1S72Z

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s72Z00
1M1K2 3G4S1 3I551 1NJI2 3I55Z 1VQ41 1K9M2 1VQ91 3CXCY 1YHQ1 1W2BY 1KD12 3CME1 1YHQZ 3CMEZ 1N8R2 3CC21 3CC2Z 1K8A1 1VQL1 3CXCZ 2OTLZ 1JJ2Y 1VQM1 3G71Z 3CCU1 1VQMZ 3CC71 1Q7Y2 1YI21 3CC4Z 1YJ91 1YI2Z 1YJ9Z 1Q811 1VQ51 1QVFY 3G4SZ 2QEX1 1Q861 3OW2Y 1K731 2QEXZ 1VQ4Z 1S721 3CCR1 1VQ9Z 1KQSY 1QVFZ 1KC81 1M901 3OW2Z 1M1K1 1YIT1 1W2BZ 2QA41 1VQLZ 1NJI1 3CCJ1 1QVGY 3CCUZ 3CCJZ 3CC7Z 1KD11 3CMA1 1VQ71 1JJ2Z 1VQ5Z 3CCV1 1N8R1 3CCVZ 3CD61 3CD6Z 3CCL1 1VQP1 1S72Z 3CCRZ 3CCQ1 3CCLZ 1VQPZ 3CCQZ 1VQ81 3CCS1 1VQ8Z 1YJN1 1Q7Y1 3CCSZ 1Q821 3I561 1YJNZ 1M902 1K8A2 1VQN1 1KQSZ 1YITZ 2QA4Z 1VQNZ 1YIJ1 1VQO1 3CCE1 1YIJZ 1VQOZ 3CCEZ 3CPWY 1K9M1 1VQ61 3CMAZ 1VQ6Z 1VQ7Z 1Q812 1QVGZ 3CPWZ 1Q862 1K732 3CCM1 2OTL1 3CCMZ 3G6E1 3G6EZ 3G711 1VQK1 1YJW1 1KC82 1VQKZ 1YJWZ 3CC41 3I56Z 2OTJ1 1Q822 2OTJZ
chains in the Genus database with same CATH superfamily
4E32A 1Z02A 2O53A 5FLXf 2NVXI 5A2Qb 4Y7NI 1RNIA 1K9M2 3J80f 3CME1 3RZOI 3GTLI 3I4MI 2E2II 5CM2M 3CC71 1YI21 2K5RA 3D2LA 1VLAA 1Q811 4NOZA 1VQ51 4NB8A 2E2HI 2F4MA 3NDJA 3EEDA 4RVDA 4NBAA 1I50I 3OW2Y 5C4JI 1VQ4Z 1S721 3CCR1 3HOUI 1VQ9Z 2IZ3A 2P28A 3IX0A 2JIQA 3GTPI 3OW2Z 4RS4A 2GU2A 1YIT1 1W2BZ 3TDHB 2DE7A 2VPYA 4RV9A 2V8KA 1QVGY 3NH4A 3FKII 3S1RI 1KD11 3H0GI 3MZLB 3D9XA 5AN9F 2JIRA 3CD61 1TWAI 1NP6A 3GTGI 2E2JI 1VQPZ 4A3DI 3CCQZ 3J81f 3T4NB 2VF1A 3NH8A 2GTIA 2QA4Z 2QKDA 1SIWA 1VQNZ 4E33A 3Q87A 4A3GI 2JIMA 3CCEZ 3GCFA 2M48A 2RT9A 2HU9A 2Y0SA 1VQ6Z 3PO3S 1QF8A 3BG0B 1Y1VI 3S17I 2R92I 4MD8A 1Q862 1K732 1P9NA 1L1OC 2OTL1 3CCMZ 3G6E1 2KPIA 2DE6A 2R93I 2JNYA 3MONA 1YJWZ 1VQKZ 3CC41 4MH4A 1RO0A 1M1K2 2G2KA 3JAMf 3G4S1 3I551 1FDIA 1YHQ1 3H3VJ 3CMEZ 2OZKA 2LEXA 2WB1A 1K8A1 1TWFI 3F3FC 3KIFA 1VQL1 3GTMI 2V45A 1TWCI 1VQM1 5IT9b 4BXXI 3S16I 1Q7Y2 3M4OI 1YJ91 1YI2Z 5D1PA 4A3CI 4DQYB 5A2Qf 1WCMI 4E2YA 2QEX1 2PM9A 2QRDB 1WIIA 2J6AA 5LL6f 3QWUA 3CQZI 2ZAEB 4E30A 4E2ZA 1KRLA 1KC81 3S1QI 3NDIA 3HOYI 3MZKB 1ZB9A 1YUKA 4DGLA 4A3BI 1NJI1 2JA7I 3CCJ1 1Z01A 3CCUZ 5C3EI 2RIQA 3GKQA 4NBGA 1X3WA 3CMA1 4NBDA 4BBRI 4Y52I 