1S72Z

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s72Z00
1Q821 3CC71 2OTJZ 1VQ7Z 1KQSY 3CC4Z 1VQK1 1Q7Y1 3CCV1 1VQP1 1KC82 3CCM1 1NJI1 3G4SZ 3G711 1YIJ1 1YHQ1 1YJW1 3CME1 1Q822 1YITZ 3CCR1 1VQ9Z 1VQ4Z 1Q7Y2 1Q861 3CCLZ 1KQSZ 3CCE1 1NJI2 3CCU1 1VQO1 3CMA1 1VQ81 3CC2Z 1YJ9Z 1VQN1 2OTL1 1QVGY 2QEXZ 1JJ2Z 1Q862 3CPWY 1VQLZ 1M901 3CCQZ 1QVFY 3G6E1 1VQMZ 3OW2Y 3I561 3CCS1 1K8A1 3CC7Z 3CD61 3I551 3CXCY 1YJN1 1S721 3CCVZ 1VQKZ 1VQPZ 3CCMZ 1K9M1 3G71Z 2QA41 1YIJZ 1YI21 1YHQZ 1YJWZ 1Q811 3CMEZ 1VQ51 1K8A2 3CCRZ 3CCJ1 1W2BY 3CCEZ 3CXCZ 1K9M2 2QA4Z 3CCUZ 1VQOZ 3CMAZ 1Q812 1M1K1 1KD11 1VQ8Z 2OTJ1 1VQ71 1VQ61 3CC41 1VQNZ 2OTLZ 3G4S1 1QVGZ 1M902 1W2BZ 3CPWZ 3G6EZ 1YIT1 1M1K2 3I56Z 1KD12 1QVFZ 1VQ6Z 1VQ91 1N8R1 1VQ41 3OW2Z 3CCSZ 3CCL1 3CD6Z 3I55Z 1YJNZ 1S72Z 1K731 1YI2Z 1JJ2Y 3CC21 1YJ91 1N8R2 2QEX1 1VQ5Z 1VQL1 3CCJZ 3CCQ1 1KC81 1K732 1VQM1
chains in the Genus database with same CATH superfamily
2V45A 2E2II 2KPIA 4MD7A 3D6WA 3CC71 3PO2I 2OTJZ 1VQK1 4BY1I 2RBLA 3S1MI 3G4SZ 3J81b 2J6AA 2E2JI 1USPB 1YJW1 3P5JB 4A3JI 2W03A 1Q822 1YITZ 3S15I 1PFTA 1VQ9Z 5T64A 2RPRA 3BG1B 4MD8A 2RHBA 4NBDA 1RNIA 4NBGA 3GTMI 2F4OA 3KIFA 2RIQA 4BXXI 1ZH1A 3J81f 4MRIA 1QVGY 4QTTA 2R6MA 1VQLZ 3VB9A 1P9NA 1Q16A 5C3EI 3G6E1 1TWCI 5T67A 3CCS1 3CC7Z 3CD61 1VQKZ 3VMHA 4E30A 4XX2A 1QF8A 1DL6A 3LUSA 3J80b 2K3RA 4RVGA 3VMIA 1YJWZ 3NH5A 4A3DI 1VQ51 1K8A2 4Y7NI 2HF1A 4A3BI 5C4XI 3RZOI 3GTOI 2Q4ZA 3CXCZ 1K9M2 3I4NI 2QA4Z 1FDOA 3S2DI 1WJ2A 2VUGA 4RV9A 2YADA 1NP6A 5IP9I 1VQ61 2JIRA 3J80f 2JIOA 1W2BZ 3JAMb 3GTMS 3IR7A 3G6EZ 3S14I 1QVFZ 2P3YA 3CCSZ 3CCL1 3CD6Z 2W04A 2GTIA 3ESWA 2O53A 3CC21 1YJ91 2QEX1 3GKQA 2VPYA 1VQ5Z 3JAMf 1RO4A 3VMGA 1K732 1TWGI 3GTGI 4Y52I 1Q821 3H0GI 2P28A 1KQSY 3CCV1 3H3VJ 1KC82 4A3II 3CCM1 3G711 2JS4A 1YHQ1 3K7AI 3GTLI 4NOZA 3HOXI 3CME1 3HOWI 1Q7Y2 5IT9b 2QKDA 2IV2X 3CCLZ 1X3WA 1ZB8A 3M4OI 2Y0SA 2AKLA 2PM9A 2E2HI 1RO0A 3CC2Z 2NVQI 3S2HI 1YJ9Z 1JJ2Z 2QEXZ 3NH8A 1NUIA 2JIQA 3MZLB 3IX0A 3MONA 4E32A 1QVFY 5IT9f 4NBFA 1Y1WI 1K8A1 3S1RI 2V8IA 1S721 3CCVZ 5FLXb 4A3GI 4E2YA 3CCMZ 1K9M1 3G71Z 2QA41 2YU9I 1I6HI 