ I;  1FDI A;  3CCS Z;  1TFI A;  5A2Q f;  1JWH C;  2O4H A;  2LFU A;  3NH5 A;  3U50 C;  2E2I I;  2WAQ A;  2RIQ A;  1VQ4 Z;  3RZO I;  1VQ5 Z;  5IT9 b;  3I4N I;  3CCU 1;  2E7Z A;  1YJN Z;  3GTM I;  1YHQ 1;  5FLX b;  2LEX A;  3NDI A;  3CCJ Z;  1Y1V S;  2KPI A;  3BG1 B;  3CPW Y;  3JAM f;  4E2Z A;  5A2Q b;  4RS4 A;  1VQ7 Z;  3S1Q I;  3S2D I;  4RVF A;  2NVY I;  2JMO A;  3J7A 4;  4A3C I;  4A93 I;  3Q87 A;  4A3B I;  1YUA A;  4MD8 A;  4HGY A;  1TWG I;  2AKL A;  2IZ4 A;  2HU9 A;  1YJ9 Z;  2OOX B;  1Q81 2;  1P9N A;  4RVD A;  3HOU I;  1VQ8 Z;  5D1O B;  3FKI I;  3CC2 1;  2OTL Z;  3JAM b;  1YIJ 1;  5IP9 I;  3S15 I;  2QRC B;  3GTP I;  3OW2 Y;  1LQL A;  3CCS 1;  2RBL A;  5T64 A;  2M6N A;  3CCV Z;  1TWH I;  2DE7 A;  2QR1 B;  4RVG A;  3MZL B;  2R6M A;  4NBC A;  4Y7N I;  4MXU A;  2QRD B;  3GKQ A;  2Y0S A;  3HOY I;  4QTT A;  1YJN 1;  1I6H I;  2G2K A;  1I50 I;  3IX0 A;  3CCJ 1;  2OOY B;  1FDO A;  2VPY A;  1RQF A;  1K9M 1;  3G4S Z;  1VQ7 1;  2R93 I;  1YI2 Z;  2YU9 I;  3G6E Z;  3CCE Z;  2PM9 A;  3QWU A;  1JJ2 Z;  5LL6 f;  1VQ9 Z;  2QA4 Z;  4BXX I;  3HOX I;  1VQO Z;  3CCL Z;  3OW2 Z;  1VQL Z;  4MON A;  1YJ9 1;  1Q86 1;  1YUK A;  4NBF A;  1VQ8 1;  3CCM Z;  1ZH1 A;  1N2F A;  2OTL 1;  3D9X A;  1VQP 1;  3H0G I;  2QRE B;  2JIP A;  5C4X I;  1NJI 1;  2NVX I;  2GTH A;  1KRL A;  1Q81 1;  2M48 A;  4RV9 A;  1VQ6 Z;  1W2B Z;  1M90 2;  4DQY B;  1SFO I;  1N8R 1;  1VQN 1;  4NBG A;  3CCV 1;  1Q82 1;  3I55 1;  1ZB8 A;  4S1T A;  1AA6 A;  3S2H I;  2JA7 I;  1K9M 2;  3NDJ A;  1QVF Y;  4MH4 A;  5T6B A;  4NOZ A;  4A3G I;  4NBD A;  2RHB A;  3CCQ Z;  3VTN A;  1QYP A;  1SIW A;  4HGZ A;  3HOV I;  3CCR Z;  2RT9 A;  3G4S 1;  3VMI A;  1YI2 1;  1Q86 2;  3TE5 B;  3CD6 Z;  3G6E 1;  2V45 A;  3G71 Z;  2BJO A;  2JIM A;  1NUI A;  5C3E I;  1YIT Z;  1K73 1;  3NFZ A;  4NBA A;  2JIQ A;  1YJW 1;  1NJI 2;  3P5J B;  3K7A I;  1Z02 A;  1USP A;  3CCL 1;  4NB8 A;  2DE5 A;  1VQL 1;  2NVQ I;  3I56 Z;  3FQQ A;  2LIY A;  1N8R 2;  3CCM 1;  4E32 A;  1RO0 A;  1Q82 2; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  2V8J A;  2PMZ A;  5D1P A;  4E30 