5FLXb

Mammalian 40s hcv-ires complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
80
structure length
80
Chain Sequence
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 4
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5flxb00
5IT9b 3JAMb 3J81b 5A2Qb 3J7A4 5LL6f 3J80b 5FLXb
chains in the Genus database with same CATH superfamily
1Z03A 2JA8I 4RV9A 4A3GI 1FDIA 2YADA 3GTJI 3HKZA 4NH1C 5IT9f 4CL1A 1QVGZ 3CMA1 2Y0SA 3GTMS 2V3VA 2W04A 4E31A 2K3RA 4NFRA 1VQ9Z 5IP7I 1M902 3M4OI 2JIRA 1RO0A 3JAMf 3CC21 3H3VJ 2HU9A 4HH4A 1N8R1 3RZOI 1Q7Y2 1JWHC 1TWCI 1KQSZ 1WIIA 1X0TA 1QYPA 1QXFA 1VQOZ 1S72Z 1YIJZ 2HF1A 2IZ3A 3MZKB 4HGZA 2IZ4A 2VPYA 2R92I 3HOXI 2RHBA 2JR6A 1RO2A 1VQKZ 1TWAI 5C4XI 3GTMI 4MD8A 1K83I 3BG0B 2H85A 4MONA 2J6AA 3CME1 3EEDA 1VQ81 3I4NI 2DE5A 5T6BA 4NBEA 3CCL1 2O4HA 1VQ7Z 3G4SZ 2OTLZ 3JAMb 1L1OC 3D6WA 1Z01A 1YJNZ 4E2ZA 5C3EI 4A3II 3IF8A 3GCFA 2R93I 2QRCB 3CQZI 3K7AI 3NFZA 1Q16A 1P9NA 1JJ2Z 5A2Qf 4A3JI 2V8KA 1VQPZ 2QEX1 1VQNZ 3CCR1 2QRDB 5D1OB 3G71Z 2LEXA 3IX0A 1I50I 2OZKA 5C4JI 2QLVB 2M6NA 4A3KI 3VMGA 1VQ5Z 3S2DI 1R9TI 4DGLA 2I3CA 1YIT1 3H0GI 3NH8A 5LL6f 1FDOA 2OTL1 4NBFA 3CCU1 3CCS1 1VQ71 3GTGI 3CCLZ 3M3YI 2RBLA 2JIQA 1RO4A 2AKLA 2QA41 4NB8A 2VPXA 4XX2A 1K8A1 3I55Z 2R6MA 5T67A 3CPWY 4NBCA 2E2HI 3CMEZ 1M1K1 2Q51A 1AA6A 2VPZA 2PM9A 2ZAEB 4A3DI 2RIQA 3P5JB 1N8R2 1Y1VS 1ML8A 2GTHA 3MONA 1RNIA 4BBSI 2YU9I 4DK1A 1YIJ1 1S721 1Q821 4NB9A 4RVHA 2Q4ZA 1YUKA 1I3QI 1USPA 3CCE1 5IT9b 2IV2X 4NBDA 1TFIA 2AYDA 5FLXb 1K9M1 3S15I 3I07A 1WW9A 2RT9A 1VQ91 2PK7A 1Q862 1KQSY 2NVXI 2W03A 1KD11 3CMAZ 1W2BY 3GKQA 2KPIA 3PO3I 2DE6A 1Y1WI 3VB9A 5C44I 4E33A 5D1PA 3J81f 3CCEZ 3GTKI 4HGYA 1KC81 2VUMI 1NJI2 1KD12 4RVGA 1YHQ1 1WJ2A 3CC4Z 4QTUA 2E2JI 1LQLA 1YI21 1RLYA 3S1RI 2V8IA 4A93I 4MRIA 3HOWI 3IFUA 1Q812 2JNYA 2KI7B 2QREB 1SIWA 3U50C 1ZB8A 1Q822 2VUGA 2GU2A 3BG1B 1S7MA 3I551 3FQQA 1VQM1 