5FLXb

Mammalian 40s hcv-ires complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
80
structure length
80
Chain Sequence
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 4
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5flxb00
3J80b 5FLXb 5IT9b 3J7A4 5LL6f 3J81b 5A2Qb 3JAMb
chains in the Genus database with same CATH superfamily
2OTLZ 1VQ8Z 3GTMI 1ML8A 2O53A 4NBGA 1VQMZ 4A3CI 2QA41 1VQ7Z 3GTPI 1VQ9Z 4A93I 2RT9A 1Q821 3GTMS 1QVFY 3GTJI 4A3FI 1Z01A 4RVHA 3S2DI 3CCSZ 3VMIA 2Y0SA 2LIYA 3CC2Z 1Z03A 2K3RA 3GKQA 1YUKA 3CCM1 1Q812 4Y52I 5D1OB 3Q87A 3PO2I 3CCE1 1Z02A 2P28A 4A3KI 3CC4Z 4BY1I 3VB9A 1NJI1 2PMZA 2JA7I 3FQMA 2OZKA 4RV9A 3CCVZ 2WAQA 2V8JA 4MD8A 2NVTI 2R92I 4E32A 3VTNA 3CMAZ 1DL6A 1JWHC 1LQLA 3NFZA 3MZKB 4HGZA 3G711 2V8KA 3I561 1JJ2Y 5FLXf 2IZ3A 1K9M2 1RO2A 3CXCY 3U50C 3EEDA 4X6AI 2QEX1 3M3YI 1YJW1 3S16I 3CMEZ 3I07A 3PO3I 3IF8A 4DK1A 1FDIA 4A3EI 1Q862 1X3WA 3NDJA 1VQOZ 2O4HA 1ZB9A 5IT9f 3PO3S 1YIT1 2E7ZA 1VQLZ 4TNUA 1NP6A 3I4MI 4MXUA 2PK7A 1X0TA 3CC7Z 4MD9A 4S1TA 1K8A2 2ZAEB 3I551 3CCLZ 5FLXb 4E31A 1VQ6Z 1RO4A 2RHBA 2OTJZ 5CM2M 4NBAA 1X3ZA 3FKII 3JAMf 1VQ41 2VPWA 3KIHA 1N8R2 4NOZA 1VQM1 3CCRZ 1TWHI 1TWGI 5T64A 3S1RI 4BBRI 5IT9b 3ESWA 1L1OC 1YI21 3CD6Z 3NH8A 2RIQA 3GTKI 2R93I 1USPA 3H3VJ 1K8A1 2NVXI 3S15I 1VQKZ 3NH4A 2V8IA 1FDOA 3KIFA 4CL1A 3CCJZ 1N2FA 2HU9A 1K731 3CCQZ 5FLMI 2I3CA 4NBDA 1SFOI 4A3DI 1WW9A 2JA5I 2QREB 1S72Z 2JIQA 4A3GI 2K5RA 3M4OI 1Y1VI 3G4S1 1Q7Y1 1YJ91 1TWCI 3JAMb 3CPWZ 3D6WA 5C44I 3CCUZ 3OW2Z 1QVGY 1Y1VS 1ZH1A 1YHQ1 2R7ZI 2IV2X 2VUGA 1RLYA 2LEXA 3GTGI 2F4MA 1NUIA 1KQSY 4BY7I 2JIPA 3HOVI 4AYBA 3MONA 3F3FC 1YIJZ 3F3PC 4NBEA 1W2BZ 2E9HA 2QA4Z 1Y1WI 1PFTA 4DGLA 3HKZA 1KC82 2W03A 5LL6f 1Q811 2NVQI 4QTUA 1VQ51 2DE5A 4E2ZA 3J7A4 2JNYA 3CQZI 1VQN1 2M6NA 3OW2Y 3CCMZ 1WZNA 1S7MA 4RVFA 3CCEZ 2AYDA 2J6AA 1USPB 2OOYB 5T67A 1KD12 2JA8I 4MRIA 4A3JI 3K7AI 