1N8R1 5T6BA 2QREB 3CD6Z 3KIHA 4E31A 4A3II 2NVQI 3F3PC 3IR7A 1YJN1 2LFUA 2LIYA 3I561 2F4OA 2B63I 2VPWA 1YIJ1 4NBCA 5C4XI 4EWCA 1VQO1 2AKLA 5IP9I 3CPWY 3NH5A 2RPRA 1K83I 1VQ7Z 1Q812 3HOWI 3J7A4 1QVGZ 2NVTI 3CPWZ 3VMIA 5T67A 2IZ4A 2RBLA 4QTTA 1X3ZA 5C44I 3GTQI 3G6EZ 4RVFA 3HKZA 2V8JA 1Y8CA 4MD7A 4NBHA 3IFUA 2OOYB 1ML8A 1QYPA 2QR1B 3I55Z 2OOXB 1VQ41 2JUBA 1VQ91 4E2XA 3CXCY 1KD12 4X6AI 1YHQZ 1Z03A 2O4HA 4MRIA 3CC21 2YADA 1ZH1A 2Q51A 2QLVB 4E2WA 3CXCZ 1JJ2Y 3S2DI 3G71Z 1VQMZ 5FLMI 2R7ZI 5D1OA 1YJ9Z 1TFIA 4A3EI 3PO3I 2QEXZ 1Q16A 2GTHA 1KQSY 3U50C 3K7AI 1TWGI 3VMGA 1M901 4XX2A 4BY1I 2QA41 5IT9f 3EERA 1WZNA 3CCJZ 3CC7Z 2I3CA 1VQ5Z 4NFRA 2K3RA 3CCV1 2EGTA 2JA6I 4A3JI 3FQQA 3CCL1 1S72Z 3CCRZ 1DL6A 2W03A 1JWHC 2WAQA 3FQMA 1VQ81 2JIOA 3CCS1 2RHBA 3S15I 1Q821 1SFOI 1YJNZ 4S1TA 4A3MI 1USPB 1LQLA 1M902 1K8A2 1YITZ 3I4NI 1QXFA 3S14I 3IF8A 1YIJZ 1VQOZ 1RLYA 2NVYI 5FLXb 4NBFA 1X0TA 2HF1A 4NBBA 3J80b 1WW9A 3S1NI 1R9TI 3GTOI 3VB9A 2E7ZA 1KC82 2H85A 4NBEA 2OTJ1 1Q822 2IV2X 2BJOA 2V8IA 2PMZA 5IP7I 2JS4A 1NJI2 1FDOA 3VMHA 1PFTA 1RO4A 1N2FA 4A3KI 3S2HI 1W2BY 2KI7B 3VTNA 3HOXI 2AYDA 3D6WA 1N8R2 3CC2Z 2DE5A 4MD9A 2OTLZ 2Q4ZA 4RVHA 3CCU1 3P5JB 3CC4Z 3HOZI 4AYBA 1QVFY 2M6NA 5T64A 4MONA 3G4SZ 4CL1A 1Q861 3HOVI 1TWHI 1K731 1Y1VS 4A3LI 4HH4A 1I6HI 2JA8I 3PO2I 1RO2A 1QVFZ 3GTJI 3LUSA 2JIPA 2P3YA 4A93I 1M1K1 3J81b 3NFZA 1VQLZ 2R6MA 1RQFA 4BY7I 1AA6A 3GTKI 1I3QI 3ESWA 4NB9A 2VPXA 4MXUA 1VQ71 1JJ2Z 2PK7A 3CCVZ 3I07A 2VPZA 1VQP1 4BBSI 3S1MI 3CCQ1 3CCLZ 4HGYA 2NAPA 2W04A 1VQ8Z 3BG1B 1Q7Y1 3CCSZ 3GTMS 1VQN1 2V3VA 1KQSZ 3M3YI 4A3FI 2E9HA 3CCE1 4HGZA 2VUGA 1K9M1 3JAMb 2QRCB 4NH1C 2YU9I 4QTUA 1VQ61 1YUAA 1Y1WI 3CMAZ 2JR6A 5D1OB 1ZB8A 4TNUA 1USPA 3CCM1 1S7MA 3TE5B 1WJ2A 3RZDI 4DK1A 2VUMI 3G711 2JA5I 1VQK1 1YJW1 1NUIA 4RVGA 3I56Z 2JMOA 2OTJZ
chains in the Genus database with same CATH topology
