5FLXb

Mammalian 40s hcv-ires complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
80
structure length
80
Chain Sequence
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 4
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5flxb00
3J80b 5LL6f 5A2Qb 5IT9b 3JAMb 3J7A4 5FLXb 3J81b
chains in the Genus database with same CATH superfamily
4E2YA 2VUMI 2ZAEB 3CC2Z 1K732 1W2BZ 1N8R1 3J7A4 1JWHC 2DE6A 4BBRI 1R9TI 3CCSZ 1VQLZ 4Y52I 3CCQ1 3S17I 3CCLZ 4DGLA 1YHQ1 2VPYA 2P3YA 2G2KA 1NP6A 4NFRA 1VQO1 1WIIA 1VQ5Z 4RVDA 3RZDI 5IP7I 1PFTA 3JAMf 2NVQI 3I4MI 4DQYB 2RBLA 1Z03A 3CCU1 2M48A 4X6AI 3CCV1 1KD12 3S1RI 3GTQI 1KQSY 2RT9A 3HOUI 1USPB 1VQ91 2QLVB 1M901 1S721 3M3YI 4NBAA 3HOZI 5C4XI 2QEX1 4MRIA 1W2BY 2NVYI 4NBBA 5D1OB 3S1QI 3NH4A 2V8KA 2E2HI 3CCQZ 2R92I 4HH4A 2QRDB 2NVXI 4E2WA 5C44I 2OTL1 3NH8A 3MZKB 2DE7A 5FLXf 4NBDA 4E30A 2JMOA 3PO2I 2K5RA 1VQOZ 4A3DI 3RZOI 1N2FA 3I551 4TNUA 3D2LA 1X3WA 1RO4A 1VQNZ 2JA6I 2YU9I 3G4S1 3CCVZ 2JR6A 1Y8CA 3CQZI 3NDIA 3CXCY 5FLMI 2LFUA 2V8IA 1TWGI 2EGTA 1Q861 1QYPA 3VMIA 3S15I 1YIT1 4E2XA 3I07A 3T4NB 3S1MI 4DK1A 2O53A 3EEDA 3JAMb 3S1NI 2JUBA 3TE5B 3BG0B 2M6NA 1YI21 1KQSZ 3P5JB 4RVGA 3M4OI 1RO2A 1K731 2IZ4A 2V45A 3GTPI 3HKZA 2PMZA 2Q4ZA 5C3EI 4NBGA 1VQPZ 1QVFZ 4S1TA 4MD8A 1DL6A 3I56Z 3MZLB 3I55Z 3K7AI 2JIOA 4E31A 4E33A 3IF8A 2RIQA 5A2Qb 3U50C 1JJ2Z 3H3VJ 3CD6Z 2LIYA 2E2JI 1Z02A 3F3FC 3TDHB 1RLYA 5FLXb 4BBSI 3ESWA 4RS4A 1P9NA 3PO3S 2IV2X 1S7MA 1YITZ 3J80f 2QREB 3G6E1 1TWCI 4MONA 1VQ4Z 2OTJZ 1VQ6Z 4HGZA 1RO0A 3CCJ1 3VTNA 1TWAI 1X0TA 2JIPA 2JA7I 3CXCZ 1YI2Z 1KD11 3CC7Z 3J81f 3CMA1 1VQ71 2JIMA 3CPWZ 2E2II 1Q7Y2 4NBHA 4AYBA 2GU2A 1QVFY 4BY1I 3D9XA 1I50I 1Y1VI 3G711 1VQK1 1YIJ1 1K8A2 5A2Qf 1JJ2Y 3FQQA 2JIQA 1RQFA 1YUAA 2LEXA 3G6EZ 1YHQZ 2W04A 3NFZA 3VMHA 1VQ81 1FDOA 2JA8I 2VPZA 1I3QI 2RPRA 4CL1A 2J6AA 3CCJZ 1WZNA 2H85A 2HU9A 3OW2Y 1M1K2 1TWHI 2YADA 1K9M2 