1YJN1 2M48A 2JUBA 1AA6A 1K9M1 2LFUA 2JR6A 3H0GI 4HGYA 2EGTA 1TWFI 2OOXB 4E30A 1W2BY 1QYPA 2AKLA 4NBCA 3G71Z 4NH1C 3I56Z 3RZOI 1Y8CA 1Q861 3NH5A 1VQP1 3HOUI 2E2JI 4XX2A 1TFIA 2WB1A 1VLAA 3D2LA 2QEXZ 3G6E1 4NB8A 1QXFA 4MD7A 2OTL1 1VQ81 2B63I 1P9NA 4E2WA 3MZLB 1VQ71 3VMGA 4NB9A 4HH4A 2V3VA 3IX0A 2Q4ZA 1VQ91 1WJ2A 2RPRA 3D9XA 3RZDI 2DE7A 1YITZ 3I4NI 4BXXI 3CCS1 4DQYB 1YUAA 1I3QI 5AN9F 3CC21 5C4XI 4NBHA 3J80f 1N8R1 1Q822 2G2KA 3I55Z 2VPXA 3VMHA 2E2II 1RO0A 1VQ4Z 2JS4A 3CC41 4A3BI 2QLVB 3CCV1 2F4OA 3HOWI 3BG0B 1YI2Z 3CMA1 1Q16A 1WIIA 3S2HI 2QR1B 1NJI2 1JJ2Z 2GTHA 3J81f 4A3II 2QRCB 4NFRA 3CXCZ 2VF1A 4RVDA 2NVYI 4NBFA 1M902 3J80b 3S1MI 2JIOA 4A3MI 1RNIA 2DE6A 5C4JI 2VPYA 2JIMA 3CME1 2YADA 5D1PA 3G4SZ 1YJ9Z 3NDIA 1VQO1 1TWAI 2KI7B 3CPWY 2NAPA 1YHQZ 1SIWA 1VQL1 2VUMI 1M901 1I6HI 3P5JB 2P3YA 3LUSA 4MONA 1KRLA 3CC71 3GCFA 3J81b 2QRDB 4BBSI 3GTQI 4MH4A 3CCL1 3S17I 1VQ61 1KC81 4RS4A 2JIRA 4E2XA 2YU9I 2OTJ1 2GTIA 2V45A 4A3LI 4EWCA 3T4NB 3TDHB 1QF8A 3CCR1 5A2Qf 1I50I 2GU2A 5D1OA 3QWUA 3S1QI 3CD61 2IZ4A 1VQ5Z 1VQNZ 3FQQA 3HOXI 2JMOA 1KD11 1VQK1 4QTTA 1YJWZ 1WCMI 3CCJ1 2R6MA 2E2HI 2BJOA 3CCQ1 3S14I 3HOYI 5C3EI 3GTOI 3BG1B 1S721 2PM9A 1R9TI 1M1K2 1RQFA 3IR7A 1QVFZ 3S1NI 5IP9I 3EERA 1QVGZ 3GTLI 2VPZA 5IP7I 4E33A 3CCU1 1K732 4RVGA 5T6BA 1YJNZ 3TE5B 2QKDA 2Q51A 3IFUA 2JA6I 1KQSZ 2H85A 5A2Qb 2RBLA 3HOZI 1Q7Y2 4NBBA 4Y7NI 2HF1A 1ZB8A 2KPIA 1M1K1 1VQPZ 1K83I 4E2YA 1YIJ1 2W04A 3G6EZ
chains in the Genus database with same CATH topology
2OTLZ 1VQ8Z 3GTMI 1ML8A 2O53A 4NBGA 1VQMZ 4A3CI 2QA41 1VQ7Z 3GTPI 1VQ9Z 4A93I 2RT9A 1Q821 3GTMS 1QVFY 3GTJI 4A3FI 1Z01A 4RVHA 3S2DI 3CCSZ 3VMIA 2Y0SA 2LIYA 3CC2Z 1Z03A 2K3RA 3GKQA 1YUKA 3CCM1 1Q812 4Y52I 5D1OB 3Q87A 3PO2I 3CCE1 1Z02A 2P28A 4A3KI 3CC4Z 4BY1I 3VB9A 1NJI1 2PMZA 2JA7I 3FQMA 2OZKA 4RV9A 3CCVZ 2WAQA 2V8JA 4MD8A 2NVTI 2R92I 4E32A 3VTNA 3CMAZ 1DL6A 1JWHC 1LQLA 3NFZA 