2QR1B 2QA4Z 3QWUA 4NOZA 4TNUA 3CCM1 3OW2Z 3S1QI 3CCSZ 3CCUZ 1K731 1YITZ 2LIYA 2V45A 1VQ6Z 1VQ51 2EGTA 3D9XA 2E7ZA 1JJ2Y 1TWFI 1KRLA 1K8A2 3G711 3CCRZ 1VQN1 1VQLZ 2P3YA 1USPB 1Y8CA 3S2HI 3GTPI 3T4NB 2QEXZ 1VQP1 4Y52I 4NBHA 3GTQI 3MZLB 3NDJA 2E9HA 2OTJ1 4NBAA 2PMZA 3J80b 1W2BZ 3CCVZ 4RVDA 1Q861 1YJN1 1TWHI 5FLXf 3HOVI 1NJI1 1K732 3S16I 3I56Z 3Q87A 1YJWZ 3CCQ1 2B63I 4MD7A 2WB1A 3VMHA 3G4S1 2JIMA 2V8JA 1ZH1A 4DQYB 3CD61 2RPRA 1I6HI 4X6AI 1QVFZ 4MXUA 4A3BI 5D1OA 1Q811 1VQ8Z 3CCJZ 1N2FA 1Z02A 3OW2Y 1QF8A 3NDIA 2JIOA 4Y7NI 4E2XA 4NBGA 1VQ4Z 1VQK1 3GTLI 1X3ZA 4E2YA 5A2Qb 1YUAA 3NH4A 3FKII 1YJ91 1Q7Y1 1X3WA 4A3EI 2JS4A 1KC82 3PO3S 2F4OA 4EWCA 1VQO1 1YJ9Z 4RS4A 2OOXB 3F3PC 3J80f 3HOYI 2DE7A 1VQ41 2NVQI 2QKDA 1PFTA 2LFUA 4BXXI 3VTNA 4BY1I 5CM2M 3CC2Z 3CCJ1 4E2WA 2R7ZI 3RZDI 1RQFA 3CD6Z 3S17I 2GTIA 2WAQA 4RVFA 2K5RA 5T64A 1TWGI 1K9M2 4A3LI 1WZNA 4E30A 1ZB9A 3S1NI 1VLAA 2M48A 3KIHA 3CCQZ 1YJW1 1QVFY 3I561 3NH5A 3IR7A 4AYBA 2G2KA 5IP9I 3CXCZ 3J81b 3CCV1 4QTTA 2JA5I 2JA6I 3PO2I 2OTJZ 4A3MI 2P28A 2JUBA 3G6EZ 1SFOI 1VQL1 2VPWA 2JMOA 3KIFA 3CPWZ 1VQ61 3GTOI 3LUSA 2E2II 1M901 1DL6A 4MD9A 3I4MI 3S14I 3FQMA 4E32A 2JA7I 3S1MI 4NBBA 3CXCY 1QVGY 2NAPA 2JIPA 2NVYI 3CCMZ 2F4MA 4S1TA 4BBRI 3CC71 3CC7Z 1VQMZ 3D2LA 4BY7I 4MH4A 1Y1VI 2O53A 1M1K2 1NUIA 3VMIA 3HOUI 1WCMI 2NVTI 3J7A4 3TE5B 3ESWA 2BJOA 2OOYB 4A3FI 3EERA 3HOZI 3TDHB 3F3FC 2VF1A 1YI2Z 5AN9F 1NP6A 3G6E1 4A3CI 5FLMI 3CC41 1YHQZ
chains in the Genus database with same CATH topology
1Z03A 2JA8I 4RV9A 4A3GI 2YADA 3GTJI 3HKZA 4NH1C 5IT9f 4CL1A 1QVGZ 3CMA1 2Y0SA 3GTMS 2W04A 4E31A 2K3RA 4NFRA 1VQ9Z 5IP7I 1M902 3M4OI 1RO0A 3JAMf 3CC21 3H3VJ 2HU9A 4HH4A 1N8R1 3RZOI 1Q7Y2 1JWHC 1TWCI 1KQSZ 1WIIA 1X0TA 1QYPA 1VQOZ 1S72Z 1YIJZ 2HF1A 2IZ3A 3MZKB 4HGZA 2IZ4A 2R92I 3HOXI 2RHBA 2JR6A 1RO2A 1VQKZ 1TWAI 5C4XI 3GTMI 4MD8A 1K83I 3BG0B 2H85A 4MONA 2J6AA 3CME1 3EEDA 1VQ81 