2QA41 4E2ZA 3CCUZ 1YJ91 2JA5I 3EERA 3J80b 2IZ3A 2V3VA 4XX2A 4MH4A 2QKDA 2VPWA 1VQ9Z 1KC82 3S14I 1VQM1 1S72Z 3MONA 3CPWY 4A3EI 2QEXZ 1VQKZ 1Q812 3HOXI 2AYDA 4RV9A 3CC21 1TWFI 3IFUA 4NOZA 3H0GI 3VMGA 4A3CI 2F4OA 4E32A 3J81b 1Y1VS 4A3II 2OTLZ 3CME1 1Q16A 3GTLI 2VF1A 5IT9f 3CCS1 1WJ2A 1VQL1 2QRCB 3F3PC 4A3LI 4MD9A 3CCL1 5T67A 1YJN1 5T64A 1RNIA 3HOVI 4A93I 3D6WA 2QA4Z 4NB9A 2K3RA 3G4SZ 1NJI2 1YJW1 1VQ51 2Y0SA 4EWCA 4NBCA 4A3FI 1SFOI 1VQMZ 2F4MA 1QXFA 2B63I 3CCM1 4NBFA 3CCE1 2I3CA 3VB9A 2JIRA 3OW2Z 2GTHA 3KIFA 1Q822 3GTKI 3GTMI 2JNYA 3GKQA 1Z01A 1USPA 2E7ZA 3CCR1 1N8R2 2R93I 4MXUA 3CMEZ 5D1PA 1WW9A 2O4HA 5LL6f 1SIWA 4A3KI 2WB1A 1ZB8A 1Q7Y1 5D1OA 4RVHA 1YJNZ 2NAPA 3IX0A 2JS4A 4NBEA 3I4NI 1TFIA 5IP9I 4A3BI 2BJOA 3GTOI 2OOXB 1YJWZ 1K8A1 1ML8A 2QR1B 2E9HA 2WAQA 3QWUA 1ZB9A 1VLAA 5IT9b 3GCFA 3CCMZ 1VQN1 4BXXI 3CCEZ 3NDJA 4A3JI 3HOYI 2R6MA 3CC41 1M1K1 2KI7B 1QVGZ 3CCRZ 2PM9A 4Y7NI 1K9M1 3GTMS 2OOYB 3Q87A 1M902 4QTUA 2V8JA 5AN9F 3GTJI 3CMAZ 1VQ7Z 1WCMI 1KC81 2KPIA 1QF8A 1NUIA 2AKLA 4NB8A 3S2DI 3FKII 2VUGA 1AA6A 3FQMA 2RHBA 1Q811 4RVFA 4QTTA 3NH5A 2GTIA 3S16I 4A3GI 2VPXA 1VQP1 3G71Z 1X3ZA 5C4JI 3I561 1KRLA 4HGYA 1YIJZ 2PK7A 4NH1C 3KIHA 3BG1B 3IR7A 5CM2M 3CD61 2R7ZI 3PO3I 3CC4Z 3HOWI 1I6HI 1VQ8Z 1Y1WI 1YUKA 2OZKA 2Q51A 5T6BA 4A3MI 4BY7I 2P28A 1LQLA 1L1OC 1Q862 1VQ41 3LUSA 1NJI1 2NVTI 2OTJ1 1VQ61 3S2HI 1QVGY 1YJ9Z 1ZH1A 1K83I 3GTGI 2HF1A 4MD7A 2DE5A 3CC71 1Q821 1FDIA 2W03A
chains in the Genus database with same CATH topology
4E2YA 2VUMI 2ZAEB 3CC2Z 1K732 1W2BZ 1N8R1 3J7A4 1JWHC 2DE6A 4BBRI 1R9TI 3CCSZ 1VQLZ 4Y52I 3CCQ1 3S17I 3CCLZ 4DGLA 1YHQ1 2P3YA 2G2KA 1NP6A 4NFRA 1VQO1 1WIIA 1VQ5Z 4RVDA 3RZDI 5IP7I 1PFTA 3JAMf 2NVQI 3I4MI 4DQYB 2RBLA 1Z03A 3CCU1 2M48A 4X6AI 3CCV1 1KD12 3S1RI 3GTQI 1KQSY 2RT9A 3HOUI 1USPB 1VQ91 2QLVB 1M901 1S721 3M3YI 4NBAA 3HOZI 5C4XI 2QEX1 4MRIA 1W2BY 2NVYI 4NBBA 5D1OB 3S1QI 