3MZKB 4HGZA 3G711 2V8KA 3I561 1JJ2Y 5FLXf 2IZ3A 1K9M2 1RO2A 3CXCY 3U50C 3EEDA 4X6AI 2QEX1 3M3YI 1YJW1 3S16I 3CMEZ 3I07A 3PO3I 3IF8A 4DK1A 4A3EI 1Q862 1X3WA 3NDJA 1VQOZ 2O4HA 1ZB9A 5IT9f 3PO3S 1YIT1 1VQLZ 4TNUA 1NP6A 3I4MI 4MXUA 2PK7A 1X0TA 3CC7Z 4MD9A 4S1TA 1K8A2 2ZAEB 3I551 3CCLZ 5FLXb 4E31A 1VQ6Z 1RO4A 2RHBA 2OTJZ 5CM2M 4NBAA 1X3ZA 3FKII 3JAMf 1VQ41 3KIHA 1N8R2 4NOZA 1VQM1 3CCRZ 1TWHI 1TWGI 5T64A 3S1RI 4BBRI 5IT9b 3ESWA 1L1OC 1YI21 3CD6Z 3NH8A 2RIQA 3GTKI 2R93I 1USPA 3H3VJ 1K8A1 2NVXI 3S15I 1VQKZ 3NH4A 2V8IA 3KIFA 4CL1A 3CCJZ 1N2FA 2HU9A 1K731 3CCQZ 5FLMI 2I3CA 4NBDA 1SFOI 4A3DI 1WW9A 2JA5I 2QREB 1S72Z 4A3GI 2K5RA 3M4OI 1Y1VI 3G4S1 1Q7Y1 1YJ91 1TWCI 3JAMb 3CPWZ 3D6WA 5C44I 3CCUZ 3OW2Z 1QVGY 1Y1VS 1ZH1A 1YHQ1 2R7ZI 2VUGA 1RLYA 3GTGI 2F4MA 1NUIA 1KQSY 4BY7I 3HOVI 4AYBA 3MONA 3F3FC 1YIJZ 3F3PC 4NBEA 1W2BZ 2E9HA 2QA4Z 1Y1WI 1PFTA 4DGLA 3HKZA 1KC82 2W03A 5LL6f 1Q811 2NVQI 4QTUA 1VQ51 2DE5A 4E2ZA 3J7A4 2JNYA 3CQZI 1VQN1 2M6NA 3OW2Y 3CCMZ 1S7MA 4RVFA 3CCEZ 2J6AA 1USPB 2OOYB 5T67A 1KD12 2JA8I 4MRIA 4A3JI 3K7AI 1YJN1 2M48A 2JUBA 1K9M1 2LFUA 2JR6A 3H0GI 4HGYA 2EGTA 1TWFI 2OOXB 4E30A 1W2BY 1QYPA 2AKLA 4NBCA 3G71Z 4NH1C 3I56Z 3RZOI 1Q861 3NH5A 1VQP1 3HOUI 2E2JI 4XX2A 1TFIA 2WB1A 1VLAA 2QEXZ 3G6E1 4NB8A 4MD7A 2OTL1 1VQ81 2B63I 1P9NA 4E2WA 3MZLB 1VQ71 3VMGA 4NB9A 4HH4A 3IX0A 2Q4ZA 1VQ91 2RPRA 3D9XA 3RZDI 2DE7A 1YITZ 3I4NI 4BXXI 3CCS1 4DQYB 1YUAA 1I3QI 5AN9F 3CC21 5C4XI 4NBHA 3J80f 1N8R1 1Q822 2G2KA 3I55Z 3VMHA 2E2II 1RO0A 1VQ4Z 2JS4A 3CC41 4A3BI 2QLVB 3CCV1 2F4OA 3HOWI 3BG0B 1YI2Z 3CMA1 1WIIA 3S2HI 2QR1B 1NJI2 1JJ2Z 2GTHA 3J81f 4A3II 2QRCB 4NFRA 3CXCZ 2VF1A 4RVDA 2NVYI 4NBFA 1M902 3J80b 3S1MI 4A3MI 1RNIA 2DE6A 5C4JI 3CME1 2YADA 5D1PA 3G4SZ 1YJ9Z 3NDIA 1VQO1 1TWAI 2KI7B 3CPWY 1YHQZ 1VQL1 2VUMI 1M901 1I6HI 3P5JB 2P3YA 3LUSA 4MONA 1KRLA 3CC71 3GCFA 3J81b 2QRDB 4BBSI 3GTQI 4MH4A 3CCL1 3S17I 