3I4NI 2DE5A 5T6BA 4NBEA 3CCL1 2O4HA 1VQ7Z 3G4SZ 2OTLZ 3JAMb 1L1OC 3D6WA 1Z01A 1YJNZ 4E2ZA 5C3EI 4A3II 3IF8A 3GCFA 2R93I 2QRCB 3CQZI 3K7AI 3NFZA 1P9NA 1JJ2Z 5A2Qf 4A3JI 2V8KA 1VQPZ 2QEX1 1VQNZ 3CCR1 2QRDB 5D1OB 3G71Z 3IX0A 1I50I 2OZKA 5C4JI 2QLVB 2M6NA 4A3KI 3VMGA 1VQ5Z 3S2DI 1R9TI 4DGLA 2I3CA 1YIT1 3H0GI 3NH8A 5LL6f 2OTL1 4NBFA 3CCU1 3CCS1 1VQ71 3GTGI 3CCLZ 3M3YI 2RBLA 1RO4A 2AKLA 2QA41 4NB8A 4XX2A 1K8A1 3I55Z 2R6MA 5T67A 3CPWY 4NBCA 2E2HI 3CMEZ 1M1K1 2Q51A 2PM9A 2ZAEB 4A3DI 2RIQA 3P5JB 1N8R2 1Y1VS 1ML8A 2GTHA 3MONA 1RNIA 4BBSI 2YU9I 4DK1A 1YIJ1 1S721 1Q821 4NB9A 4RVHA 2Q4ZA 1YUKA 1I3QI 1USPA 3CCE1 5IT9b 4NBDA 1TFIA 1K9M1 5FLXb 3S15I 3I07A 1WW9A 2RT9A 1VQ91 2PK7A 1Q862 1KQSY 2NVXI 2W03A 1KD11 3CMAZ 1W2BY 3GKQA 2KPIA 3PO3I 2DE6A 1Y1WI 3VB9A 5C44I 4E33A 5D1PA 3J81f 3CCEZ 3GTKI 4HGYA 1KC81 2VUMI 1NJI2 1KD12 4RVGA 1YHQ1 3CC4Z 4QTUA 2E2JI 1LQLA 1YI21 1RLYA 3S1RI 2V8IA 4A93I 4MRIA 3HOWI 3IFUA 1Q812 2JNYA 2KI7B 2QREB 3U50C 1ZB8A 1Q822 2VUGA 2GU2A 3BG1B 1S7MA 3I551 3FQQA 1VQM1 2QR1B 2QA4Z 3QWUA 4NOZA 4TNUA 3CCM1 3OW2Z 3S1QI 3CCSZ 3CCUZ 1K731 1YITZ 2LIYA 1VQ6Z 1VQ51 2EGTA 3D9XA 1JJ2Y 1TWFI 1KRLA 1K8A2 3G711 3CCRZ 1VQN1 1VQLZ 2P3YA 1USPB 3S2HI 3GTPI 3T4NB 2QEXZ 1VQP1 4Y52I 4NBHA 3GTQI 3MZLB 3NDJA 2E9HA 2OTJ1 4NBAA 2PMZA 3J80b 1W2BZ 3CCVZ 4RVDA 1Q861 1YJN1 1TWHI 5FLXf 3HOVI 1NJI1 1K732 3S16I 3I56Z 3Q87A 1YJWZ 3CCQ1 2B63I 4MD7A 2WB1A 3VMHA 3G4S1 2V8JA 1ZH1A 4DQYB 3CD61 2RPRA 1I6HI 4X6AI 1QVFZ 4MXUA 4A3BI 5D1OA 1Q811 1VQ8Z 3CCJZ 1N2FA 1Z02A 3OW2Y 1QF8A 3NDIA 4Y7NI 4E2XA 4NBGA 1VQ4Z 1VQK1 3GTLI 1X3ZA 4E2YA 5A2Qb 1YUAA 3NH4A 3FKII 1YJ91 1Q7Y1 1X3WA 4A3EI 2JS4A 1KC82 3PO3S 2F4OA 4EWCA 1VQO1 1YJ9Z 4RS4A 2OOXB 3F3PC 3J80f 3HOYI 2DE7A 1VQ41 2NVQI 2QKDA 1PFTA 2LFUA 4BXXI 3VTNA 4BY1I 5CM2M 3CC2Z 3CCJ1 4E2WA 2R7ZI 3RZDI 1RQFA 3CD6Z 3S17I 2GTIA 2WAQA 4RVFA 2K5RA 5T64A 1TWGI 1K9M2 4A3LI 4E30A 1ZB9A 