A;  1QVF Z;  4NBB A;  1VQ6 1;  3VB9 A;  4RVH A;  2PK7 A;  1TWA I;  3GTQ I;  3S1N I;  2JA5 I;  2H85 A;  2NVT I;  2YAD A;  1X0T A;  2QEX Z;  3HOW I;  4A3L I;  2P28 A;  1VQ4 1;  3CC4 Z;  3J80 b;  1WII A;  1VLA A;  1M90 1;  1VQ5 1;  4NB9 A;  5IP7 I;  3ESW A;  1M1K 2;  4Y52 I;  3PO3 S;  1W2B Y;  2GTI A;  4MRI A;  5CM2 M;  4QTU A;  4A3E I;  3D6W A;  1K73 2;  2B63 I;  2IZ3 A;  4E2X A;  3CCQ 1;  2JA6 I;  3S16 I;  3CCR 1;  1QVG Z;  3CMA Z;  1S72 Z;  3CD6 1;  1DL6 A;  3G71 1;  2VUM I;  3NH8 A;  4BBR I;  1Y1V I;  2Q51 A;  1Q7Y 2;  2E2H I;  4A3F I;  1Z03 A;  1TWC I;  3F3F C;  2VF1 A;  4NBH A;  4E31 A;  3IFU A;  2JS4 A;  4DGL A;  3I56 1;  3CXC Y;  2JR6 A;  3FQM A;  3CME Z;  2V8K A;  2I3C A;  1RNI A;  3LUS A;  1PFT A;  1VQK Z;  4BY7 I;  2OTJ Z;  3GCF A;  1RO4 A;  3CC2 Z;  3EER A;  2R92 I;  5AN9 F;  1I3Q I;  3MZK B;  1X3W A;  2EGT A;  2K3R A;  1ML8 A;  4XX2 A;  1TWF I;  2WB1 A;  4DK1 A;  4A3K I;  3S1R I;  2E9H A;  3EED A;  4BBS I;  2K5R A;  2QKD A;  4HH4 A;  3KIH A;  3I07 A;  1WCM I;  3J81 f;  1KC8 2;  2VUG A;  2KI7 B;  3F3P C;  1M1K 1;  1VQM Z;  3CXC Z;  4X6A I;  3CMA 1;  2ZAE B;  3PO3 I;  1S72 1;  3CCE 1;  3CC7 Z;  1RLY A;  1VQ9 1;  2QA4 1;  3S14 I;  4A3D I;  4CL1 A;  1VQO 1;  4MD7 A;  4NBE A;  4A3M I;  2W04 A;  3PO2 I;  5C4J I;  3J81 b;  3J80 f;  1QVG Y;  2QLV B;  1KQS Z;  4AYB A;  2W03 A;  5D1O A;  1USP B;  3NH4 A;  2JUB A;  3CME 1;  1Q7Y 1;  2F4M A;  2F4O A;  3CQZ I;  3HOZ I;  2Q4Z A;  3BG0 B;  4A3J I;  1Y1W I;  1VQK 1;  3RZD I;  4NH1 C;  1S7M A;  2OTJ 1;  1ZB9 A;  3S17 I;  3GTL I;  3M3Y I;  2DE6 A;  3T4N B;  1VQP Z;  1K8A 1;  1L1O C;  1RO2 A;  1KD1 1;  2V8I A;  3GTM S;  3HKZ A;  3GTO I;  3MON A;  1VQN Z;  2JA8 I;  3I4M I;  3I55 Z;  5FLM I;  3CPW Z;  5C44 I;  3CCU Z;  4A3I I;  1VQM 1;  3KIF A;  1K83 I;  3M4O I;  3S1M I;  4BY1 I;  1YHQ Z;  4EWC A;  1YIT 1;  1KC8 1;  3CC7 1;  3TDH B;  2GU2 A;  3GTK I;  1R9T I;  2E2J I;  3VMG A;  3VMH A;  2OZK A;  1WW9 A;  2O53 A;  1K8A 2;  1Z01 A;  1YJW Z;  3IF8 A;  5T67 A;  1X3Z A;  2HF1 A;  2RPR A;  4E2Y A;  4MD9 A;  1NP6 A;  4TNU A;  2P3Y A;  1KD1 2;  