5FLXb

Mammalian 40s hcv-ires complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
80
structure length
80
Chain Sequence
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 4
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5flxb00
5LL6f 3JAMb 5FLXb 3J7A4 5A2Qb 5IT9b 3J81b 3J80b
chains in the Genus database with same CATH superfamily
1M1K2 2JA6I 2QEX1 4HH4A 3S1NI 2QEXZ 4RV9A 3G6E1 3MZLB 1TFIA 2QREB 1WCMI 2YADA 4XX2A 2E9HA 3CC41 3J81f 1RQFA 3CC4Z 2ZAEB 4BXXI 4CL1A 1ZB9A 4A3CI 3HOVI 5CM2M 1TWAI 3G711 3G71Z 3S2HI 1QVFY 4E30A 3CPWY 3NFZA 2E2II 2P3YA 3RZDI 3IX0A 5IT9b 1I6HI 1X0TA 1AA6A 4NBDA 3S17I 2VPWA 3CCL1 1S721 2JMOA 2JIQA 2JIRA 1S72Z 2E7ZA 1Q16A 2B63I 2QA41 3VMHA 2V45A 4S1TA 2QA4Z 5IT9f 2Y0SA 1VQ5Z 2PM9A 3OW2Y 3QWUA 2JIPA 4AYBA 5C4JI 5AN9F 4A3JI 3HOXI 5LL6f 1VLAA 2OOYB 3NH4A 2V8KA 3PO2I 1VQO1 1VQOZ 2RPRA 2W03A 1Q811 1DL6A 1VQM1 2JA7I 1RO0A 1VQMZ 4NBBA 1VQN1 1Y1VI 3GTPI 1FDIA 1KD12 3PO3I 1VQNZ 3VB9A 1QVFZ 1VQL1 3CPWZ 1VQLZ 1SFOI 3TE5B 1YJ91 2EGTA 3NH8A 3TDHB 1YJ9Z 1K731 2DE5A 1X3ZA 3D6WA 2LIYA 1QF8A 3HOWI 2OZKA 3S1MI 5FLMI 3NDJA 3GTQI 3OW2Z 1NJI1 4E2ZA 2W04A 4BY7I 5T6BA 3F3PC 3I551 3GTGI 3H3VJ 5IP9I 3I55Z 3Q87A 3U50C 3CCMZ 1X3WA 3K7AI 1N8R2 3CCS1 4RVDA 2NVXI 2NVQI 3CCSZ 1Y1VS 2QRCB 4NH1C 1NUIA 5IP7I 4A3BI 2IZ4A 3FQMA 2R93I 3I4MI 4NBAA 4MXUA 2E2JI 4Y7NI 2GTIA 2I3CA 2IZ3A 3S16I 2LEXA 3CCE1 2GTHA 2Q4ZA 1Y8CA 3CCEZ 3GTLI 4RVHA 4NFRA 1USPA 3CD61 3CD6Z 2RBLA 2OTL1 3MZKB 2OTLZ 1K9M2 4NBEA 1KC82 2JUBA 3MONA 5T64A 1WIIA 3S1QI 1Q812 4E2YA 2J6AA 2KPIA 3F3FC 3EERA 3CXCY 1P9NA 2WAQA 1FDOA 4E31A 4BY1I 1K732 4MRIA 1Q7Y2 1JWHC 1K8A1 4DQYB 1VQK1 4A3LI 3CC71 1VQ51 1VQKZ 2JA8I 4TNUA 3CC7Z 1VQ81 1ML8A 1RO4A 2JA5I 3CQZI 1VQ8Z 1PFTA 3BG0B 4HGYA 1Y1WI 3S2DI 4MONA 2M48A 2JR6A 1QVGY 3LUSA 3BG1B 4NB9A 2JNYA 4NB8A 1S7MA 1VQ7Z 1N2FA 1M1K1 2PK7A 1YIT1 1YITZ 3S1RI 1Q861 2NAPA 3CXCZ 3I07A 1Q822 