3S1NI 1VLAA 2M48A 3KIHA 3CCQZ 1YJW1 1QVFY 3I561 3NH5A 4AYBA 2G2KA 5IP9I 3CXCZ 3J81b 3CCV1 4QTTA 2JA5I 2JA6I 3PO2I 2OTJZ 4A3MI 2P28A 2JUBA 3G6EZ 1SFOI 1VQL1 2JMOA 3KIFA 3CPWZ 1VQ61 3GTOI 3LUSA 2E2II 1M901 1DL6A 4MD9A 3I4MI 3S14I 3FQMA 4E32A 2JA7I 3S1MI 4NBBA 3CXCY 1QVGY 2NVYI 3CCMZ 2F4MA 4S1TA 4BBRI 3CC71 3CC7Z 1VQMZ 4BY7I 4MH4A 1Y1VI 2O53A 1M1K2 1NUIA 3VMIA 3HOUI 1WCMI 2NVTI 3J7A4 3TE5B 3ESWA 2BJOA 2OOYB 4A3FI 3EERA 3HOZI 3TDHB 3F3FC 2VF1A 1YI2Z 5AN9F 1NP6A 3G6E1 4A3CI 5FLMI 3CC41 1YHQZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  3JAM b;  3J81 b;  5A2Q b;  3J7A 4;  5LL6 f;  3J80 b;  5FLX b; 
#chains in the Genus database with same CATH topology
 1Z03 A;  2JA8 I;  4RV9 A;  4A3G I;  1FDI A;  2YAD A;  3GTJ I;  3HKZ A;  4NH1 C;  5IT9 f;  4CL1 A;  1QVG Z;  3CMA 1;  2Y0S A;  3GTM S;  2V3V A;  2W04 A;  4E31 A;  2K3R A;  4NFR A;  1VQ9 Z;  5IP7 I;  1M90 2;  3M4O I;  2JIR A;  1RO0 A;  3JAM f;  3CC2 1;  3H3V J;  2HU9 A;  4HH4 A;  1N8R 1;  3RZO I;  1Q7Y 2;  1JWH C;  1TWC I;  1KQS Z;  1WII A;  1X0T A;  1QYP A;  1QXF A;  1VQO Z;  1S72 Z;  1YIJ Z;  2HF1 A;  2IZ3 A;  3MZK B;  4HGZ A;  2IZ4 A;  2VPY A;  2R92 I;  3HOX I;  2RHB A;  2JR6 A;  1RO2 A;  1VQK Z;  1TWA I;  5C4X I;  3GTM I;  4MD8 A;  1K83 I;  3BG0 B;  2H85 A;  4MON A;  2J6A A;  3CME 1;  3EED A;  1VQ8 1;  3I4N I;  2DE5 A;  5T6B A;  4NBE A;  3CCL 1;  2O4H A;  1VQ7 Z;  3G4S Z;  2OTL Z;  3JAM b;  1L1O C;  3D6W A;  1Z01 A;  1YJN Z;  4E2Z A;  5C3E I;  4A3I I;  3IF8 A;  3GCF A;  2R93 I;  2QRC B;  3CQZ I;  3K7A I;  3NFZ A;  1Q16 A;  1P9N A;  1JJ2 Z;  5A2Q f;  4A3J I;  2V8K A;  1VQP Z;  2QEX 1;  1VQN Z;  3CCR 1;  2QRD B;  5D1O B;  3G71 Z;  2LEX A;  3IX0 A;  1I50 I;  2OZK A;  5C4J I;  2QLV B;  2M6N A;  4A3K I;  3VMG A;  1VQ5 Z;  3S2D I;  1R9T I;  4DGL A;  2I3C A;  1YIT 1;  3H0G I;  3NH8 A;  5LL6 f;  1FDO A;  2OTL 1;  4NBF A;  3CCU 1;  