1VQ61 1KC81 4RS4A 4E2XA 2YU9I 2OTJ1 2GTIA 4A3LI 4EWCA 3T4NB 3TDHB 1QF8A 3CCR1 5A2Qf 1I50I 2GU2A 5D1OA 3QWUA 3S1QI 3CD61 2IZ4A 1VQ5Z 1VQNZ 3FQQA 3HOXI 2JMOA 1KD11 1VQK1 4QTTA 1YJWZ 1WCMI 3CCJ1 2R6MA 2E2HI 2BJOA 3CCQ1 3S14I 3HOYI 5C3EI 3GTOI 3BG1B 1S721 2PM9A 1R9TI 1M1K2 1RQFA 1QVFZ 3S1NI 5IP9I 3EERA 1QVGZ 3GTLI 5IP7I 4E33A 3CCU1 1K732 4RVGA 5T6BA 1YJNZ 3TE5B 2QKDA 2Q51A 3IFUA 2JA6I 1KQSZ 2H85A 5A2Qb 2RBLA 3HOZI 1Q7Y2 4NBBA 4Y7NI 2HF1A 1ZB8A 2KPIA 1M1K1 1VQPZ 1K83I 4E2YA 1YIJ1 2W04A 3G6EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 b;  5FLX b;  5IT9 b;  3J7A 4;  5LL6 f;  3J81 b;  5A2Q b;  3JAM b; 
#chains in the Genus database with same CATH topology
 2OTL Z;  1VQ8 Z;  3GTM I;  1ML8 A;  2O53 A;  4NBG A;  1VQM Z;  4A3C I;  2QA4 1;  1VQ7 Z;  3GTP I;  1VQ9 Z;  4A93 I;  2RT9 A;  1Q82 1;  3GTM S;  1QVF Y;  3GTJ I;  4A3F I;  1Z01 A;  4RVH A;  3S2D I;  3CCS Z;  3VMI A;  2Y0S A;  2LIY A;  3CC2 Z;  1Z03 A;  2K3R A;  3GKQ A;  1YUK A;  3CCM 1;  1Q81 2;  4Y52 I;  5D1O B;  3Q87 A;  3PO2 I;  3CCE 1;  1Z02 A;  2P28 A;  4A3K I;  3CC4 Z;  4BY1 I;  3VB9 A;  1NJI 1;  2PMZ A;  2JA7 I;  3FQM A;  2OZK A;  4RV9 A;  3CCV Z;  2WAQ A;  2V8J A;  4MD8 A;  2NVT I;  2R92 I;  4E32 A;  3VTN A;  3CMA Z;  1DL6 A;  1JWH C;  1LQL A;  3NFZ A;  3MZK B;  4HGZ A;  3G71 1;  2V8K A;  3I56 1;  1JJ2 Y;  5FLX f;  2IZ3 A;  1K9M 2;  1RO2 A;  3CXC Y;  3U50 C;  3EED A;  4X6A I;  2QEX 1;  3M3Y I;  1YJW 1;  3S16 I;  3CME Z;  3I07 A;  3PO3 I;  3IF8 A;  4DK1 A;  1FDI A;  4A3E I;  1Q86 2;  1X3W A;  3NDJ A;  1VQO Z;  2O4H A;  1ZB9 A;  5IT9 f;  3PO3 S;  1YIT 1;  2E7Z A;  1VQL Z;  4TNU A;  1NP6 A;  3I4M I;  4MXU A;  2PK7 A;  1X0T A;  3CC7 Z;  4MD9 A;  4S1T A;  1K8A 2;  2ZAE B;  3I55 1;  3CCL Z;  5FLX b;  4E31 A;  1VQ6 Z;  1RO4 A;  2RHB A;  2OTJ Z;  5CM2 M;  4NBA A;  1X3Z A;  3FKI I;  3JAM f;  1VQ4 1;  2VPW A;  3KIH A;  1N8R 2;  