4A3DI 2P28A 3NDIA 5D1PA 2KI7B 3CC21 3EEDA 4MD7A 4E33A 3CC2Z 1YJW1 1RO2A 5D1OB 3I4NI 1YJWZ 3GTKI 1Z01A 3J7A4 1ZB8A 1R9TI 3M4OI 2V8IA 1JJ2Y 5A2Qb 3S14I 2QR1B 2PMZA 4A3MI 1QVGZ 1VQ91 2JIOA 1LQLA 1I50I 1VQ9Z 3HKZA 4A3KI 2NVTI 3FQQA 4A3EI 1ZH1A 4RS4A 5A2Qf 1Z02A 3G4S1 3CCM1 3G4SZ 2RHBA 1M901 1TWGI 3CME1 3CMEZ 3GCFA 3CCUZ 2E2HI 4NBGA 1WZNA 3CMA1 3GKQA 3PO3S 2YU9I 3CMAZ 5T67A 3ESWA 4RVGA 2V8JA 1YIJ1 4A3II 1YIJZ 5C3EI 4EWCA 2AKLA 4RVFA 2M6NA 1RNIA 2V3VA 3VTNA 2K3RA 1YHQ1 2VUMI 3KIHA 3FKII 2O4HA 1YHQZ 1JJ2Z 4MH4A 1W2BZ 1TWFI 2JIMA 4DGLA 1VQ41 4QTUA 1VQ4Z 3NH5A 2AYDA 1Z03A 1Q862 2F4OA 4QTTA 3I561 3G6EZ 3I56Z 3J81b 2H85A 1YUAA 3HOZI 1VQ61 3RZOI 2F4MA 1VQ6Z 2R92I 3HOYI 3S15I 1K83I 3D9XA 2OOXB 1NJI2 3P5JB 3GTJI 4A93I 3IFUA 3KIFA 3CCJ1 1YJN1 2QKDA 4A3FI 1N8R1 3CCJZ 1YJNZ 4E2WA 2VPYA 2IV2X 1KQSZ 4A3GI 1RLYA 5C4XI 2R6MA 1M902 1VQ71 2VF1A 3GTMI 3VMIA 2QLVB 3CCLZ 2RT9A 1VQP1 3GTOI 1L1OC 3IR7A 3M3YI 1VQPZ 2VPZA 2DE6A 3D2LA 2OTJ1 2NVYI 4BBRI 2OTJZ 2LFUA 2HU9A 4MD8A 3JAMb 1K9M1 4NBFA 1QXFA 1KC81 1NP6A 2R7ZI 3T4NB 1SIWA 4DK1A 3CCV1 3H0GI 3JAMf 3CCVZ 4MD9A 2K5RA 2O53A 2DE7A 1W2BY 1USPB 1YUKA 2RIQA 4E32A 1KRLA 3GTMS 1Q7Y1 4Y52I 2VUGA 2GU2A 3CCU1 2JS4A 3VMGA 1YI21 1TWHI 3HOUI 5FLXb 1YI2Z 2VPXA 1WW9A 4NOZA 3J80b 4HGZA 1K8A2 2G2KA 4NBCA 4X6AI 2BJOA 2QRDB 4E2XA 5FLXf 1I3QI 2Q51A 1TWCI 4NBHA 3CCQ1 3CCQZ 3J80f 3IF8A 5C44I 3CCR1 4BBSI 3CCRZ 2HF1A 1WJ2A 5D1OA 2WB1A 1KQSY 1KD11 1Q821 1QYPA
chains in the Genus database with same CATH topology
1M1K2 2JA6I 2QEX1 4HH4A 3S1NI 2QEXZ 4RV9A 3G6E1 3MZLB 1TFIA 2QREB 1WCMI 2YADA 4XX2A 2E9HA 3CC41 3J81f 1RQFA 3CC4Z 2ZAEB 4BXXI 4CL1A 1ZB9A 4A3CI 3HOVI 5CM2M 1TWAI 3G711 3G71Z 3S2HI 1QVFY 4E30A 3CPWY 3NFZA 2E2II 2P3YA 3RZDI 3IX0A 5IT9b 1I6HI 1X0TA 4NBDA 3S17I 3CCL1 1S721 2JMOA 1S72Z 2B63I 2QA41 3VMHA 4S1TA 2QA4Z 5IT9f 2Y0SA 1VQ5Z 2PM9A 3OW2Y 3QWUA 4AYBA 5C4JI 5AN9F 4A3JI 3HOXI 