3CCS 1;  1VQ7 1;  3GTG I;  3CCL Z;  3M3Y I;  2RBL A;  2JIQ A;  1RO4 A;  2AKL A;  2QA4 1;  4NB8 A;  2VPX A;  4XX2 A;  1K8A 1;  3I55 Z;  2R6M A;  5T67 A;  3CPW Y;  4NBC A;  2E2H I;  3CME Z;  1M1K 1;  2Q51 A;  1AA6 A;  2VPZ A;  2PM9 A;  2ZAE B;  4A3D I;  2RIQ A;  3P5J B;  1N8R 2;  1Y1V S;  1ML8 A;  2GTH A;  3MON A;  1RNI A;  4BBS I;  2YU9 I;  4DK1 A;  1YIJ 1;  1S72 1;  1Q82 1;  4NB9 A;  4RVH A;  2Q4Z A;  1YUK A;  1I3Q I;  1USP A;  3CCE 1;  5IT9 b;  2IV2 X;  4NBD A;  1TFI A;  2AYD A;  5FLX b;  1K9M 1;  3S15 I;  3I07 A;  1WW9 A;  2RT9 A;  1VQ9 1;  2PK7 A;  1Q86 2;  1KQS Y;  2NVX I;  2W03 A;  1KD1 1;  3CMA Z;  1W2B Y;  3GKQ A;  2KPI A;  3PO3 I;  2DE6 A;  1Y1W I;  3VB9 A;  5C44 I;  4E33 A;  5D1P A;  3J81 f;  3CCE Z;  3GTK I;  4HGY A;  1KC8 1;  2VUM I;  1NJI 2;  1KD1 2;  4RVG A;  1YHQ 1;  1WJ2 A;  3CC4 Z;  4QTU A;  2E2J I;  1LQL A;  1YI2 1;  1RLY A;  3S1R I;  2V8I A;  4A93 I;  4MRI A;  3HOW I;  3IFU A;  1Q81 2;  2JNY A;  2KI7 B;  2QRE B;  1SIW A;  3U50 C;  1ZB8 A;  1Q82 2;  2VUG A;  2GU2 A;  3BG1 B;  1S7M A;  3I55 1;  3FQQ A;  1VQM 1;  2QR1 B;  2QA4 Z;  3QWU A;  4NOZ A;  4TNU A;  3CCM 1;  3OW2 Z;  3S1Q I;  3CCS Z;  3CCU Z;  1K73 1;  1YIT Z;  2LIY A;  2V45 A;  1VQ6 Z;  1VQ5 1;  2EGT A;  3D9X A;  2E7Z A;  1JJ2 Y;  1TWF I;  1KRL A;  1K8A 2;  3G71 1;  3CCR Z;  1VQN 1;  1VQL Z;  2P3Y A;  1USP B;  1Y8C A;  3S2H I;  3GTP I;  3T4N B;  2QEX Z;  1VQP 1;  4Y52 I;  4NBH A;  3GTQ I;  3MZL B;  3NDJ A;  2E9H A;  2OTJ 1;  4NBA A;  2PMZ A;  3J80 b;  1W2B Z;  3CCV Z;  4RVD A;  1Q86 1;  1YJN 1;  1TWH I;  5FLX f;  3HOV I;  1NJI 1;  1K73 2;  3S16 I;  3I56 Z;  3Q87 A;  1YJW Z;  3CCQ 1;  2B63 I;  4MD7 A;  2WB1 A;  3VMH A;  3G4S 1;  2JIM A;  2V8J A;  1ZH1 A;  4DQY B;  3CD6 1;  2RPR A;  1I6H I;  4X6A I;  1QVF Z;  4MXU A;  4A3B I;  5D1O A;  1Q81 1;  1VQ8 Z;  3CCJ Z;  1N2F A;  1Z02 A;  3OW2 Y;  1QF8 A;  3NDI A;  