3NH4A 2V8KA 2E2HI 3CCQZ 2R92I 4HH4A 2QRDB 2NVXI 4E2WA 5C44I 2OTL1 3NH8A 3MZKB 2DE7A 5FLXf 4NBDA 4E30A 2JMOA 3PO2I 2K5RA 1VQOZ 4A3DI 3RZOI 1N2FA 3I551 4TNUA 1X3WA 1RO4A 1VQNZ 2JA6I 2YU9I 3G4S1 3CCVZ 2JR6A 3CQZI 3NDIA 3CXCY 5FLMI 2LFUA 2V8IA 1TWGI 2EGTA 1Q861 1QYPA 3VMIA 3S15I 1YIT1 4E2XA 3I07A 3T4NB 3S1MI 4DK1A 2O53A 3EEDA 3JAMb 3S1NI 2JUBA 3TE5B 3BG0B 2M6NA 1YI21 1KQSZ 3P5JB 4RVGA 3M4OI 1RO2A 1K731 2IZ4A 3GTPI 3HKZA 2PMZA 2Q4ZA 5C3EI 4NBGA 1VQPZ 1QVFZ 4S1TA 4MD8A 1DL6A 3I56Z 3MZLB 3I55Z 3K7AI 4E31A 4E33A 3IF8A 2RIQA 5A2Qb 3U50C 1JJ2Z 3H3VJ 3CD6Z 2LIYA 2E2JI 1Z02A 3F3FC 3TDHB 1RLYA 5FLXb 4BBSI 3ESWA 4RS4A 1P9NA 3PO3S 1S7MA 1YITZ 3J80f 2QREB 3G6E1 1TWCI 4MONA 1VQ4Z 2OTJZ 1VQ6Z 4HGZA 1RO0A 3CCJ1 3VTNA 1TWAI 1X0TA 2JA7I 3CXCZ 1YI2Z 1KD11 3CC7Z 3J81f 3CMA1 1VQ71 3CPWZ 2E2II 1Q7Y2 4NBHA 4AYBA 2GU2A 1QVFY 4BY1I 3D9XA 1I50I 1Y1VI 3G711 1VQK1 1YIJ1 1K8A2 5A2Qf 1JJ2Y 3FQQA 1RQFA 1YUAA 3G6EZ 1YHQZ 2W04A 3NFZA 3VMHA 1VQ81 2JA8I 1I3QI 2RPRA 4CL1A 2J6AA 3CCJZ 2H85A 2HU9A 3OW2Y 1M1K2 1TWHI 2YADA 1K9M2 2QA41 4E2ZA 3CCUZ 1YJ91 2JA5I 3EERA 3J80b 2IZ3A 4XX2A 4MH4A 2QKDA 1VQ9Z 1KC82 3S14I 1VQM1 1S72Z 3MONA 3CPWY 4A3EI 2QEXZ 1VQKZ 1Q812 3HOXI 3CC21 4RV9A 1TWFI 3IFUA 4NOZA 3H0GI 3VMGA 4A3CI 2F4OA 4E32A 3J81b 1Y1VS 4A3II 2OTLZ 3CME1 3GTLI 2VF1A 5IT9f 3CCS1 1VQL1 2QRCB 3F3PC 4A3LI 4MD9A 3CCL1 5T67A 1YJN1 5T64A 1RNIA 3HOVI 4A93I 3D6WA 2QA4Z 4NB9A 2K3RA 3G4SZ 1NJI2 1YJW1 1VQ51 2Y0SA 4EWCA 4NBCA 4A3FI 1SFOI 1VQMZ 2F4MA 2B63I 3CCM1 4NBFA 3CCE1 2I3CA 3VB9A 3OW2Z 2GTHA 3KIFA 1Q822 3GTKI 3GTMI 2JNYA 3GKQA 1Z01A 1USPA 3CCR1 1N8R2 2R93I 4MXUA 3CMEZ 5D1PA 1WW9A 2O4HA 5LL6f 4A3KI 2WB1A 1ZB8A 1Q7Y1 5D1OA 4RVHA 1YJNZ 3IX0A 2JS4A 4NBEA 3I4NI 1TFIA 5IP9I 4A3BI 2BJOA 3GTOI 2OOXB 1YJWZ 1K8A1 1ML8A 2QR1B 2E9HA 2WAQA 3QWUA 1ZB9A 1VLAA 5IT9b 3GCFA 3CCMZ 1VQN1 4BXXI 3CCEZ 3NDJA 4A3JI 3HOYI 2R6MA 3CC41 1M1K1 2KI7B 1QVGZ 