5LL6f 1VLAA 2OOYB 3NH4A 2V8KA 3PO2I 1VQO1 1VQOZ 2RPRA 2W03A 1Q811 1DL6A 1VQM1 2JA7I 1RO0A 1VQMZ 4NBBA 1VQN1 1Y1VI 3GTPI 1KD12 3PO3I 1VQNZ 3VB9A 1QVFZ 1VQL1 3CPWZ 1VQLZ 1SFOI 3TE5B 1YJ91 2EGTA 3NH8A 3TDHB 1YJ9Z 1K731 2DE5A 1X3ZA 3D6WA 2LIYA 1QF8A 3HOWI 2OZKA 3S1MI 5FLMI 3NDJA 3GTQI 3OW2Z 1NJI1 4E2ZA 2W04A 4BY7I 5T6BA 3F3PC 3I551 3GTGI 3H3VJ 5IP9I 3I55Z 3Q87A 3U50C 3CCMZ 1X3WA 3K7AI 1N8R2 3CCS1 4RVDA 2NVXI 2NVQI 3CCSZ 1Y1VS 2QRCB 4NH1C 1NUIA 5IP7I 4A3BI 2IZ4A 3FQMA 2R93I 3I4MI 4NBAA 4MXUA 2E2JI 4Y7NI 2GTIA 2I3CA 2IZ3A 3S16I 3CCE1 2GTHA 2Q4ZA 3GTLI 3CCEZ 4RVHA 4NFRA 1USPA 3CD61 3CD6Z 2RBLA 2OTL1 3MZKB 2OTLZ 1K9M2 4NBEA 1KC82 2JUBA 3MONA 5T64A 1WIIA 3S1QI 1Q812 4E2YA 2J6AA 2KPIA 3F3FC 3EERA 3CXCY 1P9NA 2WAQA 4E31A 4BY1I 1K732 4MRIA 1Q7Y2 1JWHC 1K8A1 4DQYB 1VQK1 4A3LI 3CC71 1VQ51 1VQKZ 2JA8I 4TNUA 3CC7Z 1VQ81 1ML8A 1RO4A 2JA5I 3CQZI 1VQ8Z 1PFTA 3BG0B 4HGYA 1Y1WI 3S2DI 4MONA 2M48A 2JR6A 1QVGY 3LUSA 3BG1B 4NB9A 2JNYA 4NB8A 1S7MA 1VQ7Z 1N2FA 1M1K1 2PK7A 1YIT1 1YITZ 3S1RI 1Q861 3CXCZ 3I07A 1Q822 4A3DI 2P28A 3NDIA 5D1PA 2KI7B 3CC21 3EEDA 4MD7A 4E33A 3CC2Z 1YJW1 1RO2A 5D1OB 3I4NI 1YJWZ 3GTKI 1Z01A 3J7A4 1ZB8A 1R9TI 3M4OI 2V8IA 1JJ2Y 5A2Qb 3S14I 2QR1B 2PMZA 4A3MI 1QVGZ 1VQ91 1LQLA 1I50I 1VQ9Z 3HKZA 4A3KI 2NVTI 3FQQA 4A3EI 1ZH1A 4RS4A 5A2Qf 1Z02A 3G4S1 3CCM1 3G4SZ 2RHBA 1M901 1TWGI 3CME1 3CMEZ 3GCFA 3CCUZ 2E2HI 4NBGA 3CMA1 3GKQA 3PO3S 2YU9I 3CMAZ 5T67A 3ESWA 4RVGA 2V8JA 1YIJ1 4A3II 1YIJZ 5C3EI 4EWCA 2AKLA 4RVFA 2M6NA 1RNIA 3VTNA 2K3RA 1YHQ1 2VUMI 3KIHA 3FKII 2O4HA 1YHQZ 1JJ2Z 4MH4A 1W2BZ 1TWFI 4DGLA 1VQ41 4QTUA 1VQ4Z 3NH5A 1Z03A 1Q862 2F4OA 4QTTA 3I561 3G6EZ 3I56Z 3J81b 2H85A 1YUAA 3HOZI 1VQ61 3RZOI 2F4MA 1VQ6Z 2R92I 3HOYI 3S15I 1K83I 3D9XA 2OOXB 1NJI2 3P5JB 3GTJI 4A93I 3IFUA 3KIFA 3CCJ1 1YJN1 2QKDA 4A3FI 1N8R1 3CCJZ 1YJNZ 4E2WA 1KQSZ 4A3GI 1RLYA 5C4XI 2R6MA 1M902 1VQ71 2VF1A 3GTMI 3VMIA 