5D1OA 1YHQZ 4MXUA 4BY7I 4E2WA 1Y1VS 3CMEZ 2VF1A 3FQMA 4DK1A 1AA6A 1YUAA 3J7A4 1YUKA 1Y8CA 3VTNA 4DGLA 3GTKI 5CM2M 2JA8I 2VPZA 2JIPA 5FLXf 3S1NI 2F4MA 2EGTA 3CC41 4X6AI 2O4HA 3M3YI 2JA5I 3MZKB 3QWUA 2BJOA 1M1K2 4A93I 1KD12 4E2XA 4TNUA 3OW2Z 3NFZA 1S72Z 2QRDB 4RVHA 1K731 2JA6I 1WIIA 1TWHI 5IP7I 1JJ2Y 1I3QI 4NFRA 1N8R2 3GTQI 2VPXA 3EERA 1KC81 3U50C 3HOUI 2IZ4A 3D2LA 3NDJA 3NDIA 4A3CI 4RVDA 1ZB9A 2B63I 2QR1B 1ML8A 3CC4Z 1Q7Y1 1RQFA 1YIJ1 3FKII 2LIYA 2DE7A 4RS4A 3CCR1 4S1TA 3TE5B 4A3MI 1NJI2 3CCU1 2PMZA 1QXFA 3CMA1 4NBAA 1VQN1 2OTL1 3HKZA 3CQZI 1Y1VI 1Q862 2H85A 3BG0B 3GTJI 5T6BA 1TWAI 3OW2Y 4HGZA 1RLYA 3I551 3CXCY 2LFUA 2JA7I 3D9XA 4RVFA 3S17I 3KIHA 1JWHC 1SIWA 2PK7A 1YIJZ 1YI21 3HOZI 4CL1A 4A3EI 5A2Qb 3CCRZ 2GU2A 1W2BY 3I07A 3CCUZ 4NBEA 1QYPA 2JNYA 4A3FI 3CMAZ 1Q812 2JUBA 4E31A 1M1K1 1KD11 1Z02A 1VQ71 2JR6A 1VQNZ 2OTLZ 1TFIA 3F3PC 2E9HA 2JMOA 5C44I 2HU9A 1K83I 4E33A 3CPWZ 5A2Qf 3S16I 3EEDA 2NVXI 3IF8A 4QTUA 4A3LI 2IZ3A 1N8R1 1VQ41 3F3FC 4HH4A 4NB8A 3HOVI 2DE6A 3I55Z 4E2ZA 1R9TI 2QLVB 1YI2Z 2QREB 5AN9F 1N2FA 1KRLA 3IFUA 3CCQ1 3I4MI 1VQM1 5LL6f 2M48A 5C4JI 4HGYA 2M6NA 2KI7B 1VQ7Z 5D1OB 3S1QI 1VQP1 3TDHB 3PO3I 1NJI1 4EWCA 1Z03A 5D1PA 2LEXA 1VQ4Z 1Q861 2R93I 1I50I 1KQSZ 3CCE1 3FQQA 3NH4A 2V8KA 1VQO1 2JIMA 2OZKA 2V3VA 1S7MA 1VQ81 3GTPI 4AYBA 2WAQA 1Z01A 3CPWY 1M901 4NBBA 3CCQZ 2OOXB 4MH4A 2DE5A 1VQMZ 4MD9A 2ZAEB 3I561 3HOYI 3RZDI 3T4NB 3Q87A 2NVYI 1YJN1 3GCFA 1VQPZ 2OOYB 1X3ZA 2K5RA 2WB1A 1WCMI 2E7ZA 1Q811 2R92I 1WW9A 2I3CA 3CCJ1 1VLAA 2Q51A 3PO3S 3CCEZ 2V8JA 1VQOZ 2G2KA 2R7ZI 1TWFI 2RT9A 1VQ8Z 2OTJ1 1X0TA 4NH1C 1SFOI 4NBCA 3G4S1 1QVGZ 1M902 1FDIA 4DQYB 2NVTI 2NAPA 1RO2A 1YIT1 3I56Z 4A3KI 1VQ6Z 1VQ91 1USPA 4MONA 4NBHA 1YJNZ 1L1OC 2AYDA 2VUMI 4BBSI 2GTHA 5FLMI 1VQL1 2QRCB 3CCJZ 4BBRI 4NB9A 1WZNA 1LQLA 2VPWA
chains in the Genus database with same CATH topology