2JIO A;  4Y7N I;  4E2X A;  4NBG A;  1VQ4 Z;  1VQK 1;  3GTL I;  1X3Z A;  4E2Y A;  5A2Q b;  1YUA A;  3NH4 A;  3FKI I;  1YJ9 1;  1Q7Y 1;  1X3W A;  4A3E I;  2JS4 A;  1KC8 2;  3PO3 S;  2F4O A;  4EWC A;  1VQO 1;  1YJ9 Z;  4RS4 A;  2OOX B;  3F3P C;  3J80 f;  3HOY I;  2DE7 A;  1VQ4 1;  2NVQ I;  2QKD A;  1PFT A;  2LFU A;  4BXX I;  3VTN A;  4BY1 I;  5CM2 M;  3CC2 Z;  3CCJ 1;  4E2W A;  2R7Z I;  3RZD I;  1RQF A;  3CD6 Z;  3S17 I;  2GTI A;  2WAQ A;  4RVF A;  2K5R A;  5T64 A;  1TWG I;  1K9M 2;  4A3L I;  1WZN A;  4E30 A;  1ZB9 A;  3S1N I;  1VLA A;  2M48 A;  3KIH A;  3CCQ Z;  1YJW 1;  1QVF Y;  3I56 1;  3NH5 A;  3IR7 A;  4AYB A;  2G2K A;  5IP9 I;  3CXC Z;  3J81 b;  3CCV 1;  4QTT A;  2JA5 I;  2JA6 I;  3PO2 I;  2OTJ Z;  4A3M I;  2P28 A;  2JUB A;  3G6E Z;  1SFO I;  1VQL 1;  2VPW A;  2JMO A;  3KIF A;  3CPW Z;  1VQ6 1;  3GTO I;  3LUS A;  2E2I I;  1M90 1;  1DL6 A;  4MD9 A;  3I4M I;  3S14 I;  3FQM A;  4E32 A;  2JA7 I;  3S1M I;  4NBB A;  3CXC Y;  1QVG Y;  2NAP A;  2JIP A;  2NVY I;  3CCM Z;  2F4M A;  4S1T A;  4BBR I;  3CC7 1;  3CC7 Z;  1VQM Z;  3D2L A;  4BY7 I;  4MH4 A;  1Y1V I;  2O53 A;  1M1K 2;  1NUI A;  3VMI A;  3HOU I;  1WCM I;  2NVT I;  3J7A 4;  3TE5 B;  3ESW A;  2BJO A;  2OOY B;  4A3F I;  3EER A;  3HOZ I;  3TDH B;  3F3F C;  2VF1 A;  1YI2 Z;  5AN9 F;  1NP6 A;  3G6E 1;  4A3C I;  5FLM I;  3CC4 1;  1YHQ Z; 
#chains in the Genus database with same CATH homology
 1Z03 A;  2JA8 I;  4RV9 A;  4A3G I;  2YAD A;  3GTJ I;  3HKZ A;  4NH1 C;  5IT9 f;  4CL1 A;  1QVG Z;  3CMA 1;  2Y0S A;  3GTM S;  2W04 A;  4E31 A;  2K3R A;  4NFR A;  1VQ9 Z;  5IP7 I;  1M90 2;  3M4O I;  1RO0 A;  3JAM f;  3CC2 1;  3H3V J;  2HU9 A;  4HH4 A;  1N8R 1;  3RZO I;  1Q7Y 2;  1JWH C;  1TWC I;  1KQS Z;  1WII A;  1X0T A;  1QYP A;  1VQO Z;  1S72 Z;  1YIJ Z;  2HF1 A;  2IZ3 A;  3MZK B;  4HGZ A;  2IZ4 A;  2R92 I;  3HOX I;  2RHB A;  2JR6 A;  1RO2 A;  