2QLVB 3CCLZ 2RT9A 1VQP1 3GTOI 1L1OC 3M3YI 1VQPZ 2DE6A 2OTJ1 2NVYI 4BBRI 2OTJZ 2LFUA 2HU9A 4MD8A 3JAMb 1K9M1 4NBFA 1KC81 1NP6A 2R7ZI 3T4NB 4DK1A 3CCV1 3H0GI 3JAMf 3CCVZ 4MD9A 2K5RA 2O53A 2DE7A 1W2BY 1USPB 1YUKA 2RIQA 4E32A 1KRLA 3GTMS 1Q7Y1 4Y52I 2VUGA 2GU2A 3CCU1 2JS4A 3VMGA 1YI21 1TWHI 3HOUI 5FLXb 1YI2Z 1WW9A 4NOZA 3J80b 4HGZA 1K8A2 2G2KA 4NBCA 4X6AI 2BJOA 2QRDB 4E2XA 5FLXf 1I3QI 2Q51A 1TWCI 4NBHA 3CCQ1 3CCQZ 3J80f 3IF8A 5C44I 3CCR1 4BBSI 3CCRZ 2HF1A 5D1OA 2WB1A 1KQSY 1KD11 1Q821 1QYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 f;  3JAM b;  5FLX b;  3J7A 4;  5A2Q b;  5IT9 b;  3J81 b;  3J80 b; 
#chains in the Genus database with same CATH topology
 1M1K 2;  2JA6 I;  2QEX 1;  4HH4 A;  3S1N I;  2QEX Z;  4RV9 A;  3G6E 1;  3MZL B;  1TFI A;  2QRE B;  1WCM I;  2YAD A;  4XX2 A;  2E9H A;  3CC4 1;  3J81 f;  1RQF A;  3CC4 Z;  2ZAE B;  4BXX I;  4CL1 A;  1ZB9 A;  4A3C I;  3HOV I;  5CM2 M;  1TWA I;  3G71 1;  3G71 Z;  3S2H I;  1QVF Y;  4E30 A;  3CPW Y;  3NFZ A;  2E2I I;  2P3Y A;  3RZD I;  3IX0 A;  5IT9 b;  1I6H I;  1X0T A;  1AA6 A;  4NBD A;  3S17 I;  2VPW A;  3CCL 1;  1S72 1;  2JMO A;  2JIQ A;  2JIR A;  1S72 Z;  2E7Z A;  1Q16 A;  2B63 I;  2QA4 1;  3VMH A;  2V45 A;  4S1T A;  2QA4 Z;  5IT9 f;  2Y0S A;  1VQ5 Z;  2PM9 A;  3OW2 Y;  3QWU A;  2JIP A;  4AYB A;  5C4J I;  5AN9 F;  4A3J I;  3HOX I;  5LL6 f;  1VLA A;  2OOY B;  3NH4 A;  2V8K A;  3PO2 I;  1VQO 1;  1VQO Z;  2RPR A;  2W03 A;  1Q81 1;  1DL6 A;  1VQM 1;  2JA7 I;  1RO0 A;  1VQM Z;  4NBB A;  1VQN 1;  1Y1V I;  3GTP I;  1FDI A;  1KD1 2;  3PO3 I;  1VQN Z;  3VB9 A;  1QVF Z;  1VQL 1;  3CPW Z;  1VQL Z;  1SFO I;  3TE5 B;  1YJ9 1;  2EGT A;  3NH8 A;  3TDH B;  1YJ9 Z;  1K73 1;  2DE5 A;  1X3Z A;  3D6W A;  2LIY A;  1QF8 A;  3HOW I;  2OZK A;  3S1M I;  5FLM I;  3NDJ A;  3GTQ I;  3OW2 Z;  1NJI 1;  4E2Z A;  2W04 A;  4BY7 I;  5T6B A;  3F3P C;  3I55 1;  