3CCRZ 2PM9A 4Y7NI 1K9M1 3GTMS 2OOYB 3Q87A 1M902 4QTUA 2V8JA 5AN9F 3GTJI 3CMAZ 1VQ7Z 1WCMI 1KC81 2KPIA 1QF8A 1NUIA 2AKLA 4NB8A 3S2DI 3FKII 2VUGA 3FQMA 2RHBA 1Q811 4RVFA 4QTTA 3NH5A 2GTIA 3S16I 4A3GI 1VQP1 3G71Z 1X3ZA 5C4JI 3I561 1KRLA 4HGYA 1YIJZ 2PK7A 4NH1C 3KIHA 3BG1B 5CM2M 3CD61 2R7ZI 3PO3I 3CC4Z 3HOWI 1I6HI 1VQ8Z 1Y1WI 1YUKA 2OZKA 2Q51A 5T6BA 4A3MI 4BY7I 2P28A 1LQLA 1L1OC 1Q862 1VQ41 3LUSA 1NJI1 2NVTI 2OTJ1 1VQ61 3S2HI 1QVGY 1YJ9Z 1ZH1A 1K83I 3GTGI 2HF1A 4MD7A 2DE5A 3CC71 1Q821 2W03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 b;  5LL6 f;  5A2Q b;  5IT9 b;  3JAM b;  3J7A 4;  5FLX b;  3J81 b; 
#chains in the Genus database with same CATH topology
 4E2Y A;  2VUM I;  2ZAE B;  3CC2 Z;  1K73 2;  1W2B Z;  1N8R 1;  3J7A 4;  1JWH C;  2DE6 A;  4BBR I;  1R9T I;  3CCS Z;  1VQL Z;  4Y52 I;  3CCQ 1;  3S17 I;  3CCL Z;  4DGL A;  1YHQ 1;  2VPY A;  2P3Y A;  2G2K A;  1NP6 A;  4NFR A;  1VQO 1;  1WII A;  1VQ5 Z;  4RVD A;  3RZD I;  5IP7 I;  1PFT A;  3JAM f;  2NVQ I;  3I4M I;  4DQY B;  2RBL A;  1Z03 A;  3CCU 1;  2M48 A;  4X6A I;  3CCV 1;  1KD1 2;  3S1R I;  3GTQ I;  1KQS Y;  2RT9 A;  3HOU I;  1USP B;  1VQ9 1;  2QLV B;  1M90 1;  1S72 1;  3M3Y I;  4NBA A;  3HOZ I;  5C4X I;  2QEX 1;  4MRI A;  1W2B Y;  2NVY I;  4NBB A;  5D1O B;  3S1Q I;  3NH4 A;  2V8K A;  2E2H I;  3CCQ Z;  2R92 I;  4HH4 A;  2QRD B;  2NVX I;  4E2W A;  5C44 I;  2OTL 1;  3NH8 A;  3MZK B;  2DE7 A;  5FLX f;  4NBD A;  4E30 A;  2JMO A;  3PO2 I;  2K5R A;  1VQO Z;  4A3D I;  3RZO I;  1N2F A;  3I55 1;  4TNU A;  3D2L A;  1X3W A;  1RO4 A;  1VQN Z;  2JA6 I;  2YU9 I;  3G4S 1;  3CCV Z;  2JR6 A;  1Y8C A;  3CQZ I;  3NDI A;  3CXC Y;  5FLM I;  2LFU A;  2V8I A;  1TWG I;  2EGT A;  1Q86 1;  1QYP A;  3VMI A;  3S15 I;  1YIT 1;  4E2X A;  3I07 A;  3T4N B;  3S1M I;  4DK1 A;  2O53 A;  3EED A;  3JAM b;  3S1N I;  2JUB A;  3TE5 B;  3BG0 B;  2M6N A;  1YI2 1;  