2E2II 2KPIA 4MD7A 3D6WA 3CC71 3PO2I 2OTJZ 1VQK1 4BY1I 2RBLA 3S1MI 3G4SZ 3J81b 2J6AA 2E2JI 1USPB 1YJW1 3P5JB 4A3JI 2W03A 1Q822 1YITZ 3S15I 1PFTA 1VQ9Z 5T64A 2RPRA 3BG1B 4MD8A 2RHBA 4NBDA 1RNIA 4NBGA 3GTMI 2F4OA 3KIFA 2RIQA 4BXXI 1ZH1A 3J81f 4MRIA 1QVGY 4QTTA 2R6MA 1VQLZ 3VB9A 1P9NA 5C3EI 3G6E1 1TWCI 5T67A 3CCS1 3CC7Z 3CD61 1VQKZ 3VMHA 4E30A 4XX2A 1QF8A 1DL6A 3LUSA 3J80b 2K3RA 4RVGA 3VMIA 1YJWZ 3NH5A 4A3DI 1VQ51 1K8A2 4Y7NI 2HF1A 4A3BI 5C4XI 3RZOI 3GTOI 2Q4ZA 3CXCZ 1K9M2 3I4NI 2QA4Z 3S2DI 2VUGA 4RV9A 2YADA 1NP6A 5IP9I 1VQ61 3J80f 1W2BZ 3JAMb 3GTMS 3G6EZ 3S14I 1QVFZ 2P3YA 3CCSZ 3CCL1 3CD6Z 2W04A 2GTIA 3ESWA 2O53A 3CC21 1YJ91 2QEX1 3GKQA 1VQ5Z 3JAMf 1RO4A 3VMGA 1K732 1TWGI 3GTGI 4Y52I 1Q821 3H0GI 2P28A 1KQSY 3CCV1 3H3VJ 1KC82 4A3II 3CCM1 3G711 2JS4A 1YHQ1 3K7AI 3GTLI 4NOZA 3HOXI 3CME1 3HOWI 1Q7Y2 5IT9b 2QKDA 3CCLZ 1X3WA 1ZB8A 3M4OI 2Y0SA 2AKLA 2PM9A 2E2HI 1RO0A 3CC2Z 2NVQI 3S2HI 1YJ9Z 1JJ2Z 2QEXZ 3NH8A 1NUIA 3MZLB 3IX0A 3MONA 4E32A 1QVFY 5IT9f 4NBFA 1Y1WI 1K8A1 3S1RI 2V8IA 1S721 3CCVZ 5FLXb 4A3GI 4E2YA 3CCMZ 1K9M1 3G71Z 2QA41 2YU9I 1I6HI 5D1OA 1YHQZ 4MXUA 4BY7I 4E2WA 1Y1VS 3CMEZ 2VF1A 3FQMA 4DK1A 1YUAA 3J7A4 1YUKA 3GTKI 3VTNA 4DGLA 5CM2M 2JA8I 5FLXf 3S1NI 2F4MA 2EGTA 3CC41 4X6AI 2O4HA 3M3YI 2JA5I 3MZKB 3QWUA 2BJOA 1M1K2 4A93I 1KD12 4E2XA 4TNUA 3OW2Z 3NFZA 1S72Z 2QRDB 4RVHA 1K731 2JA6I 1WIIA 1TWHI 5IP7I 1JJ2Y 1I3QI 4NFRA 1N8R2 3GTQI 3EERA 1KC81 3U50C 3HOUI 2IZ4A 3NDIA 3NDJA 4A3CI 4RVDA 1ZB9A 2B63I 2QR1B 1ML8A 3CC4Z 1Q7Y1 1RQFA 1YIJ1 3FKII 2LIYA 2DE7A 4RS4A 3CCR1 4S1TA 3TE5B 4A3MI 1NJI2 3CCU1 2PMZA 3CMA1 4NBAA 1VQN1 2OTL1 3HKZA 3CQZI 1Y1VI 1Q862 2H85A 3BG0B 3GTJI 5T6BA 1TWAI 3OW2Y 4HGZA 1RLYA 3I551 3CXCY 2LFUA 2JA7I 3D9XA 4RVFA 3S17I 3KIHA 1JWHC 2PK7A 1YIJZ 1YI21 3HOZI 4CL1A 4A3EI 5A2Qb 3CCRZ 2GU2A 1W2BY 3I07A 3CCUZ 4NBEA 1QYPA 2JNYA 4A3FI 3CMAZ 1Q812 2JUBA 4E31A 1M1K1 1KD11 1Z02A 1VQ71 2JR6A 1VQNZ 2OTLZ 1TFIA 3F3PC 2E9HA 2JMOA 5C44I 2HU9A 1K83I 4E33A 3CPWZ 5A2Qf 3S16I 3EEDA 2NVXI 3IF8A 4QTUA 4A3LI 2IZ3A 1N8R1 1VQ41 3F3FC 4HH4A 4NB8A 3HOVI 2DE6A 3I55Z 4E2ZA 1R9TI 2QLVB 1YI2Z 2QREB 5AN9F 1N2FA 1KRLA 3IFUA 3CCQ1 3I4MI 1VQM1 5LL6f 2M48A 5C4JI 4HGYA 2M6NA 2KI7B 1VQ7Z 5D1OB 3S1QI 1VQP1 3TDHB 3PO3I 1NJI1 4EWCA 1Z03A 5D1PA 1VQ4Z 1Q861 2R93I 1I50I 1KQSZ 3CCE1 3FQQA 3NH4A 2V8KA 1VQO1 2OZKA 1S7MA 1VQ81 3GTPI 4AYBA 2WAQA 1Z01A 