3GTG I;  3H3V J;  5IP9 I;  3I55 Z;  3Q87 A;  3U50 C;  3CCM Z;  1X3W A;  3K7A I;  1N8R 2;  3CCS 1;  4RVD A;  2NVX I;  2NVQ I;  3CCS Z;  1Y1V S;  2QRC B;  4NH1 C;  1NUI A;  5IP7 I;  4A3B I;  2IZ4 A;  3FQM A;  2R93 I;  3I4M I;  4NBA A;  4MXU A;  2E2J I;  4Y7N I;  2GTI A;  2I3C A;  2IZ3 A;  3S16 I;  2LEX A;  3CCE 1;  2GTH A;  2Q4Z A;  1Y8C A;  3CCE Z;  3GTL I;  4RVH A;  4NFR A;  1USP A;  3CD6 1;  3CD6 Z;  2RBL A;  2OTL 1;  3MZK B;  2OTL Z;  1K9M 2;  4NBE A;  1KC8 2;  2JUB A;  3MON A;  5T64 A;  1WII A;  3S1Q I;  1Q81 2;  4E2Y A;  2J6A A;  2KPI A;  3F3F C;  3EER A;  3CXC Y;  1P9N A;  2WAQ A;  1FDO A;  4E31 A;  4BY1 I;  1K73 2;  4MRI A;  1Q7Y 2;  1JWH C;  1K8A 1;  4DQY B;  1VQK 1;  4A3L I;  3CC7 1;  1VQ5 1;  1VQK Z;  2JA8 I;  4TNU A;  3CC7 Z;  1VQ8 1;  1ML8 A;  1RO4 A;  2JA5 I;  3CQZ I;  1VQ8 Z;  1PFT A;  3BG0 B;  4HGY A;  1Y1W I;  3S2D I;  4MON A;  2M48 A;  2JR6 A;  1QVG Y;  3LUS A;  3BG1 B;  4NB9 A;  2JNY A;  4NB8 A;  1S7M A;  1VQ7 Z;  1N2F A;  1M1K 1;  2PK7 A;  1YIT 1;  1YIT Z;  3S1R I;  1Q86 1;  2NAP A;  3CXC Z;  3I07 A;  1Q82 2;  4A3D I;  2P28 A;  3NDI A;  5D1P A;  2KI7 B;  3CC2 1;  3EED A;  4MD7 A;  4E33 A;  3CC2 Z;  1YJW 1;  1RO2 A;  5D1O B;  3I4N I;  1YJW Z;  3GTK I;  1Z01 A;  3J7A 4;  1ZB8 A;  1R9T I;  3M4O I;  2V8I A;  1JJ2 Y;  5A2Q b;  3S14 I;  2QR1 B;  2PMZ A;  4A3M I;  1QVG Z;  1VQ9 1;  2JIO A;  1LQL A;  1I50 I;  1VQ9 Z;  3HKZ A;  4A3K I;  2NVT I;  3FQQ A;  4A3E I;  1ZH1 A;  4RS4 A;  5A2Q f;  1Z02 A;  3G4S 1;  3CCM 1;  3G4S Z;  2RHB A;  1M90 1;  1TWG I;  3CME 1;  3CME Z;  3GCF A;  3CCU Z;  2E2H I;  4NBG A;  1WZN A;  3CMA 1;  3GKQ A;  3PO3 S;  2YU9 I;  3CMA Z;  5T67 A;  3ESW A;  4RVG A;  2V8J A;  1YIJ 1;  4A3I I;  1YIJ Z;  5C3E I;  4EWC A;  2AKL A;  4RVF A;  2M6N A;  1RNI A;  2V3V A;  3VTN A;  2K3R A;  1YHQ 1;  2VUM I;  3KIH A;  3FKI I;  2O4H A;  1YHQ Z;  1JJ2 Z;  4MH4 A;  