4NOZ A;  1VQM 1;  3CCR Z;  1TWH I;  1TWG I;  5T64 A;  3S1R I;  4BBR I;  5IT9 b;  3ESW A;  1L1O C;  1YI2 1;  3CD6 Z;  3NH8 A;  2RIQ A;  3GTK I;  2R93 I;  1USP A;  3H3V J;  1K8A 1;  2NVX I;  3S15 I;  1VQK Z;  3NH4 A;  2V8I A;  1FDO A;  3KIF A;  4CL1 A;  3CCJ Z;  1N2F A;  2HU9 A;  1K73 1;  3CCQ Z;  5FLM I;  2I3C A;  4NBD A;  1SFO I;  4A3D I;  1WW9 A;  2JA5 I;  2QRE B;  1S72 Z;  2JIQ A;  4A3G I;  2K5R A;  3M4O I;  1Y1V I;  3G4S 1;  1Q7Y 1;  1YJ9 1;  1TWC I;  3JAM b;  3CPW Z;  3D6W A;  5C44 I;  3CCU Z;  3OW2 Z;  1QVG Y;  1Y1V S;  1ZH1 A;  1YHQ 1;  2R7Z I;  2IV2 X;  2VUG A;  1RLY A;  2LEX A;  3GTG I;  2F4M A;  1NUI A;  1KQS Y;  4BY7 I;  2JIP A;  3HOV I;  4AYB A;  3MON A;  3F3F C;  1YIJ Z;  3F3P C;  4NBE A;  1W2B Z;  2E9H A;  2QA4 Z;  1Y1W I;  1PFT A;  4DGL A;  3HKZ A;  1KC8 2;  2W03 A;  5LL6 f;  1Q81 1;  2NVQ I;  4QTU A;  1VQ5 1;  2DE5 A;  4E2Z A;  3J7A 4;  2JNY A;  3CQZ I;  1VQN 1;  2M6N A;  3OW2 Y;  3CCM Z;  1WZN A;  1S7M A;  4RVF A;  3CCE Z;  2AYD A;  2J6A A;  1USP B;  2OOY B;  5T67 A;  1KD1 2;  2JA8 I;  4MRI A;  4A3J I;  3K7A I;  1YJN 1;  2M48 A;  2JUB A;  1AA6 A;  1K9M 1;  2LFU A;  2JR6 A;  3H0G I;  4HGY A;  2EGT A;  1TWF I;  2OOX B;  4E30 A;  1W2B Y;  1QYP A;  2AKL A;  4NBC A;  3G71 Z;  4NH1 C;  3I56 Z;  3RZO I;  1Y8C A;  1Q86 1;  3NH5 A;  1VQP 1;  3HOU I;  2E2J I;  4XX2 A;  1TFI A;  2WB1 A;  1VLA A;  3D2L A;  2QEX Z;  3G6E 1;  4NB8 A;  1QXF A;  4MD7 A;  2OTL 1;  1VQ8 1;  2B63 I;  1P9N A;  4E2W A;  3MZL B;  1VQ7 1;  3VMG A;  4NB9 A;  4HH4 A;  2V3V A;  3IX0 A;  2Q4Z A;  1VQ9 1;  1WJ2 A;  2RPR A;  3D9X A;  3RZD I;  2DE7 A;  1YIT Z;  3I4N I;  4BXX I;  3CCS 1;  4DQY B;  1YUA A;  1I3Q I;  5AN9 F;  3CC2 1;  5C4X I;  4NBH A;  3J80 f;  1N8R 1;  1Q82 2;  2G2K A;  3I55 Z;  2VPX A;  3VMH A;  2E2I I;  1RO0 A;  1VQ4 Z;  2JS4 A;  3CC4 1;  4A3B I;  2QLV B;  3CCV 1;  2F4O A;  3HOW I;  3BG0 B;  