3CPWY 1M901 4NBBA 3CCQZ 2OOXB 4MH4A 2DE5A 1VQMZ 4MD9A 2ZAEB 3I561 3HOYI 3RZDI 3T4NB 3Q87A 2NVYI 1YJN1 3GCFA 1VQPZ 2OOYB 1X3ZA 2K5RA 2WB1A 1WCMI 1Q811 2R92I 1WW9A 2I3CA 3CCJ1 1VLAA 2Q51A 3PO3S 3CCEZ 2V8JA 1VQOZ 2G2KA 2R7ZI 1TWFI 2RT9A 1VQ8Z 2OTJ1 1X0TA 4NH1C 1SFOI 4NBCA 3G4S1 1QVGZ 1M902 4DQYB 2NVTI 1RO2A 1YIT1 3I56Z 4A3KI 1VQ6Z 1VQ91 1USPA 4MONA 4NBHA 1YJNZ 1L1OC 2VUMI 4BBSI 2GTHA 5FLMI 1VQL1 2QRCB 3CCJZ 4BBRI 4NB9A 1LQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 1;  3CC7 1;  2OTJ Z;  1VQ7 Z;  1KQS Y;  3CC4 Z;  1VQK 1;  1Q7Y 1;  3CCV 1;  1VQP 1;  1KC8 2;  3CCM 1;  1NJI 1;  3G4S Z;  3G71 1;  1YIJ 1;  1YHQ 1;  1YJW 1;  3CME 1;  1Q82 2;  1YIT Z;  3CCR 1;  1VQ9 Z;  1VQ4 Z;  1Q7Y 2;  1Q86 1;  3CCL Z;  1KQS Z;  3CCE 1;  1NJI 2;  3CCU 1;  1VQO 1;  3CMA 1;  1VQ8 1;  3CC2 Z;  1YJ9 Z;  1VQN 1;  2OTL 1;  1QVG Y;  2QEX Z;  1JJ2 Z;  1Q86 2;  3CPW Y;  1VQL Z;  1M90 1;  3CCQ Z;  1QVF Y;  3G6E 1;  1VQM Z;  3OW2 Y;  3I56 1;  3CCS 1;  1K8A 1;  3CC7 Z;  3CD6 1;  3I55 1;  3CXC Y;  1YJN 1;  1S72 1;  3CCV Z;  1VQK Z;  1VQP Z;  3CCM Z;  1K9M 1;  3G71 Z;  2QA4 1;  1YIJ Z;  1YI2 1;  1YHQ Z;  1YJW Z;  1Q81 1;  3CME Z;  1VQ5 1;  1K8A 2;  3CCR Z;  3CCJ 1;  1W2B Y;  3CCE Z;  3CXC Z;  1K9M 2;  2QA4 Z;  3CCU Z;  1VQO Z;  3CMA Z;  1Q81 2;  1M1K 1;  1KD1 1;  1VQ8 Z;  2OTJ 1;  1VQ7 1;  1VQ6 1;  3CC4 1;  1VQN Z;  2OTL Z;  3G4S 1;  1QVG Z;  1M90 2;  1W2B Z;  3CPW Z;  3G6E Z;  1YIT 1;  1M1K 2;  3I56 Z;  1KD1 2;  1QVF Z;  1VQ6 Z;  1VQ9 1;  1N8R 1;  1VQ4 1;  3OW2 Z;  3CCS Z;  3CCL 1;  3CD6 Z;  3I55 Z;  1YJN Z;  1S72 Z;  1K73 1;  1YI2 Z;  1JJ2 Y;  3CC2 1;  1YJ9 1;  1N8R 2;  2QEX 1;  1VQ5 Z;  1VQL 1;  3CCJ Z;  3CCQ 1;  1KC8 1;  1K73 2;  1VQM 1; 
#chains in the Genus database with same CATH topology
 2V45 A;  2E2I I;  2KPI A;  4MD7 A;  3D6W A;  3CC7 1;  3PO2 I;  2OTJ Z;  1VQK 1;  4BY1 I;  2RBL A;  3S1M I;  3G4S Z;  3J81 b;  2J6A A;  2E2J I;  1USP B;  1YJW 1;  3P5J B;  4A3J I;  2W03 A;  1Q82 2;  1YIT Z;  3S15 I;  1PFT A;  1VQ9 Z;  5T64 A;  2RPR A;  3BG1 B;  4MD8 A;  2RHB A;  4NBD A;  1RNI A;  4NBG A;  3GTM I;  