1W2B Z;  1TWF I;  2JIM A;  4DGL A;  1VQ4 1;  4QTU A;  1VQ4 Z;  3NH5 A;  2AYD A;  1Z03 A;  1Q86 2;  2F4O A;  4QTT A;  3I56 1;  3G6E Z;  3I56 Z;  3J81 b;  2H85 A;  1YUA A;  3HOZ I;  1VQ6 1;  3RZO I;  2F4M A;  1VQ6 Z;  2R92 I;  3HOY I;  3S15 I;  1K83 I;  3D9X A;  2OOX B;  1NJI 2;  3P5J B;  3GTJ I;  4A93 I;  3IFU A;  3KIF A;  3CCJ 1;  1YJN 1;  2QKD A;  4A3F I;  1N8R 1;  3CCJ Z;  1YJN Z;  4E2W A;  2VPY A;  2IV2 X;  1KQS Z;  4A3G I;  1RLY A;  5C4X I;  2R6M A;  1M90 2;  1VQ7 1;  2VF1 A;  3GTM I;  3VMI A;  2QLV B;  3CCL Z;  2RT9 A;  1VQP 1;  3GTO I;  1L1O C;  3IR7 A;  3M3Y I;  1VQP Z;  2VPZ A;  2DE6 A;  3D2L A;  2OTJ 1;  2NVY I;  4BBR I;  2OTJ Z;  2LFU A;  2HU9 A;  4MD8 A;  3JAM b;  1K9M 1;  4NBF A;  1QXF A;  1KC8 1;  1NP6 A;  2R7Z I;  3T4N B;  1SIW A;  4DK1 A;  3CCV 1;  3H0G I;  3JAM f;  3CCV Z;  4MD9 A;  2K5R A;  2O53 A;  2DE7 A;  1W2B Y;  1USP B;  1YUK A;  2RIQ A;  4E32 A;  1KRL A;  3GTM S;  1Q7Y 1;  4Y52 I;  2VUG A;  2GU2 A;  3CCU 1;  2JS4 A;  3VMG A;  1YI2 1;  1TWH I;  3HOU I;  5FLX b;  1YI2 Z;  2VPX A;  1WW9 A;  4NOZ A;  3J80 b;  4HGZ A;  1K8A 2;  2G2K A;  4NBC A;  4X6A I;  2BJO A;  2QRD B;  4E2X A;  5FLX f;  1I3Q I;  2Q51 A;  1TWC I;  4NBH A;  3CCQ 1;  3CCQ Z;  3J80 f;  3IF8 A;  5C44 I;  3CCR 1;  4BBS I;  3CCR Z;  2HF1 A;  1WJ2 A;  5D1O A;  2WB1 A;  1KQS Y;  1KD1 1;  1Q82 1;  1QYP A; 
#chains in the Genus database with same CATH homology
 1M1K 2;  2JA6 I;  2QEX 1;  4HH4 A;  3S1N I;  2QEX Z;  4RV9 A;  3G6E 1;  3MZL B;  1TFI A;  2QRE B;  1WCM I;  2YAD A;  4XX2 A;  2E9H A;  3CC4 1;  3J81 f;  1RQF A;  3CC4 Z;  2ZAE B;  4BXX I;  4CL1 A;  1ZB9 A;  4A3C I;  3HOV I;  5CM2 M;  1TWA I;  3G71 1;  3G71 Z;  3S2H I;  1QVF Y;  4E30 A;  3CPW Y;  3NFZ A;  2E2I I;  2P3Y A;  3RZD I;  3IX0 A;  5IT9 b;  1I6H I;  1X0T A;  4NBD A;  3S17 I;  3CCL 1;  1S72 1;  2JMO A;  1S72 Z;  2B63 I;  2QA4 1;  3VMH