1VQK Z;  1TWA I;  5C4X I;  3GTM I;  4MD8 A;  1K83 I;  3BG0 B;  2H85 A;  4MON A;  2J6A A;  3CME 1;  3EED A;  1VQ8 1;  3I4N I;  2DE5 A;  5T6B A;  4NBE A;  3CCL 1;  2O4H A;  1VQ7 Z;  3G4S Z;  2OTL Z;  3JAM b;  1L1O C;  3D6W A;  1Z01 A;  1YJN Z;  4E2Z A;  5C3E I;  4A3I I;  3IF8 A;  3GCF A;  2R93 I;  2QRC B;  3CQZ I;  3K7A I;  3NFZ A;  1P9N A;  1JJ2 Z;  5A2Q f;  4A3J I;  2V8K A;  1VQP Z;  2QEX 1;  1VQN Z;  3CCR 1;  2QRD B;  5D1O B;  3G71 Z;  3IX0 A;  1I50 I;  2OZK A;  5C4J I;  2QLV B;  2M6N A;  4A3K I;  3VMG A;  1VQ5 Z;  3S2D I;  1R9T I;  4DGL A;  2I3C A;  1YIT 1;  3H0G I;  3NH8 A;  5LL6 f;  2OTL 1;  4NBF A;  3CCU 1;  3CCS 1;  1VQ7 1;  3GTG I;  3CCL Z;  3M3Y I;  2RBL A;  1RO4 A;  2AKL A;  2QA4 1;  4NB8 A;  4XX2 A;  1K8A 1;  3I55 Z;  2R6M A;  5T67 A;  3CPW Y;  4NBC A;  2E2H I;  3CME Z;  1M1K 1;  2Q51 A;  2PM9 A;  2ZAE B;  4A3D I;  2RIQ A;  3P5J B;  1N8R 2;  1Y1V S;  1ML8 A;  2GTH A;  3MON A;  1RNI A;  4BBS I;  2YU9 I;  4DK1 A;  1YIJ 1;  1S72 1;  1Q82 1;  4NB9 A;  4RVH A;  2Q4Z A;  1YUK A;  1I3Q I;  1USP A;  3CCE 1;  5IT9 b;  4NBD A;  1TFI A;  1K9M 1;  5FLX b;  3S15 I;  3I07 A;  1WW9 A;  2RT9 A;  1VQ9 1;  2PK7 A;  1Q86 2;  1KQS Y;  2NVX I;  2W03 A;  1KD1 1;  3CMA Z;  1W2B Y;  3GKQ A;  2KPI A;  3PO3 I;  2DE6 A;  1Y1W I;  3VB9 A;  5C44 I;  4E33 A;  5D1P A;  3J81 f;  3CCE Z;  3GTK I;  4HGY A;  1KC8 1;  2VUM I;  1NJI 2;  1KD1 2;  4RVG A;  1YHQ 1;  3CC4 Z;  4QTU A;  2E2J I;  1LQL A;  1YI2 1;  1RLY A;  3S1R I;  2V8I A;  4A93 I;  4MRI A;  3HOW I;  3IFU A;  1Q81 2;  2JNY A;  2KI7 B;  2QRE B;  3U50 C;  1ZB8 A;  1Q82 2;  2VUG A;  2GU2 A;  3BG1 B;  1S7M A;  3I55 1;  3FQQ A;  1VQM 1;  2QR1 B;  2QA4 Z;  3QWU A;  4NOZ A;  4TNU A;  3CCM 1;  3OW2 Z;  3S1Q I;  3CCS Z;  3CCU Z;  1K73 1;  1YIT Z;  2LIY A;  1VQ6 Z;  1VQ5 1;  2EGT A;  3D9X A;  1JJ2 Y;  1TWF I;  1KRL A;  1K8A 2;  3G71 1;  3CCR Z;  1VQN 