2F4O A;  3KIF A;  2RIQ A;  4BXX I;  1ZH1 A;  3J81 f;  4MRI A;  1QVG Y;  4QTT A;  2R6M A;  1VQL Z;  3VB9 A;  1P9N A;  1Q16 A;  5C3E I;  3G6E 1;  1TWC I;  5T67 A;  3CCS 1;  3CC7 Z;  3CD6 1;  1VQK Z;  3VMH A;  4E30 A;  4XX2 A;  1QF8 A;  1DL6 A;  3LUS A;  3J80 b;  2K3R A;  4RVG A;  3VMI A;  1YJW Z;  3NH5 A;  4A3D I;  1VQ5 1;  1K8A 2;  4Y7N I;  2HF1 A;  4A3B I;  5C4X I;  3RZO I;  3GTO I;  2Q4Z A;  3CXC Z;  1K9M 2;  3I4N I;  2QA4 Z;  1FDO A;  3S2D I;  1WJ2 A;  2VUG A;  4RV9 A;  2YAD A;  1NP6 A;  5IP9 I;  1VQ6 1;  2JIR A;  3J80 f;  2JIO A;  1W2B Z;  3JAM b;  3GTM S;  3IR7 A;  3G6E Z;  3S14 I;  1QVF Z;  2P3Y A;  3CCS Z;  3CCL 1;  3CD6 Z;  2W04 A;  2GTI A;  3ESW A;  2O53 A;  3CC2 1;  1YJ9 1;  2QEX 1;  3GKQ A;  2VPY A;  1VQ5 Z;  3JAM f;  1RO4 A;  3VMG A;  1K73 2;  1TWG I;  3GTG I;  4Y52 I;  1Q82 1;  3H0G I;  2P28 A;  1KQS Y;  3CCV 1;  3H3V J;  1KC8 2;  4A3I I;  3CCM 1;  3G71 1;  2JS4 A;  1YHQ 1;  3K7A I;  3GTL I;  4NOZ A;  3HOX I;  3CME 1;  3HOW I;  1Q7Y 2;  5IT9 b;  2QKD A;  2IV2 X;  3CCL Z;  1X3W A;  1ZB8 A;  3M4O I;  2Y0S A;  2AKL A;  2PM9 A;  2E2H I;  1RO0 A;  3CC2 Z;  2NVQ I;  3S2H I;  1YJ9 Z;  1JJ2 Z;  2QEX Z;  3NH8 A;  1NUI A;  2JIQ A;  3MZL B;  3IX0 A;  3MON A;  4E32 A;  1QVF Y;  5IT9 f;  4NBF A;  1Y1W I;  1K8A 1;  3S1R I;  2V8I A;  1S72 1;  3CCV Z;  5FLX b;  4A3G I;  4E2Y A;  3CCM Z;  1K9M 1;  3G71 Z;  2QA4 1;  2YU9 I;  1I6H I;  5D1O A;  1YHQ Z;  4MXU A;  4BY7 I;  4E2W A;  1Y1V S;  3CME Z;  2VF1 A;  3FQM A;  4DK1 A;  1AA6 A;  1YUA A;  3J7A 4;  1YUK A;  1Y8C A;  3VTN A;  4DGL A;  3GTK I;  5CM2 M;  2JA8 I;  2VPZ A;  2JIP A;  5FLX f;  3S1N I;  2F4M A;  2EGT A;  3CC4 1;  4X6A I;  2O4H A;  3M3Y I;  2JA5 I;  3MZK B;  3QWU A;  2BJO A;  1M1K 2;  4A93 I;  1KD1 2;  4E2X A;  4TNU A;  3OW2 Z;  3NFZ A;  1S72 Z;  2QRD B;  4RVH A;  1K73 1;  2JA6 I;  1WII A;  1TWH I;  5IP7 I;  1JJ2 Y;  1I3Q I;  4NFR A;  1N8R 2;  3GTQ I;  2VPX A;  3EER A;  1KC8 1;  3U50 C;  3HOU I;  2IZ4 A;  3D2L A;  3NDJ A;  3NDI A;  4A3C I;  4RVD A;  1ZB9 A;  2B63 I;  2QR1 B;  1ML8 A;  3CC4 Z;  1Q7Y 1;  1RQF A;  1YIJ 1;  3FKI I;  