4E32A 1Z02A 2O53A 5FLXf 2NVXI 5A2Qb 4Y7NI 1RNIA 1K9M2 3J80f 3CME1 3RZOI 3GTLI 3I4MI 2E2II 5CM2M 3CC71 1YI21 2K5RA 1VLAA 1Q811 4NOZA 1VQ51 4NB8A 2E2HI 2F4MA 3NDJA 3EEDA 4RVDA 4NBAA 1I50I 3OW2Y 5C4JI 1VQ4Z 1S721 3CCR1 3HOUI 1VQ9Z 2IZ3A 2P28A 3IX0A 3GTPI 3OW2Z 4RS4A 2GU2A 1YIT1 1W2BZ 3TDHB 2DE7A 4RV9A 2V8KA 1QVGY 3NH4A 3FKII 3S1RI 1KD11 3H0GI 3MZLB 3D9XA 5AN9F 3CD61 1TWAI 1NP6A 3GTGI 2E2JI 1VQPZ 4A3DI 3CCQZ 3J81f 3T4NB 2VF1A 3NH8A 2GTIA 2QA4Z 2QKDA 1VQNZ 4E33A 3Q87A 4A3GI 3CCEZ 3GCFA 2M48A 2RT9A 2HU9A 2Y0SA 1VQ6Z 3PO3S 1QF8A 3BG0B 1Y1VI 3S17I 2R92I 4MD8A 1Q862 1K732 1P9NA 1L1OC 2OTL1 3CCMZ 3G6E1 2KPIA 2DE6A 2R93I 2JNYA 3MONA 1YJWZ 1VQKZ 3CC41 4MH4A 1RO0A 1M1K2 2G2KA 3JAMf 3G4S1 3I551 1YHQ1 3H3VJ 3CMEZ 2OZKA 2WB1A 1K8A1 1TWFI 3F3FC 3KIFA 1VQL1 3GTMI 1TWCI 1VQM1 5IT9b 4BXXI 3S16I 1Q7Y2 3M4OI 1YJ91 1YI2Z 5D1PA 4A3CI 4DQYB 5A2Qf 1WCMI 4E2YA 2QEX1 2PM9A 2QRDB 1WIIA 2J6AA 5LL6f 3QWUA 3CQZI 2ZAEB 4E30A 4E2ZA 1KRLA 1KC81 3S1QI 3NDIA 3HOYI 3MZKB 1ZB9A 1YUKA 4DGLA 4A3BI 1NJI1 2JA7I 3CCJ1 1Z01A 3CCUZ 5C3EI 2RIQA 3GKQA 4NBGA 1X3WA 3CMA1 4NBDA 4BBRI 4Y52I 1N8R1 5T6BA 2QREB 3CD6Z 3KIHA 4E31A 4A3II 2NVQI 3F3PC 1YJN1 2LFUA 2LIYA 3I561 2F4OA 2B63I 1YIJ1 4NBCA 5C4XI 4EWCA 1VQO1 2AKLA 5IP9I 3CPWY 3NH5A 2RPRA 1K83I 1VQ7Z 1Q812 3HOWI 3J7A4 1QVGZ 2NVTI 3CPWZ 3VMIA 5T67A 2IZ4A 2RBLA 4QTTA 1X3ZA 5C44I 3GTQI 3G6EZ 4RVFA 3HKZA 2V8JA 4MD7A 4NBHA 3IFUA 2OOYB 1ML8A 1QYPA 2QR1B 3I55Z 2OOXB 1VQ41 2JUBA 1VQ91 4E2XA 3CXCY 1KD12 4X6AI 1YHQZ 1Z03A 2O4HA 4MRIA 3CC21 2YADA 1ZH1A 2Q51A 2QLVB 4E2WA 3CXCZ 1JJ2Y 3S2DI 3G71Z 1VQMZ 5FLMI 2R7ZI 5D1OA 1YJ9Z 1TFIA 4A3EI 3PO3I 2QEXZ 2GTHA 1KQSY 3U50C 3K7AI 1TWGI 3VMGA 1M901 4XX2A 4BY1I 2QA41 5IT9f 3EERA 3CCJZ 3CC7Z 2I3CA 1VQ5Z 4NFRA 2K3RA 3CCV1 2EGTA 2JA6I 4A3JI 3FQQA 3CCL1 1S72Z 3CCRZ 1DL6A 2W03A 1JWHC 2WAQA 3FQMA 1VQ81 3CCS1 2RHBA 3S15I 1Q821 1SFOI 1YJNZ 4S1TA 4A3MI 1USPB 1LQLA 1M902 1K8A2 1YITZ 3I4NI 3S14I 3IF8A 1YIJZ 1VQOZ 1RLYA 2NVYI 5FLXb 4NBFA 1X0TA 2HF1A 4NBBA 3J80b 1WW9A 3S1NI 1R9TI 3GTOI 3VB9A 1KC82 2H85A 4NBEA 2OTJ1 1Q822 2BJOA 2V8IA 2PMZA 5IP7I 2JS4A 1NJI2 3VMHA 1PFTA 1RO4A 1N2FA 4A3KI 3S2HI 1W2BY 2KI7B 3VTNA 3HOXI 3D6WA 1N8R2 3CC2Z 2DE5A 4MD9A 2OTLZ 2Q4ZA 4RVHA 3CCU1 3P5JB 3CC4Z 3HOZI 4AYBA 1QVFY 2M6NA 5T64A 4MONA 3G4SZ 4CL1A 1Q861 3HOVI 1TWHI 1K731 1Y1VS 4A3LI 4HH4A 1I6HI 2JA8I 3PO2I 1RO2A 