1YI2 Z;  3CMA 1;  1Q16 A;  1WII A;  3S2H I;  2QR1 B;  1NJI 2;  1JJ2 Z;  2GTH A;  3J81 f;  4A3I I;  2QRC B;  4NFR A;  3CXC Z;  2VF1 A;  4RVD A;  2NVY I;  4NBF A;  1M90 2;  3J80 b;  3S1M I;  2JIO A;  4A3M I;  1RNI A;  2DE6 A;  5C4J I;  2VPY A;  2JIM A;  3CME 1;  2YAD A;  5D1P A;  3G4S Z;  1YJ9 Z;  3NDI A;  1VQO 1;  1TWA I;  2KI7 B;  3CPW Y;  2NAP A;  1YHQ Z;  1SIW A;  1VQL 1;  2VUM I;  1M90 1;  1I6H I;  3P5J B;  2P3Y A;  3LUS A;  4MON A;  1KRL A;  3CC7 1;  3GCF A;  3J81 b;  2QRD B;  4BBS I;  3GTQ I;  4MH4 A;  3CCL 1;  3S17 I;  1VQ6 1;  1KC8 1;  4RS4 A;  2JIR A;  4E2X A;  2YU9 I;  2OTJ 1;  2GTI A;  2V45 A;  4A3L I;  4EWC A;  3T4N B;  3TDH B;  1QF8 A;  3CCR 1;  5A2Q f;  1I50 I;  2GU2 A;  5D1O A;  3QWU A;  3S1Q I;  3CD6 1;  2IZ4 A;  1VQ5 Z;  1VQN Z;  3FQQ A;  3HOX I;  2JMO A;  1KD1 1;  1VQK 1;  4QTT A;  1YJW Z;  1WCM I;  3CCJ 1;  2R6M A;  2E2H I;  2BJO A;  3CCQ 1;  3S14 I;  3HOY I;  5C3E I;  3GTO I;  3BG1 B;  1S72 1;  2PM9 A;  1R9T I;  1M1K 2;  1RQF A;  3IR7 A;  1QVF Z;  3S1N I;  5IP9 I;  3EER A;  1QVG Z;  3GTL I;  2VPZ A;  5IP7 I;  4E33 A;  3CCU 1;  1K73 2;  4RVG A;  5T6B A;  1YJN Z;  3TE5 B;  2QKD A;  2Q51 A;  3IFU A;  2JA6 I;  1KQS Z;  2H85 A;  5A2Q b;  2RBL A;  3HOZ I;  1Q7Y 2;  4NBB A;  4Y7N I;  2HF1 A;  1ZB8 A;  2KPI A;  1M1K 1;  1VQP Z;  1K83 I;  4E2Y A;  1YIJ 1;  2W04 A;  3G6E Z; 
#chains in the Genus database with same CATH homology
 2OTL Z;  1VQ8 Z;  3GTM I;  1ML8 A;  2O53 A;  4NBG A;  1VQM Z;  4A3C I;  2QA4 1;  1VQ7 Z;  3GTP I;  1VQ9 Z;  4A93 I;  2RT9 A;  1Q82 1;  3GTM S;  1QVF Y;  3GTJ I;  4A3F I;  1Z01 A;  4RVH A;  3S2D I;  3CCS Z;  3VMI A;  2Y0S A;  2LIY A;  3CC2 Z;  1Z03 A;  2K3R A;  3GKQ A;  1YUK A;  3CCM 1;  1Q81 2;  4Y52 I;  5D1O B;  3Q87 A;  3PO2 I;  3CCE 1;  1Z02 A;  2P28 A;  4A3K I;  3CC4 Z;  4BY1 I;  3VB9 A;  1NJI 1;  2PMZ A;  2JA7 I;  3FQM A;  2OZK A;  4RV9 A;  