2LIY A;  2DE7 A;  4RS4 A;  3CCR 1;  4S1T A;  3TE5 B;  4A3M I;  1NJI 2;  3CCU 1;  2PMZ A;  1QXF A;  3CMA 1;  4NBA A;  1VQN 1;  2OTL 1;  3HKZ A;  3CQZ I;  1Y1V I;  1Q86 2;  2H85 A;  3BG0 B;  3GTJ I;  5T6B A;  1TWA I;  3OW2 Y;  4HGZ A;  1RLY A;  3I55 1;  3CXC Y;  2LFU A;  2JA7 I;  3D9X A;  4RVF A;  3S17 I;  3KIH A;  1JWH C;  1SIW A;  2PK7 A;  1YIJ Z;  1YI2 1;  3HOZ I;  4CL1 A;  4A3E I;  5A2Q b;  3CCR Z;  2GU2 A;  1W2B Y;  3I07 A;  3CCU Z;  4NBE A;  1QYP A;  2JNY A;  4A3F I;  3CMA Z;  1Q81 2;  2JUB A;  4E31 A;  1M1K 1;  1KD1 1;  1Z02 A;  1VQ7 1;  2JR6 A;  1VQN Z;  2OTL Z;  1TFI A;  3F3P C;  2E9H A;  2JMO A;  5C44 I;  2HU9 A;  1K83 I;  4E33 A;  3CPW Z;  5A2Q f;  3S16 I;  3EED A;  2NVX I;  3IF8 A;  4QTU A;  4A3L I;  2IZ3 A;  1N8R 1;  1VQ4 1;  3F3F C;  4HH4 A;  4NB8 A;  3HOV I;  2DE6 A;  3I55 Z;  4E2Z A;  1R9T I;  2QLV B;  1YI2 Z;  2QRE B;  5AN9 F;  1N2F A;  1KRL A;  3IFU A;  3CCQ 1;  3I4M I;  1VQM 1;  5LL6 f;  2M48 A;  5C4J I;  4HGY A;  2M6N A;  2KI7 B;  1VQ7 Z;  5D1O B;  3S1Q I;  1VQP 1;  3TDH B;  3PO3 I;  1NJI 1;  4EWC A;  1Z03 A;  5D1P A;  2LEX A;  1VQ4 Z;  1Q86 1;  2R93 I;  1I50 I;  1KQS Z;  3CCE 1;  3FQQ A;  3NH4 A;  2V8K A;  1VQO 1;  2JIM A;  2OZK A;  2V3V A;  1S7M A;  1VQ8 1;  3GTP I;  4AYB A;  2WAQ A;  1Z01 A;  3CPW Y;  1M90 1;  4NBB A;  3CCQ Z;  2OOX B;  4MH4 A;  2DE5 A;  1VQM Z;  4MD9 A;  2ZAE B;  3I56 1;  3HOY I;  3RZD I;  3T4N B;  3Q87 A;  2NVY I;  1YJN 1;  3GCF A;  1VQP Z;  2OOY B;  1X3Z A;  2K5R A;  2WB1 A;  1WCM I;  2E7Z A;  1Q81 1;  2R92 I;  1WW9 A;  2I3C A;  3CCJ 1;  1VLA A;  2Q51 A;  3PO3 S;  3CCE Z;  2V8J A;  1VQO Z;  2G2K A;  2R7Z I;  1TWF I;  2RT9 A;  1VQ8 Z;  2OTJ 1;  1X0T A;  4NH1 C;  1SFO I;  4NBC A;  3G4S 1;  1QVG Z;  1M90 2;  1FDI A;  4DQY B;  2NVT I;  2NAP A;  1RO2 A;  1YIT 1;  3I56 Z;  4A3K I;  1VQ6 Z;  1VQ9 1;  1USP A;  4MON A;  4NBH A;  1YJN Z;  1L1O C;  2AYD A;  2VUM I;  4BBS I;  2GTH A;  5FLM I;  1VQL 1;  2QRC B;  3CCJ Z;  4BBR I;  4NB9 A;  1WZN A;  1LQL A;  2VPW A; 
#chains in the Genus database with same CATH homology