1KQS Z;  3P5J B;  4RVG A;  3M4O I;  1RO2 A;  1K73 1;  2IZ4 A;  2V45 A;  3GTP I;  3HKZ A;  2PMZ A;  2Q4Z A;  5C3E I;  4NBG A;  1VQP Z;  1QVF Z;  4S1T A;  4MD8 A;  1DL6 A;  3I56 Z;  3MZL B;  3I55 Z;  3K7A I;  2JIO A;  4E31 A;  4E33 A;  3IF8 A;  2RIQ A;  5A2Q b;  3U50 C;  1JJ2 Z;  3H3V J;  3CD6 Z;  2LIY A;  2E2J I;  1Z02 A;  3F3F C;  3TDH B;  1RLY A;  5FLX b;  4BBS I;  3ESW A;  4RS4 A;  1P9N A;  3PO3 S;  2IV2 X;  1S7M A;  1YIT Z;  3J80 f;  2QRE B;  3G6E 1;  1TWC I;  4MON A;  1VQ4 Z;  2OTJ Z;  1VQ6 Z;  4HGZ A;  1RO0 A;  3CCJ 1;  3VTN A;  1TWA I;  1X0T A;  2JIP A;  2JA7 I;  3CXC Z;  1YI2 Z;  1KD1 1;  3CC7 Z;  3J81 f;  3CMA 1;  1VQ7 1;  2JIM A;  3CPW Z;  2E2I I;  1Q7Y 2;  4NBH A;  4AYB A;  2GU2 A;  1QVF Y;  4BY1 I;  3D9X A;  1I50 I;  1Y1V I;  3G71 1;  1VQK 1;  1YIJ 1;  1K8A 2;  5A2Q f;  1JJ2 Y;  3FQQ A;  2JIQ A;  1RQF A;  1YUA A;  2LEX A;  3G6E Z;  1YHQ Z;  2W04 A;  3NFZ A;  3VMH A;  1VQ8 1;  1FDO A;  2JA8 I;  2VPZ A;  1I3Q I;  2RPR A;  4CL1 A;  2J6A A;  3CCJ Z;  1WZN A;  2H85 A;  2HU9 A;  3OW2 Y;  1M1K 2;  1TWH I;  2YAD A;  1K9M 2;  2QA4 1;  4E2Z A;  3CCU Z;  1YJ9 1;  2JA5 I;  3EER A;  3J80 b;  2IZ3 A;  2V3V A;  4XX2 A;  4MH4 A;  2QKD A;  2VPW A;  1VQ9 Z;  1KC8 2;  3S14 I;  1VQM 1;  1S72 Z;  3MON A;  3CPW Y;  4A3E I;  2QEX Z;  1VQK Z;  1Q81 2;  3HOX I;  2AYD A;  4RV9 A;  3CC2 1;  1TWF I;  3IFU A;  4NOZ A;  3H0G I;  3VMG A;  4A3C I;  2F4O A;  4E32 A;  3J81 b;  1Y1V S;  4A3I I;  2OTL Z;  3CME 1;  1Q16 A;  3GTL I;  2VF1 A;  5IT9 f;  3CCS 1;  1WJ2 A;  1VQL 1;  2QRC B;  3F3P C;  4A3L I;  4MD9 A;  3CCL 1;  5T67 A;  1YJN 1;  5T64 A;  1RNI A;  3HOV I;  4A93 I;  3D6W A;  2QA4 Z;  4NB9 A;  2K3R A;  3G4S Z;  1NJI 2;  1YJW 1;  1VQ5 1;  2Y0S A;  4EWC A;  4NBC A;  4A3F I;  1SFO I;  1VQM Z;  2F4M A;  1QXF A;  2B63 I;  3CCM 1;  4NBF A;  3CCE 1;  2I3C A;  3VB9 A;  2JIR A;  3OW2 Z;  2GTH A;  3KIF A;  