1QVFZ 3GTJI 3LUSA 2P3YA 4A93I 1M1K1 3J81b 3NFZA 1VQLZ 2R6MA 1RQFA 4BY7I 3GTKI 1I3QI 3ESWA 4NB9A 4MXUA 1VQ71 1JJ2Z 2PK7A 3CCVZ 3I07A 1VQP1 4BBSI 3S1MI 3CCQ1 3CCLZ 4HGYA 2W04A 1VQ8Z 3BG1B 1Q7Y1 3CCSZ 3GTMS 1VQN1 1KQSZ 3M3YI 4A3FI 2E9HA 3CCE1 4HGZA 2VUGA 1K9M1 3JAMb 2QRCB 4NH1C 2YU9I 4QTUA 1VQ61 1YUAA 1Y1WI 3CMAZ 2JR6A 5D1OB 1ZB8A 4TNUA 1USPA 3CCM1 1S7MA 3TE5B 3RZDI 4DK1A 2VUMI 3G711 2JA5I 1VQK1 1YJW1 1NUIA 4RVGA 3I56Z 2JMOA 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 2;  3G4S 1;  3I55 1;  1NJI 2;  3I55 Z;  1VQ4 1;  1K9M 2;  1VQ9 1;  3CXC Y;  1YHQ 1;  1W2B Y;  1KD1 2;  3CME 1;  1YHQ Z;  3CME Z;  1N8R 2;  3CC2 1;  3CC2 Z;  1K8A 1;  1VQL 1;  3CXC Z;  2OTL Z;  1JJ2 Y;  1VQM 1;  3G71 Z;  3CCU 1;  1VQM Z;  3CC7 1;  1Q7Y 2;  1YI2 1;  3CC4 Z;  1YJ9 1;  1YI2 Z;  1YJ9 Z;  1Q81 1;  1VQ5 1;  1QVF Y;  3G4S Z;  2QEX 1;  1Q86 1;  3OW2 Y;  1K73 1;  2QEX Z;  1VQ4 Z;  1S72 1;  3CCR 1;  1VQ9 Z;  1KQS Y;  1QVF Z;  1KC8 1;  1M90 1;  3OW2 Z;  1M1K 1;  1YIT 1;  1W2B Z;  2QA4 1;  1VQL Z;  1NJI 1;  3CCJ 1;  1QVG Y;  3CCU Z;  3CCJ Z;  3CC7 Z;  1KD1 1;  3CMA 1;  1VQ7 1;  1JJ2 Z;  1VQ5 Z;  3CCV 1;  1N8R 1;  3CCV Z;  3CD6 1;  3CD6 Z;  3CCL 1;  1VQP 1;  1S72 Z;  3CCR Z;  3CCQ 1;  3CCL Z;  1VQP Z;  3CCQ Z;  1VQ8 1;  3CCS 1;  1VQ8 Z;  1YJN 1;  1Q7Y 1;  3CCS Z;  1Q82 1;  3I56 1;  1YJN Z;  1M90 2;  1K8A 2;  1VQN 1;  1KQS Z;  1YIT Z;  2QA4 Z;  1VQN Z;  1YIJ 1;  1VQO 1;  3CCE 1;  1YIJ Z;  1VQO Z;  3CCE Z;  3CPW Y;  1K9M 1;  1VQ6 1;  3CMA Z;  1VQ6 Z;  1VQ7 Z;  1Q81 2;  1QVG Z;  3CPW Z;  1Q86 2;  1K73 2;  3CCM 1;  2OTL 1;  3CCM Z;  3G6E 1;  3G6E Z;  3G71 1;  1VQK 1;  1YJW 1;  1KC8 2;  1VQK Z;  1YJW Z;  3CC4 1;  3I56 Z;  2OTJ 1;  1Q82 2;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 4E32 A;  1Z02 A;  2O53 A;  5FLX f;  2NVX I;  5A2Q b;  4Y7N I;  1RNI A;  1K9M 2;  3J80 f;  3CME 1;  3RZO I;  3GTL I;  3I4M I;  2E2I I;  5CM2 M;  3CC7 1;  1YI2 1;  2K5R A;  3D2L A;  1VLA A;  1Q81 1;  4NOZ A;  1VQ5 1;  4NB8 A;  2E2H I;  2F4M A;  3NDJ A;  3EED A;  4RVD A;  4NBA A;  1I50 I;  3OW2 Y;  5C4J I;  1VQ4 Z;  1S72 1;  