4E33 A;  1QF8 A;  4NFR A;  5IT9 f;  4E2W A;  3H3V J;  2J6A A;  1KQS Y;  2JNY A;  1YIJ Z;  3GTG I;  2QEX 1;  2R7Z I;  5FLX f;  3CC4 1;  3GTJ I;  3CCS Z;  1TFI A;  5A2Q f;  1JWH C;  2O4H A;  2LFU A;  3NH5 A;  3U50 C;  2E2I I;  2WAQ A;  2RIQ A;  1VQ4 Z;  3RZO I;  1VQ5 Z;  5IT9 b;  3I4N I;  3CCU 1;  1YJN Z;  3GTM I;  1YHQ 1;  5FLX b;  3NDI A;  3CCJ Z;  1Y1V S;  2KPI A;  3BG1 B;  3CPW Y;  3JAM f;  4E2Z A;  5A2Q b;  4RS4 A;  1VQ7 Z;  3S1Q I;  3S2D I;  4RVF A;  2NVY I;  2JMO A;  3J7A 4;  4A3C I;  4A93 I;  3Q87 A;  4A3B I;  1YUA A;  4MD8 A;  4HGY A;  1TWG I;  2AKL A;  2IZ4 A;  2HU9 A;  1YJ9 Z;  2OOX B;  1Q81 2;  1P9N A;  4RVD A;  3HOU I;  1VQ8 Z;  5D1O B;  3FKI I;  3CC2 1;  2OTL Z;  3JAM b;  1YIJ 1;  5IP9 I;  3S15 I;  2QRC B;  3GTP I;  3OW2 Y;  1LQL A;  3CCS 1;  2RBL A;  5T64 A;  2M6N A;  3CCV Z;  1TWH I;  2DE7 A;  2QR1 B;  4RVG A;  3MZL B;  2R6M A;  4NBC A;  4Y7N I;  4MXU A;  2QRD B;  3GKQ A;  2Y0S A;  3HOY I;  4QTT A;  1YJN 1;  1I6H I;  2G2K A;  1I50 I;  3IX0 A;  3CCJ 1;  2OOY B;  1RQF A;  1K9M 1;  3G4S Z;  1VQ7 1;  2R93 I;  1YI2 Z;  2YU9 I;  3G6E Z;  3CCE Z;  2PM9 A;  3QWU A;  1JJ2 Z;  5LL6 f;  1VQ9 Z;  2QA4 Z;  4BXX I;  3HOX I;  1VQO Z;  3CCL Z;  3OW2 Z;  1VQL Z;  4MON A;  1YJ9 1;  1Q86 1;  1YUK A;  4NBF A;  1VQ8 1;  3CCM Z;  1ZH1 A;  1N2F A;  2OTL 1;  3D9X A;  1VQP 1;  3H0G I;  2QRE B;  5C4X I;  1NJI 1;  2NVX I;  2GTH A;  1KRL A;  1Q81 1;  2M48 A;  4RV9 A;  1VQ6 Z;  1W2B Z;  1M90 2;  4DQY B;  1SFO I;  1N8R 1;  1VQN 1;  4NBG A;  3CCV 1;  1Q82 1;  3I55 1;  1ZB8 A;  4S1T A;  3S2H I;  2JA7 I;  1K9M 2;  3NDJ A;  1QVF Y;  4MH4 A;  5T6B A;  4NOZ A;  4A3G I;  4NBD A;  2RHB A;  3CCQ Z;  3VTN A;  1QYP A;  4HGZ A;  3HOV I;  3CCR Z;  2RT9 A;  3G4S 1;  3VMI A;  1YI2 1;  1Q86 2;  3TE5 B;  3CD6 Z;  3G6E 1;  3G71 Z;  2BJO A;  1NUI A;  5C3E I;  1YIT Z;  1K73 1;  3NFZ A;  4NBA A;  1YJW 1;  1NJI 2;  3P5J B;  3K7A I;  1Z02 A;  1USP A;  3CCL 1;  4NB8 A;  2DE5 A;  1VQL 1;  2NVQ I;  3I56 Z;  3FQQ A;  2LIY A;  1N8R 2;  3CCM 1;  4E32 A;  1RO0 A;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...