1Q82 2;  3GTK I;  3GTM I;  2JNY A;  3GKQ A;  1Z01 A;  1USP A;  2E7Z A;  3CCR 1;  1N8R 2;  2R93 I;  4MXU A;  3CME Z;  5D1P A;  1WW9 A;  2O4H A;  5LL6 f;  1SIW A;  4A3K I;  2WB1 A;  1ZB8 A;  1Q7Y 1;  5D1O A;  4RVH A;  1YJN Z;  2NAP A;  3IX0 A;  2JS4 A;  4NBE A;  3I4N I;  1TFI A;  5IP9 I;  4A3B I;  2BJO A;  3GTO I;  2OOX B;  1YJW Z;  1K8A 1;  1ML8 A;  2QR1 B;  2E9H A;  2WAQ A;  3QWU A;  1ZB9 A;  1VLA A;  5IT9 b;  3GCF A;  3CCM Z;  1VQN 1;  4BXX I;  3CCE Z;  3NDJ A;  4A3J I;  3HOY I;  2R6M A;  3CC4 1;  1M1K 1;  2KI7 B;  1QVG Z;  3CCR Z;  2PM9 A;  4Y7N I;  1K9M 1;  3GTM S;  2OOY B;  3Q87 A;  1M90 2;  4QTU A;  2V8J A;  5AN9 F;  3GTJ I;  3CMA Z;  1VQ7 Z;  1WCM I;  1KC8 1;  2KPI A;  1QF8 A;  1NUI A;  2AKL A;  4NB8 A;  3S2D I;  3FKI I;  2VUG A;  1AA6 A;  3FQM A;  2RHB A;  1Q81 1;  4RVF A;  4QTT A;  3NH5 A;  2GTI A;  3S16 I;  4A3G I;  2VPX A;  1VQP 1;  3G71 Z;  1X3Z A;  5C4J I;  3I56 1;  1KRL A;  4HGY A;  1YIJ Z;  2PK7 A;  4NH1 C;  3KIH A;  3BG1 B;  3IR7 A;  5CM2 M;  3CD6 1;  2R7Z I;  3PO3 I;  3CC4 Z;  3HOW I;  1I6H I;  1VQ8 Z;  1Y1W I;  1YUK A;  2OZK A;  2Q51 A;  5T6B A;  4A3M I;  4BY7 I;  2P28 A;  1LQL A;  1L1O C;  1Q86 2;  1VQ4 1;  3LUS A;  1NJI 1;  2NVT I;  2OTJ 1;  1VQ6 1;  3S2H I;  1QVG Y;  1YJ9 Z;  1ZH1 A;  1K83 I;  3GTG I;  2HF1 A;  4MD7 A;  2DE5 A;  3CC7 1;  1Q82 1;  1FDI A;  2W03 A; 
#chains in the Genus database with same CATH homology
 4E2Y A;  2VUM I;  2ZAE B;  3CC2 Z;  1K73 2;  1W2B Z;  1N8R 1;  3J7A 4;  1JWH C;  2DE6 A;  4BBR I;  1R9T I;  3CCS Z;  1VQL Z;  4Y52 I;  3CCQ 1;  3S17 I;  3CCL Z;  4DGL A;  1YHQ 1;  2P3Y A;  2G2K A;  1NP6 A;  4NFR A;  1VQO 1;  1WII A;  1VQ5 Z;  4RVD A;  3RZD I;  5IP7 I;  1PFT A;  3JAM f;  2NVQ I;  3I4M I;  4DQY B;  2RBL A;  1Z03 A;  3CCU 1;  2M48 A;  4X6A I;  3CCV 1;  1KD1 2;  3S1R I;  3GTQ I;  1KQS Y;  2RT9 A;  3HOU I;  1USP B;  1VQ9 1;  2QLV B;  