3CCR 1;  3HOU I;  1VQ9 Z;  2IZ3 A;  2P28 A;  3IX0 A;  2JIQ A;  3GTP I;  3OW2 Z;  4RS4 A;  2GU2 A;  1YIT 1;  1W2B Z;  3TDH B;  2DE7 A;  2VPY A;  4RV9 A;  2V8K A;  1QVG Y;  3NH4 A;  3FKI I;  3S1R I;  1KD1 1;  3H0G I;  3MZL B;  3D9X A;  5AN9 F;  2JIR A;  3CD6 1;  1TWA I;  1NP6 A;  3GTG I;  2E2J I;  1VQP Z;  4A3D I;  3CCQ Z;  3J81 f;  3T4N B;  2VF1 A;  3NH8 A;  2GTI A;  2QA4 Z;  2QKD A;  1SIW A;  1VQN Z;  4E33 A;  3Q87 A;  4A3G I;  2JIM A;  3CCE Z;  3GCF A;  2M48 A;  2RT9 A;  2HU9 A;  2Y0S A;  1VQ6 Z;  3PO3 S;  1QF8 A;  3BG0 B;  1Y1V I;  3S17 I;  2R92 I;  4MD8 A;  1Q86 2;  1K73 2;  1P9N A;  1L1O C;  2OTL 1;  3CCM Z;  3G6E 1;  2KPI A;  2DE6 A;  2R93 I;  2JNY A;  3MON A;  1YJW Z;  1VQK Z;  3CC4 1;  4MH4 A;  1RO0 A;  1M1K 2;  2G2K A;  3JAM f;  3G4S 1;  3I55 1;  1FDI A;  1YHQ 1;  3H3V J;  3CME Z;  2OZK A;  2LEX A;  2WB1 A;  1K8A 1;  1TWF I;  3F3F C;  3KIF A;  1VQL 1;  3GTM I;  2V45 A;  1TWC I;  1VQM 1;  5IT9 b;  4BXX I;  3S16 I;  1Q7Y 2;  3M4O I;  1YJ9 1;  1YI2 Z;  5D1P A;  4A3C I;  4DQY B;  5A2Q f;  1WCM I;  4E2Y A;  2QEX 1;  2PM9 A;  2QRD B;  1WII A;  2J6A A;  5LL6 f;  3QWU A;  3CQZ I;  2ZAE B;  4E30 A;  4E2Z A;  1KRL A;  1KC8 1;  3S1Q I;  3NDI A;  3HOY I;  3MZK B;  1ZB9 A;  1YUK A;  4DGL A;  4A3B I;  1NJI 1;  2JA7 I;  3CCJ 1;  1Z01 A;  3CCU Z;  5C3E I;  2RIQ A;  3GKQ A;  4NBG A;  1X3W A;  3CMA 1;  4NBD A;  4BBR I;  4Y52 I;  1N8R 1;  5T6B A;  2QRE B;  3CD6 Z;  3KIH A;  4E31 A;  4A3I I;  2NVQ I;  3F3P C;  3IR7 A;  1YJN 1;  2LFU A;  2LIY A;  3I56 1;  2F4O A;  2B63 I;  2VPW A;  1YIJ 1;  4NBC A;  5C4X I;  4EWC A;  1VQO 1;  2AKL A;  5IP9 I;  3CPW Y;  3NH5 A;  2RPR A;  1K83 I;  1VQ7 Z;  1Q81 2;  3HOW I;  3J7A 4;  1QVG Z;  2NVT I;  3CPW Z;  3VMI A;  5T67 A;  2IZ4 A;  2RBL A;  4QTT A;  1X3Z A;  5C44 I;  3GTQ I;  3G6E Z;  4RVF A;  3HKZ A;  2V8J A;  1Y8C A;  4MD7 A;  4NBH A;  3IFU A;  2OOY B;  1ML8 A;  1QYP A;  2QR1 B;  3I55 Z;  2OOX B;  1VQ4 1;  2JUB A;  1VQ9 1;  4E2X A;  3CXC Y;  1KD1 2;  4X6A I;  1YHQ Z;  1Z03 A;  2O4H A;  4MRI A;  3CC2 1;  2YAD A;  1ZH1 A;  2Q51 A;  2QLV B;  4E2W A;  3CXC