A;  4S1T A;  2QA4 Z;  5IT9 f;  2Y0S A;  1VQ5 Z;  2PM9 A;  3OW2 Y;  3QWU A;  4AYB A;  5C4J I;  5AN9 F;  4A3J I;  3HOX I;  5LL6 f;  1VLA A;  2OOY B;  3NH4 A;  2V8K A;  3PO2 I;  1VQO 1;  1VQO Z;  2RPR A;  2W03 A;  1Q81 1;  1DL6 A;  1VQM 1;  2JA7 I;  1RO0 A;  1VQM Z;  4NBB A;  1VQN 1;  1Y1V I;  3GTP I;  1KD1 2;  3PO3 I;  1VQN Z;  3VB9 A;  1QVF Z;  1VQL 1;  3CPW Z;  1VQL Z;  1SFO I;  3TE5 B;  1YJ9 1;  2EGT A;  3NH8 A;  3TDH B;  1YJ9 Z;  1K73 1;  2DE5 A;  1X3Z A;  3D6W A;  2LIY A;  1QF8 A;  3HOW I;  2OZK A;  3S1M I;  5FLM I;  3NDJ A;  3GTQ I;  3OW2 Z;  1NJI 1;  4E2Z A;  2W04 A;  4BY7 I;  5T6B A;  3F3P C;  3I55 1;  3GTG I;  3H3V J;  5IP9 I;  3I55 Z;  3Q87 A;  3U50 C;  3CCM Z;  1X3W A;  3K7A I;  1N8R 2;  3CCS 1;  4RVD A;  2NVX I;  2NVQ I;  3CCS Z;  1Y1V S;  2QRC B;  4NH1 C;  1NUI A;  5IP7 I;  4A3B I;  2IZ4 A;  3FQM A;  2R93 I;  3I4M I;  4NBA A;  4MXU A;  2E2J I;  4Y7N I;  2GTI A;  2I3C A;  2IZ3 A;  3S16 I;  3CCE 1;  2GTH A;  2Q4Z A;  3GTL I;  3CCE Z;  4RVH A;  4NFR A;  1USP A;  3CD6 1;  3CD6 Z;  2RBL A;  2OTL 1;  3MZK B;  2OTL Z;  1K9M 2;  4NBE A;  1KC8 2;  2JUB A;  3MON A;  5T64 A;  1WII A;  3S1Q I;  1Q81 2;  4E2Y A;  2J6A A;  2KPI A;  3F3F C;  3EER A;  3CXC Y;  1P9N A;  2WAQ A;  4E31 A;  4BY1 I;  1K73 2;  4MRI A;  1Q7Y 2;  1JWH C;  1K8A 1;  4DQY B;  1VQK 1;  4A3L I;  3CC7 1;  1VQ5 1;  1VQK Z;  2JA8 I;  4TNU A;  3CC7 Z;  1VQ8 1;  1ML8 A;  1RO4 A;  2JA5 I;  3CQZ I;  1VQ8 Z;  1PFT A;  3BG0 B;  4HGY A;  1Y1W I;  3S2D I;  4MON A;  2M48 A;  2JR6 A;  1QVG Y;  3LUS A;  3BG1 B;  4NB9 A;  2JNY A;  4NB8 A;  1S7M A;  1VQ7 Z;  1N2F A;  1M1K 1;  2PK7 A;  1YIT 1;  1YIT Z;  3S1R I;  1Q86 1;  3CXC Z;  3I07 A;  1Q82 2;  4A3D I;  2P28 A;  3NDI A;  5D1P A;  2KI7 B;  3CC2 1;  3EED A;  4MD7 A;  4E33 A;  3CC2 Z;  1YJW 1;  1RO2 A;  5D1O B;  3I4N I;  1YJW Z;  3GTK I;  1Z01 A;  3J7A 4;  1ZB8 A;  1R9T I;  3M4O