1M90 1;  1S72 1;  3M3Y I;  4NBA A;  3HOZ I;  5C4X I;  2QEX 1;  4MRI A;  1W2B Y;  2NVY I;  4NBB A;  5D1O B;  3S1Q I;  3NH4 A;  2V8K A;  2E2H I;  3CCQ Z;  2R92 I;  4HH4 A;  2QRD B;  2NVX I;  4E2W A;  5C44 I;  2OTL 1;  3NH8 A;  3MZK B;  2DE7 A;  5FLX f;  4NBD A;  4E30 A;  2JMO A;  3PO2 I;  2K5R A;  1VQO Z;  4A3D I;  3RZO I;  1N2F A;  3I55 1;  4TNU A;  1X3W A;  1RO4 A;  1VQN Z;  2JA6 I;  2YU9 I;  3G4S 1;  3CCV Z;  2JR6 A;  3CQZ I;  3NDI A;  3CXC Y;  5FLM I;  2LFU A;  2V8I A;  1TWG I;  2EGT A;  1Q86 1;  1QYP A;  3VMI A;  3S15 I;  1YIT 1;  4E2X A;  3I07 A;  3T4N B;  3S1M I;  4DK1 A;  2O53 A;  3EED A;  3JAM b;  3S1N I;  2JUB A;  3TE5 B;  3BG0 B;  2M6N A;  1YI2 1;  1KQS Z;  3P5J B;  4RVG A;  3M4O I;  1RO2 A;  1K73 1;  2IZ4 A;  3GTP I;  3HKZ A;  2PMZ A;  2Q4Z A;  5C3E I;  4NBG A;  1VQP Z;  1QVF Z;  4S1T A;  4MD8 A;  1DL6 A;  3I56 Z;  3MZL B;  3I55 Z;  3K7A I;  4E31 A;  4E33 A;  3IF8 A;  2RIQ A;  5A2Q b;  3U50 C;  1JJ2 Z;  3H3V J;  3CD6 Z;  2LIY A;  2E2J I;  1Z02 A;  3F3F C;  3TDH B;  1RLY A;  5FLX b;  4BBS I;  3ESW A;  4RS4 A;  1P9N A;  3PO3 S;  1S7M A;  1YIT Z;  3J80 f;  2QRE B;  3G6E 1;  1TWC I;  4MON A;  1VQ4 Z;  2OTJ Z;  1VQ6 Z;  4HGZ A;  1RO0 A;  3CCJ 1;  3VTN A;  1TWA I;  1X0T A;  2JA7 I;  3CXC Z;  1YI2 Z;  1KD1 1;  3CC7 Z;  3J81 f;  3CMA 1;  1VQ7 1;  3CPW Z;  2E2I I;  1Q7Y 2;  4NBH A;  4AYB A;  2GU2 A;  1QVF Y;  4BY1 I;  3D9X A;  1I50 I;  1Y1V I;  3G71 1;  1VQK 1;  1YIJ 1;  1K8A 2;  5A2Q f;  1JJ2 Y;  3FQQ A;  1RQF A;  1YUA A;  3G6E Z;  1YHQ Z;  2W04 A;  3NFZ A;  3VMH A;  1VQ8 1;  2JA8 I;  1I3Q I;  2RPR A;  4CL1 A;  2J6A A;  3CCJ Z;  2H85 A;  2HU9 A;  3OW2 Y;  1M1K 2;  1TWH I;  2YAD A;  1K9M 2;  2QA4 1;  4E2Z A;  3CCU Z;  1YJ9 1;  2JA5 I;  3EER A;  3J80 b;  2IZ3 A;  4XX2 A;  4MH4 A;  2QKD A;  1VQ9 Z;  1KC8 2;  3S14 I;  1VQM 1;  1S72 Z;  3MON A;  3CPW Y;  4A3E I;  2QEX Z;  1VQK