 2E2I I;  2KPI A;  4MD7 A;  3D6W A;  3CC7 1;  3PO2 I;  2OTJ Z;  1VQK 1;  4BY1 I;  2RBL A;  3S1M I;  3G4S Z;  3J81 b;  2J6A A;  2E2J I;  1USP B;  1YJW 1;  3P5J B;  4A3J I;  2W03 A;  1Q82 2;  1YIT Z;  3S15 I;  1PFT A;  1VQ9 Z;  5T64 A;  2RPR A;  3BG1 B;  4MD8 A;  2RHB A;  4NBD A;  1RNI A;  4NBG A;  3GTM I;  2F4O A;  3KIF A;  2RIQ A;  4BXX I;  1ZH1 A;  3J81 f;  4MRI A;  1QVG Y;  4QTT A;  2R6M A;  1VQL Z;  3VB9 A;  1P9N A;  5C3E I;  3G6E 1;  1TWC I;  5T67 A;  3CCS 1;  3CC7 Z;  3CD6 1;  1VQK Z;  3VMH A;  4E30 A;  4XX2 A;  1QF8 A;  1DL6 A;  3LUS A;  3J80 b;  2K3R A;  4RVG A;  3VMI A;  1YJW Z;  3NH5 A;  4A3D I;  1VQ5 1;  1K8A 2;  4Y7N I;  2HF1 A;  4A3B I;  5C4X I;  3RZO I;  3GTO I;  2Q4Z A;  3CXC Z;  1K9M 2;  3I4N I;  2QA4 Z;  3S2D I;  2VUG A;  4RV9 A;  2YAD A;  1NP6 A;  5IP9 I;  1VQ6 1;  3J80 f;  1W2B Z;  3JAM b;  3GTM S;  3G6E Z;  3S14 I;  1QVF Z;  2P3Y A;  3CCS Z;  3CCL 1;  3CD6 Z;  2W04 A;  2GTI A;  3ESW A;  2O53 A;  3CC2 1;  1YJ9 1;  2QEX 1;  3GKQ A;  1VQ5 Z;  3JAM f;  1RO4 A;  3VMG A;  1K73 2;  1TWG I;  3GTG I;  4Y52 I;  1Q82 1;  3H0G I;  2P28 A;  1KQS Y;  3CCV 1;  3H3V J;  1KC8 2;  4A3I I;  3CCM 1;  3G71 1;  2JS4 A;  1YHQ 1;  3K7A I;  3GTL I;  4NOZ A;  3HOX I;  3CME 1;  3HOW I;  1Q7Y 2;  5IT9 b;  2QKD A;  3CCL Z;  1X3W A;  1ZB8 A;  3M4O I;  2Y0S A;  2AKL A;  2PM9 A;  2E2H I;  1RO0 A;  3CC2 Z;  2NVQ I;  3S2H I;  1YJ9 Z;  1JJ2 Z;  2QEX Z;  3NH8 A;  1NUI A;  3MZL B;  3IX0 A;  3MON A;  4E32 A;  1QVF Y;  5IT9 f;  4NBF A;  1Y1W I;  1K8A 1;  3S1R I;  2V8I A;  1S72 1;  3CCV Z;  5FLX b;  4A3G I;  4E2Y A;  3CCM Z;  1K9M 1;  3G71 Z;  2QA4 1;  2YU9 I;  1I6H I;  5D1O A;  1YHQ Z;  4MXU A;  4BY7 I;  4E2W A;  1Y1V S;  3CME Z;  2VF1 A;  3FQM A;  4DK1 A;  1YUA A;  3J7A 4;  1YUK A;  3GTK I;  3VTN A;  4DGL A;  5CM2 M;  2JA8 I;  5FLX f;  3S1N I;  2F4M A;  2EGT A;  3CC4 1;  4X6A I;  2O4H A;  3M3Y I;  2JA5 I;  3MZK B;  3QWU A;  2BJO A;  1M1K 2;  4A93 I;  1KD1 2;  4E2X A;  4TNU A;  3OW2 Z;  3NFZ A;  1S72 Z;  2QRD B;  4RVH A;  1K73 1;  2JA6 I;  1WII A;  1TWH I;  5IP7 I;  1JJ2 Y;  1I3Q I;  4NFR A;  1N8R 2;  3GTQ I;  3EER A;  1KC8 1;  3U50 