3CCV Z;  2WAQ A;  2V8J A;  4MD8 A;  2NVT I;  2R92 I;  4E32 A;  3VTN A;  3CMA Z;  1DL6 A;  1JWH C;  1LQL A;  3NFZ A;  3MZK B;  4HGZ A;  3G71 1;  2V8K A;  3I56 1;  1JJ2 Y;  5FLX f;  2IZ3 A;  1K9M 2;  1RO2 A;  3CXC Y;  3U50 C;  3EED A;  4X6A I;  2QEX 1;  3M3Y I;  1YJW 1;  3S16 I;  3CME Z;  3I07 A;  3PO3 I;  3IF8 A;  4DK1 A;  4A3E I;  1Q86 2;  1X3W A;  3NDJ A;  1VQO Z;  2O4H A;  1ZB9 A;  5IT9 f;  3PO3 S;  1YIT 1;  1VQL Z;  4TNU A;  1NP6 A;  3I4M I;  4MXU A;  2PK7 A;  1X0T A;  3CC7 Z;  4MD9 A;  4S1T A;  1K8A 2;  2ZAE B;  3I55 1;  3CCL Z;  5FLX b;  4E31 A;  1VQ6 Z;  1RO4 A;  2RHB A;  2OTJ Z;  5CM2 M;  4NBA A;  1X3Z A;  3FKI I;  3JAM f;  1VQ4 1;  3KIH A;  1N8R 2;  4NOZ A;  1VQM 1;  3CCR Z;  1TWH I;  1TWG I;  5T64 A;  3S1R I;  4BBR I;  5IT9 b;  3ESW A;  1L1O C;  1YI2 1;  3CD6 Z;  3NH8 A;  2RIQ A;  3GTK I;  2R93 I;  1USP A;  3H3V J;  1K8A 1;  2NVX I;  3S15 I;  1VQK Z;  3NH4 A;  2V8I A;  3KIF A;  4CL1 A;  3CCJ Z;  1N2F A;  2HU9 A;  1K73 1;  3CCQ Z;  5FLM I;  2I3C A;  4NBD A;  1SFO I;  4A3D I;  1WW9 A;  2JA5 I;  2QRE B;  1S72 Z;  4A3G I;  2K5R A;  3M4O I;  1Y1V I;  3G4S 1;  1Q7Y 1;  1YJ9 1;  1TWC I;  3JAM b;  3CPW Z;  3D6W A;  5C44 I;  3CCU Z;  3OW2 Z;  1QVG Y;  1Y1V S;  1ZH1 A;  1YHQ 1;  2R7Z I;  2VUG A;  1RLY A;  3GTG I;  2F4M A;  1NUI A;  1KQS Y;  4BY7 I;  3HOV I;  4AYB A;  3MON A;  3F3F C;  1YIJ Z;  3F3P C;  4NBE A;  1W2B Z;  2E9H A;  2QA4 Z;  1Y1W I;  1PFT A;  4DGL A;  3HKZ A;  1KC8 2;  2W03 A;  5LL6 f;  1Q81 1;  2NVQ I;  4QTU A;  1VQ5 1;  2DE5 A;  4E2Z A;  3J7A 4;  2JNY A;  3CQZ I;  1VQN 1;  2M6N A;  3OW2 Y;  3CCM Z;  1S7M A;  4RVF A;  3CCE Z;  2J6A A;  1USP B;  2OOY B;  5T67 A;  1KD1 2;  2JA8 I;  4MRI A;  4A3J I;  3K7A I;  1YJN 1;  2M48 A;  2JUB A;  1K9M 1;  2LFU A;  2JR6 A;  3H0G I;  4HGY A;  2EGT A;  1TWF I;  2OOX B;  4E30 A;  1W2B Y;  1QYP A;  2AKL A;  4NBC A;  3G71 Z;  4NH1 