Z;  1JJ2 Y;  3S2D I;  3G71 Z;  1VQM Z;  5FLM I;  2R7Z I;  5D1O A;  1YJ9 Z;  1TFI A;  4A3E I;  3PO3 I;  2QEX Z;  1Q16 A;  2GTH A;  1KQS Y;  3U50 C;  3K7A I;  1TWG I;  3VMG A;  1M90 1;  4XX2 A;  4BY1 I;  2QA4 1;  5IT9 f;  3EER A;  1WZN A;  3CCJ Z;  3CC7 Z;  2I3C A;  1VQ5 Z;  4NFR A;  2K3R A;  3CCV 1;  2EGT A;  2JA6 I;  4A3J I;  3FQQ A;  3CCL 1;  1S72 Z;  3CCR Z;  1DL6 A;  2W03 A;  1JWH C;  2WAQ A;  3FQM A;  1VQ8 1;  2JIO A;  3CCS 1;  2RHB A;  3S15 I;  1Q82 1;  1SFO I;  1YJN Z;  4S1T A;  4A3M I;  1USP B;  1LQL A;  1M90 2;  1K8A 2;  1YIT Z;  3I4N I;  1QXF A;  3S14 I;  3IF8 A;  1YIJ Z;  1VQO Z;  1RLY A;  2NVY I;  5FLX b;  4NBF A;  1X0T A;  2HF1 A;  4NBB A;  3J80 b;  1WW9 A;  3S1N I;  1R9T I;  3GTO I;  3VB9 A;  2E7Z A;  1KC8 2;  2H85 A;  4NBE A;  2OTJ 1;  1Q82 2;  2IV2 X;  2BJO A;  2V8I A;  2PMZ A;  5IP7 I;  2JS4 A;  1NJI 2;  1FDO A;  3VMH A;  1PFT A;  1RO4 A;  1N2F A;  4A3K I;  3S2H I;  1W2B Y;  2KI7 B;  3VTN A;  3HOX I;  2AYD A;  3D6W A;  1N8R 2;  3CC2 Z;  2DE5 A;  4MD9 A;  2OTL Z;  2Q4Z A;  4RVH A;  3CCU 1;  3P5J B;  3CC4 Z;  3HOZ I;  4AYB A;  1QVF Y;  2M6N A;  5T64 A;  4MON A;  3G4S Z;  4CL1 A;  1Q86 1;  3HOV I;  1TWH I;  1K73 1;  1Y1V S;  4A3L I;  4HH4 A;  1I6H I;  2JA8 I;  3PO2 I;  1RO2 A;  1QVF Z;  3GTJ I;  3LUS A;  2JIP A;  2P3Y A;  4A93 I;  1M1K 1;  3J81 b;  3NFZ A;  1VQL Z;  2R6M A;  1RQF A;  4BY7 I;  1AA6 A;  3GTK I;  1I3Q I;  3ESW A;  4NB9 A;  2VPX A;  4MXU A;  1VQ7 1;  1JJ2 Z;  2PK7 A;  3CCV Z;  3I07 A;  2VPZ A;  1VQP 1;  4BBS I;  3S1M I;  3CCQ 1;  3CCL Z;  4HGY A;  2NAP A;  2W04 A;  1VQ8 Z;  3BG1 B;  1Q7Y 1;  3CCS Z;  3GTM S;  1VQN 1;  2V3V A;  1KQS Z;  3M3Y I;  4A3F I;  2E9H A;  3CCE 1;  4HGZ A;  2VUG A;  1K9M 1;  3JAM b;  2QRC B;  4NH1 C;  2YU9 I;  4QTU A;  1VQ6 1;  1YUA A;  1Y1W I;  3CMA Z;  2JR6 A;  5D1O B;  1ZB8 A;  4TNU A;  1USP A;  3CCM 1;  1S7M A;  3TE5 B;  1WJ2 A;  3RZD I;  4DK1 A;  2VUM I;  3G71 1;  2JA5 I;  1VQK 1;  1YJW 1;  1NUI A;  4RVG A;  3I56 Z;  2JMO A;  2OTJ Z; 
#chains in the Genus database with same CATH homology