Z;  1Q81 2;  3HOX I;  3CC2 1;  4RV9 A;  1TWF I;  3IFU A;  4NOZ A;  3H0G I;  3VMG A;  4A3C I;  2F4O A;  4E32 A;  3J81 b;  1Y1V S;  4A3I I;  2OTL Z;  3CME 1;  3GTL I;  2VF1 A;  5IT9 f;  3CCS 1;  1VQL 1;  2QRC B;  3F3P C;  4A3L I;  4MD9 A;  3CCL 1;  5T67 A;  1YJN 1;  5T64 A;  1RNI A;  3HOV I;  4A93 I;  3D6W A;  2QA4 Z;  4NB9 A;  2K3R A;  3G4S Z;  1NJI 2;  1YJW 1;  1VQ5 1;  2Y0S A;  4EWC A;  4NBC A;  4A3F I;  1SFO I;  1VQM Z;  2F4M A;  2B63 I;  3CCM 1;  4NBF A;  3CCE 1;  2I3C A;  3VB9 A;  3OW2 Z;  2GTH A;  3KIF A;  1Q82 2;  3GTK I;  3GTM I;  2JNY A;  3GKQ A;  1Z01 A;  1USP A;  3CCR 1;  1N8R 2;  2R93 I;  4MXU A;  3CME Z;  5D1P A;  1WW9 A;  2O4H A;  5LL6 f;  4A3K I;  2WB1 A;  1ZB8 A;  1Q7Y 1;  5D1O A;  4RVH A;  1YJN Z;  3IX0 A;  2JS4 A;  4NBE A;  3I4N I;  1TFI A;  5IP9 I;  4A3B I;  2BJO A;  3GTO I;  2OOX B;  1YJW Z;  1K8A 1;  1ML8 A;  2QR1 B;  2E9H A;  2WAQ A;  3QWU A;  1ZB9 A;  1VLA A;  5IT9 b;  3GCF A;  3CCM Z;  1VQN 1;  4BXX I;  3CCE Z;  3NDJ A;  4A3J I;  3HOY I;  2R6M A;  3CC4 1;  1M1K 1;  2KI7 B;  1QVG Z;  3CCR Z;  2PM9 A;  4Y7N I;  1K9M 1;  3GTM S;  2OOY B;  3Q87 A;  1M90 2;  4QTU A;  2V8J A;  5AN9 F;  3GTJ I;  3CMA Z;  1VQ7 Z;  1WCM I;  1KC8 1;  2KPI A;  1QF8 A;  1NUI A;  2AKL A;  4NB8 A;  3S2D I;  3FKI I;  2VUG A;  3FQM A;  2RHB A;  1Q81 1;  4RVF A;  4QTT A;  3NH5 A;  2GTI A;  3S16 I;  4A3G I;  1VQP 1;  3G71 Z;  1X3Z A;  5C4J I;  3I56 1;  1KRL A;  4HGY A;  1YIJ Z;  2PK7 A;  4NH1 C;  3KIH A;  3BG1 B;  5CM2 M;  3CD6 1;  2R7Z I;  3PO3 I;  3CC4 Z;  3HOW I;  1I6H I;  1VQ8 Z;  1Y1W I;  1YUK A;  2OZK A;  2Q51 A;  5T6B A;  4A3M I;  4BY7 I;  2P28 A;  1LQL A;  1L1O C;  1Q86 2;  1VQ4 1;  3LUS A;  1NJI 1;  2NVT I;  2OTJ 1;  1VQ6 1;  3S2H I;  1QVG Y;  1YJ9 Z;  1ZH1 A;  1K83 I;  3GTG I;  2HF1 A;  4MD7 A;  2DE5 A;  3CC7 1;  1Q82 1;  2W03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...