C;  3I56 Z;  3RZO I;  1Q86 1;  3NH5 A;  1VQP 1;  3HOU I;  2E2J I;  4XX2 A;  1TFI A;  2WB1 A;  1VLA A;  2QEX Z;  3G6E 1;  4NB8 A;  4MD7 A;  2OTL 1;  1VQ8 1;  2B63 I;  1P9N A;  4E2W A;  3MZL B;  1VQ7 1;  3VMG A;  4NB9 A;  4HH4 A;  3IX0 A;  2Q4Z A;  1VQ9 1;  2RPR A;  3D9X A;  3RZD I;  2DE7 A;  1YIT Z;  3I4N I;  4BXX I;  3CCS 1;  4DQY B;  1YUA A;  1I3Q I;  5AN9 F;  3CC2 1;  5C4X I;  4NBH A;  3J80 f;  1N8R 1;  1Q82 2;  2G2K A;  3I55 Z;  3VMH A;  2E2I I;  1RO0 A;  1VQ4 Z;  2JS4 A;  3CC4 1;  4A3B I;  2QLV B;  3CCV 1;  2F4O A;  3HOW I;  3BG0 B;  1YI2 Z;  3CMA 1;  1WII A;  3S2H I;  2QR1 B;  1NJI 2;  1JJ2 Z;  2GTH A;  3J81 f;  4A3I I;  2QRC B;  4NFR A;  3CXC Z;  2VF1 A;  4RVD A;  2NVY I;  4NBF A;  1M90 2;  3J80 b;  3S1M I;  4A3M I;  1RNI A;  2DE6 A;  5C4J I;  3CME 1;  2YAD A;  5D1P A;  3G4S Z;  1YJ9 Z;  3NDI A;  1VQO 1;  1TWA I;  2KI7 B;  3CPW Y;  1YHQ Z;  1VQL 1;  2VUM I;  1M90 1;  1I6H I;  3P5J B;  2P3Y A;  3LUS A;  4MON A;  1KRL A;  3CC7 1;  3GCF A;  3J81 b;  2QRD B;  4BBS I;  3GTQ I;  4MH4 A;  3CCL 1;  3S17 I;  1VQ6 1;  1KC8 1;  4RS4 A;  4E2X A;  2YU9 I;  2OTJ 1;  2GTI A;  4A3L I;  4EWC A;  3T4N B;  3TDH B;  1QF8 A;  3CCR 1;  5A2Q f;  1I50 I;  2GU2 A;  5D1O A;  3QWU A;  3S1Q I;  3CD6 1;  2IZ4 A;  1VQ5 Z;  1VQN Z;  3FQQ A;  3HOX I;  2JMO A;  1KD1 1;  1VQK 1;  4QTT A;  1YJW Z;  1WCM I;  3CCJ 1;  2R6M A;  2E2H I;  2BJO A;  3CCQ 1;  3S14 I;  3HOY I;  5C3E I;  3GTO I;  3BG1 B;  1S72 1;  2PM9 A;  1R9T I;  1M1K 2;  1RQF A;  1QVF Z;  3S1N I;  5IP9 I;  3EER A;  1QVG Z;  3GTL I;  5IP7 I;  4E33 A;  3CCU 1;  1K73 2;  4RVG A;  5T6B A;  1YJN Z;  3TE5 B;  2QKD A;  2Q51 A;  3IFU A;  2JA6 I;  1KQS Z;  2H85 A;  5A2Q b;  2RBL A;  3HOZ I;  1Q7Y 2;  4NBB A;  4Y7N I;  2HF1 A;  1ZB8 A;  2KPI A;  1M1K 1;  1VQP Z;  1K83 I;  4E2Y A;  1YIJ 1;  2W04 A;  3G6E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...