 4E32 A;  1Z02 A;  2O53 A;  5FLX f;  2NVX I;  5A2Q b;  4Y7N I;  1RNI A;  1K9M 2;  3J80 f;  3CME 1;  3RZO I;  3GTL I;  3I4M I;  2E2I I;  5CM2 M;  3CC7 1;  1YI2 1;  2K5R A;  1VLA A;  1Q81 1;  4NOZ A;  1VQ5 1;  4NB8 A;  2E2H I;  2F4M A;  3NDJ A;  3EED A;  4RVD A;  4NBA A;  1I50 I;  3OW2 Y;  5C4J I;  1VQ4 Z;  1S72 1;  3CCR 1;  3HOU I;  1VQ9 Z;  2IZ3 A;  2P28 A;  3IX0 A;  3GTP I;  3OW2 Z;  4RS4 A;  2GU2 A;  1YIT 1;  1W2B Z;  3TDH B;  2DE7 A;  4RV9 A;  2V8K A;  1QVG Y;  3NH4 A;  3FKI I;  3S1R I;  1KD1 1;  3H0G I;  3MZL B;  3D9X A;  5AN9 F;  3CD6 1;  1TWA I;  1NP6 A;  3GTG I;  2E2J I;  1VQP Z;  4A3D I;  3CCQ Z;  3J81 f;  3T4N B;  2VF1 A;  3NH8 A;  2GTI A;  2QA4 Z;  2QKD A;  1VQN Z;  4E33 A;  3Q87 A;  4A3G I;  3CCE Z;  3GCF A;  2M48 A;  2RT9 A;  2HU9 A;  2Y0S A;  1VQ6 Z;  3PO3 S;  1QF8 A;  3BG0 B;  1Y1V I;  3S17 I;  2R92 I;  4MD8 A;  1Q86 2;  1K73 2;  1P9N A;  1L1O C;  2OTL 1;  3CCM Z;  3G6E 1;  2KPI A;  2DE6 A;  2R93 I;  2JNY A;  3MON A;  1YJW Z;  1VQK Z;  3CC4 1;  4MH4 A;  1RO0 A;  1M1K 2;  2G2K A;  3JAM f;  3G4S 1;  3I55 1;  1YHQ 1;  3H3V J;  3CME Z;  2OZK A;  2WB1 A;  1K8A 1;  1TWF I;  3F3F C;  3KIF A;  1VQL 1;  3GTM I;  1TWC I;  1VQM 1;  5IT9 b;  4BXX I;  3S16 I;  1Q7Y 2;  3M4O I;  1YJ9 1;  1YI2 Z;  5D1P A;  4A3C I;  4DQY B;  5A2Q f;  1WCM I;  4E2Y A;  2QEX 1;  2PM9 A;  2QRD B;  1WII A;  2J6A A;  5LL6 f;  3QWU A;  3CQZ I;  2ZAE B;  4E30 A;  4E2Z A;  1KRL A;  1KC8 1;  3S1Q I;  3NDI A;  3HOY I;  3MZK B;  1ZB9 A;  1YUK A;  4DGL A;  4A3B I;  1NJI 1;  2JA7 I;  3CCJ 1;  1Z01 A;  3CCU Z;  5C3E I;  2RIQ A;  3GKQ A;  4NBG A;  1X3W A;  3CMA 1;  4NBD A;  4BBR I;  4Y52 I;  1N8R 1;  5T6B A;  2QRE B;  3CD6 Z;  3KIH A;  4E31 A;  4A3I I;  2NVQ I;  3F3P C;  1YJN 1;  2LFU A;  2LIY A;  3I56 1;  2F4O A;  2B63 I;  1YIJ 1;  4NBC A;  5C4X I;  4EWC A;  1VQO 1;  2AKL A;  5IP9 I;  3CPW Y;  3NH5 A;  2RPR A;  1K83 I;  1VQ7 Z;  1Q81 2;  3HOW I;  3J7A 4;  1QVG Z;  2NVT I;  3CPW Z;  3VMI A;  5T67 A;  2IZ4 A;  2RBL A;  4QTT A;  1X3Z A;  5C44 I;  3GTQ I;  3G6E Z;  4RVF A;  3HKZ A;  2V8J A;  4MD7 A;  4NBH A;  3IFU A;  2OOY B;  1ML8 A;  1QYP A;  2QR1 