C;  3HOU I;  2IZ4 A;  3NDI A;  3NDJ A;  4A3C I;  4RVD A;  1ZB9 A;  2B63 I;  2QR1 B;  1ML8 A;  3CC4 Z;  1Q7Y 1;  1RQF A;  1YIJ 1;  3FKI I;  2LIY A;  2DE7 A;  4RS4 A;  3CCR 1;  4S1T A;  3TE5 B;  4A3M I;  1NJI 2;  3CCU 1;  2PMZ A;  3CMA 1;  4NBA A;  1VQN 1;  2OTL 1;  3HKZ A;  3CQZ I;  1Y1V I;  1Q86 2;  2H85 A;  3BG0 B;  3GTJ I;  5T6B A;  1TWA I;  3OW2 Y;  4HGZ A;  1RLY A;  3I55 1;  3CXC Y;  2LFU A;  2JA7 I;  3D9X A;  4RVF A;  3S17 I;  3KIH A;  1JWH C;  2PK7 A;  1YIJ Z;  1YI2 1;  3HOZ I;  4CL1 A;  4A3E I;  5A2Q b;  3CCR Z;  2GU2 A;  1W2B Y;  3I07 A;  3CCU Z;  4NBE A;  1QYP A;  2JNY A;  4A3F I;  3CMA Z;  1Q81 2;  2JUB A;  4E31 A;  1M1K 1;  1KD1 1;  1Z02 A;  1VQ7 1;  2JR6 A;  1VQN Z;  2OTL Z;  1TFI A;  3F3P C;  2E9H A;  2JMO A;  5C44 I;  2HU9 A;  1K83 I;  4E33 A;  3CPW Z;  5A2Q f;  3S16 I;  3EED A;  2NVX I;  3IF8 A;  4QTU A;  4A3L I;  2IZ3 A;  1N8R 1;  1VQ4 1;  3F3F C;  4HH4 A;  4NB8 A;  3HOV I;  2DE6 A;  3I55 Z;  4E2Z A;  1R9T I;  2QLV B;  1YI2 Z;  2QRE B;  5AN9 F;  1N2F A;  1KRL A;  3IFU A;  3CCQ 1;  3I4M I;  1VQM 1;  5LL6 f;  2M48 A;  5C4J I;  4HGY A;  2M6N A;  2KI7 B;  1VQ7 Z;  5D1O B;  3S1Q I;  1VQP 1;  3TDH B;  3PO3 I;  1NJI 1;  4EWC A;  1Z03 A;  5D1P A;  1VQ4 Z;  1Q86 1;  2R93 I;  1I50 I;  1KQS Z;  3CCE 1;  3FQQ A;  3NH4 A;  2V8K A;  1VQO 1;  2OZK A;  1S7M A;  1VQ8 1;  3GTP I;  4AYB A;  2WAQ A;  1Z01 A;  3CPW Y;  1M90 1;  4NBB A;  3CCQ Z;  2OOX B;  4MH4 A;  2DE5 A;  1VQM Z;  4MD9 A;  2ZAE B;  3I56 1;  3HOY I;  3RZD I;  3T4N B;  3Q87 A;  2NVY I;  1YJN 1;  3GCF A;  1VQP Z;  2OOY B;  1X3Z A;  2K5R A;  2WB1 A;  1WCM I;  1Q81 1;  2R92 I;  1WW9 A;  2I3C A;  3CCJ 1;  1VLA A;  2Q51 A;  3PO3 S;  3CCE Z;  2V8J A;  1VQO Z;  2G2K A;  2R7Z I;  1TWF I;  2RT9 A;  1VQ8 Z;  2OTJ 1;  1X0T A;  4NH1 C;  1SFO I;  4NBC A;  3G4S 1;  1QVG Z;  1M90 2;  4DQY B;  2NVT I;  1RO2 A;  1YIT 1;  3I56 Z;  4A3K I;  1VQ6 Z;  1VQ9 1;  1USP A;  4MON A;  4NBH A;  1YJN Z;  1L1O C;  2VUM I;  4BBS I;  2GTH A;  5FLM I;  1VQL 1;  2QRC B;  3CCJ Z;  4BBR I;  4NB9 A;  1LQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...