1;  1VQL Z;  2P3Y A;  1USP B;  3S2H I;  3GTP I;  3T4N B;  2QEX Z;  1VQP 1;  4Y52 I;  4NBH A;  3GTQ I;  3MZL B;  3NDJ A;  2E9H A;  2OTJ 1;  4NBA A;  2PMZ A;  3J80 b;  1W2B Z;  3CCV Z;  4RVD A;  1Q86 1;  1YJN 1;  1TWH I;  5FLX f;  3HOV I;  1NJI 1;  1K73 2;  3S16 I;  3I56 Z;  3Q87 A;  1YJW Z;  3CCQ 1;  2B63 I;  4MD7 A;  2WB1 A;  3VMH A;  3G4S 1;  2V8J A;  1ZH1 A;  4DQY B;  3CD6 1;  2RPR A;  1I6H I;  4X6A I;  1QVF Z;  4MXU A;  4A3B I;  5D1O A;  1Q81 1;  1VQ8 Z;  3CCJ Z;  1N2F A;  1Z02 A;  3OW2 Y;  1QF8 A;  3NDI A;  4Y7N I;  4E2X A;  4NBG A;  1VQ4 Z;  1VQK 1;  3GTL I;  1X3Z A;  4E2Y A;  5A2Q b;  1YUA A;  3NH4 A;  3FKI I;  1YJ9 1;  1Q7Y 1;  1X3W A;  4A3E I;  2JS4 A;  1KC8 2;  3PO3 S;  2F4O A;  4EWC A;  1VQO 1;  1YJ9 Z;  4RS4 A;  2OOX B;  3F3P C;  3J80 f;  3HOY I;  2DE7 A;  1VQ4 1;  2NVQ I;  2QKD A;  1PFT A;  2LFU A;  4BXX I;  3VTN A;  4BY1 I;  5CM2 M;  3CC2 Z;  3CCJ 1;  4E2W A;  2R7Z I;  3RZD I;  1RQF A;  3CD6 Z;  3S17 I;  2GTI A;  2WAQ A;  4RVF A;  2K5R A;  5T64 A;  1TWG I;  1K9M 2;  4A3L I;  4E30 A;  1ZB9 A;  3S1N I;  1VLA A;  2M48 A;  3KIH A;  3CCQ Z;  1YJW 1;  1QVF Y;  3I56 1;  3NH5 A;  4AYB A;  2G2K A;  5IP9 I;  3CXC Z;  3J81 b;  3CCV 1;  4QTT A;  2JA5 I;  2JA6 I;  3PO2 I;  2OTJ Z;  4A3M I;  2P28 A;  2JUB A;  3G6E Z;  1SFO I;  1VQL 1;  2JMO A;  3KIF A;  3CPW Z;  1VQ6 1;  3GTO I;  3LUS A;  2E2I I;  1M90 1;  1DL6 A;  4MD9 A;  3I4M I;  3S14 I;  3FQM A;  4E32 A;  2JA7 I;  3S1M I;  4NBB A;  3CXC Y;  1QVG Y;  2NVY I;  3CCM Z;  2F4M A;  4S1T A;  4BBR I;  3CC7 1;  3CC7 Z;  1VQM Z;  4BY7 I;  4MH4 A;  1Y1V I;  2O53 A;  1M1K 2;  1NUI A;  3VMI A;  3HOU I;  1WCM I;  2NVT I;  3J7A 4;  3TE5 B;  3ESW A;  2BJO A;  2OOY B;  4A3F I;  3EER A;  3HOZ I;  3TDH B;  3F3F C;  2VF1 A;  1YI2 Z;  5AN9 F;  1NP6 A;  3G6E 1;  4A3C I;  5FLM I;  3CC4 1;  1YHQ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...