B;  3I55 Z;  2OOX B;  1VQ4 1;  2JUB A;  1VQ9 1;  4E2X A;  3CXC Y;  1KD1 2;  4X6A I;  1YHQ Z;  1Z03 A;  2O4H A;  4MRI A;  3CC2 1;  2YAD A;  1ZH1 A;  2Q51 A;  2QLV B;  4E2W A;  3CXC Z;  1JJ2 Y;  3S2D I;  3G71 Z;  1VQM Z;  5FLM I;  2R7Z I;  5D1O A;  1YJ9 Z;  1TFI A;  4A3E I;  3PO3 I;  2QEX Z;  2GTH A;  1KQS Y;  3U50 C;  3K7A I;  1TWG I;  3VMG A;  1M90 1;  4XX2 A;  4BY1 I;  2QA4 1;  5IT9 f;  3EER A;  3CCJ Z;  3CC7 Z;  2I3C A;  1VQ5 Z;  4NFR A;  2K3R A;  3CCV 1;  2EGT A;  2JA6 I;  4A3J I;  3FQQ A;  3CCL 1;  1S72 Z;  3CCR Z;  1DL6 A;  2W03 A;  1JWH C;  2WAQ A;  3FQM A;  1VQ8 1;  3CCS 1;  2RHB A;  3S15 I;  1Q82 1;  1SFO I;  1YJN Z;  4S1T A;  4A3M I;  1USP B;  1LQL A;  1M90 2;  1K8A 2;  1YIT Z;  3I4N I;  3S14 I;  3IF8 A;  1YIJ Z;  1VQO Z;  1RLY A;  2NVY I;  5FLX b;  4NBF A;  1X0T A;  2HF1 A;  4NBB A;  3J80 b;  1WW9 A;  3S1N I;  1R9T I;  3GTO I;  3VB9 A;  1KC8 2;  2H85 A;  4NBE A;  2OTJ 1;  1Q82 2;  2BJO A;  2V8I A;  2PMZ A;  5IP7 I;  2JS4 A;  1NJI 2;  3VMH A;  1PFT A;  1RO4 A;  1N2F A;  4A3K I;  3S2H I;  1W2B Y;  2KI7 B;  3VTN A;  3HOX I;  3D6W A;  1N8R 2;  3CC2 Z;  2DE5 A;  4MD9 A;  2OTL Z;  2Q4Z A;  4RVH A;  3CCU 1;  3P5J B;  3CC4 Z;  3HOZ I;  4AYB A;  1QVF Y;  2M6N A;  5T64 A;  4MON A;  3G4S Z;  4CL1 A;  1Q86 1;  3HOV I;  1TWH I;  1K73 1;  1Y1V S;  4A3L I;  4HH4 A;  1I6H I;  2JA8 I;  3PO2 I;  1RO2 A;  1QVF Z;  3GTJ I;  3LUS A;  2P3Y A;  4A93 I;  1M1K 1;  3J81 b;  3NFZ A;  1VQL Z;  2R6M A;  1RQF A;  4BY7 I;  3GTK I;  1I3Q I;  3ESW A;  4NB9 A;  4MXU A;  1VQ7 1;  1JJ2 Z;  2PK7 A;  3CCV Z;  3I07 A;  1VQP 1;  4BBS I;  3S1M I;  3CCQ 1;  3CCL Z;  4HGY A;  2W04 A;  1VQ8 Z;  3BG1 B;  1Q7Y 1;  3CCS Z;  3GTM S;  1VQN 1;  1KQS Z;  3M3Y I;  4A3F I;  2E9H A;  3CCE 1;  4HGZ A;  2VUG A;  1K9M 1;  3JAM b;  2QRC B;  4NH1 C;  2YU9 I;  4QTU A;  1VQ6 1;  1YUA A;  1Y1W I;  3CMA Z;  2JR6 A;  5D1O B;  1ZB8 A;  4TNU A;  1USP A;  3CCM 1;  1S7M A;  3TE5 B;  3RZD I;  4DK1 A;  2VUM I;  3G71 1;  2JA5 I;  1VQK 1;  1YJW 1;  1NUI A;  4RVG A;  3I56 Z;  2JMO A;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...