I;  2V8I A;  1JJ2 Y;  5A2Q b;  3S14 I;  2QR1 B;  2PMZ A;  4A3M I;  1QVG Z;  1VQ9 1;  1LQL A;  1I50 I;  1VQ9 Z;  3HKZ A;  4A3K I;  2NVT I;  3FQQ A;  4A3E I;  1ZH1 A;  4RS4 A;  5A2Q f;  1Z02 A;  3G4S 1;  3CCM 1;  3G4S Z;  2RHB A;  1M90 1;  1TWG I;  3CME 1;  3CME Z;  3GCF A;  3CCU Z;  2E2H I;  4NBG A;  3CMA 1;  3GKQ A;  3PO3 S;  2YU9 I;  3CMA Z;  5T67 A;  3ESW A;  4RVG A;  2V8J A;  1YIJ 1;  4A3I I;  1YIJ Z;  5C3E I;  4EWC A;  2AKL A;  4RVF A;  2M6N A;  1RNI A;  3VTN A;  2K3R A;  1YHQ 1;  2VUM I;  3KIH A;  3FKI I;  2O4H A;  1YHQ Z;  1JJ2 Z;  4MH4 A;  1W2B Z;  1TWF I;  4DGL A;  1VQ4 1;  4QTU A;  1VQ4 Z;  3NH5 A;  1Z03 A;  1Q86 2;  2F4O A;  4QTT A;  3I56 1;  3G6E Z;  3I56 Z;  3J81 b;  2H85 A;  1YUA A;  3HOZ I;  1VQ6 1;  3RZO I;  2F4M A;  1VQ6 Z;  2R92 I;  3HOY I;  3S15 I;  1K83 I;  3D9X A;  2OOX B;  1NJI 2;  3P5J B;  3GTJ I;  4A93 I;  3IFU A;  3KIF A;  3CCJ 1;  1YJN 1;  2QKD A;  4A3F I;  1N8R 1;  3CCJ Z;  1YJN Z;  4E2W A;  1KQS Z;  4A3G I;  1RLY A;  5C4X I;  2R6M A;  1M90 2;  1VQ7 1;  2VF1 A;  3GTM I;  3VMI A;  2QLV B;  3CCL Z;  2RT9 A;  1VQP 1;  3GTO I;  1L1O C;  3M3Y I;  1VQP Z;  2DE6 A;  2OTJ 1;  2NVY I;  4BBR I;  2OTJ Z;  2LFU A;  2HU9 A;  4MD8 A;  3JAM b;  1K9M 1;  4NBF A;  1KC8 1;  1NP6 A;  2R7Z I;  3T4N B;  4DK1 A;  3CCV 1;  3H0G I;  3JAM f;  3CCV Z;  4MD9 A;  2K5R A;  2O53 A;  2DE7 A;  1W2B Y;  1USP B;  1YUK A;  2RIQ A;  4E32 A;  1KRL A;  3GTM S;  1Q7Y 1;  4Y52 I;  2VUG A;  2GU2 A;  3CCU 1;  2JS4 A;  3VMG A;  1YI2 1;  1TWH I;  3HOU I;  5FLX b;  1YI2 Z;  1WW9 A;  4NOZ A;  3J80 b;  4HGZ A;  1K8A 2;  2G2K A;  4NBC A;  4X6A I;  2BJO A;  2QRD B;  4E2X A;  5FLX f;  1I3Q I;  2Q51 A;  1TWC I;  4NBH A;  3CCQ 1;  3CCQ Z;  3J80 f;  3IF8 A;  5C44 I;  3CCR 1;  4BBS I;  3CCR Z;  2HF1 A;  5D1O A;  2WB1 A;  1KQS Y;  1KD1 1;  1Q82 1;  1QYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...