5FLXb

Mammalian 40s hcv-ires complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
80
structure length
80
Chain Sequence
b'AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 4
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5flxb00
5A2Qb 5IT9b 3J7A4 3J80b 3J81b 5LL6f 3JAMb 5FLXb
chains in the Genus database with same CATH superfamily
4RS4A 1K9M2 2QEX1 2R93I 3LUSA 3J80f 2QRCB 3CXCY 3CXCZ 1RO2A 2JIQA 2JA8I 3FQMA 4E33A 3CCSZ 1YUKA 3G6EZ 1VQ4Z 2JA5I 5LL6f 4BBSI 3PO3S 3IX0A 2B63I 4RVDA 1VQ81 2E2II 1N8R1 4NFRA 1YHQZ 4A93I 1N8R2 2NVQI 1ZB8A 4RV9A 3CCS1 2JA7I 4Y52I 2R7ZI 3G6E1 3CC4Z 3CCU1 3HOZI 3FQQA 3KIFA 1VQ41 3CCVZ 1TWAI 3VB9A 3HOYI 3H0GI 2LIYA 2DE6A 4NBFA 5C3EI 1YHQ1 3K7AI 1DL6A 4QTTA 5A2Qf 1KQSY 1X3WA 1QYPA 3CC41 4A3JI 1SIWA 4HH4A 1RO4A 1K8A1 3CC2Z 1K8A2 4NBAA 4A3EI 2VPZA 2QLVB 3I4NI 1Z02A 3MZKB 4HGYA 3CCMZ 2JIRA 2QREB 3S15I 2NVTI 3CCRZ 4A3DI 5IT9b 4QTUA 2JS4A 4NBEA 5IP7I 2HF1A 4A3BI 4X6AI 5FLXb 1VQMZ 4E30A 4MD9A 2Q4ZA 2R92I 4NBHA 1RNIA 3CCM1 4MXUA 1USPA 2IV2X 1M901 1Q861 3CCQZ 3CCR1 4EWCA 2JNYA 1M902 3CQZI 1Q862 2P28A 2YU9I 2OTJZ 2JR6A 1WW9A 1VQM1 1QVFY 1QVFZ 3FKII 1FDOA 2VUMI 1TWGI 1Q821 3CC7Z 1Y1WI 4E32A 5D1OB 3S17I 4HGZA 2OTJ1 2M6NA 1YJWZ 3KIHA 2GTIA 5C4JI 3PO2I 3J81b 3Q87A 1S72Z 3MZLB 3CC71 1JWHC 1JJ2Y 1JJ2Z 1VQKZ 3G4SZ 3CPWZ 1K83I 3CPWY 2E2HI 1X0TA 1YUAA 3GTLI 1WJ2A 5T67A 4NBCA 4MH4A 1S721 3I55Z 3GKQA 2QA41 2BJOA 2VPXA 1K9M1 1Y1VI 1VQK1 1VQPZ 3G4S1 5T64A 3CCJ1 2JIMA 4MD8A 2RT9A 1VQLZ 3PO3I 1QVGY 1QVGZ 4NBDA 5CM2M 1Y1VS 2GTHA 2JIPA 1VQN1 4NH1C 3S1MI 3G71Z 2RPRA 1VQ7Z 1VQP1 2QKDA 1YJNZ 3I4MI 1YIJZ 3HOXI 2EGTA 1VQL1 1VQ6Z 4DGLA 3S1RI 1YITZ 3HOWI 4A3KI 1VLAA 1VQ5Z 1TWCI 5IT9f 2AKLA 1VQ71 2W03A 1YIJ1 2E7ZA 1VQ61 1Y8CA 1YIT1 2I3CA 2R6MA 3CD6Z 3BG1B 4BBRI 4NBGA 3T4NB 5FLMI 3VMGA 3CCV1 1I6HI 2OTLZ 2E9HA 1VQ9Z 1L1OC 1YJ9Z 1LQLA 4XX2A 2K3RA 3BG0B 3VMIA 3HOVI 4NB8A 1Q812 3CCEZ 2J6AA 2JIOA 3CC21 4MD7A 2QRDB 3S16I 1Z03A 3IR7A 1I3QI 3S14I 4BXXI 2F4OA 4CL1A 4E31A 1NJI2 3NH5A 2V8JA 2RIQA 3F3PC 4E2YA 3GTJI 2NVXI 2PMZA 4MONA 1KD12 4NBBA 3QWUA 1RQFA 4NB9A 3GTOI 3CCQ1 2VF1A 3EEDA 2GU2A 3I56Z 4A3CI 3S1NI 1Q7Y1 1KRLA 4Y7NI 2QR1B 3JAMb 3OW2Z 1Q7Y2 1PFTA 5IP9I 3GTQI 3IF8A 1RLYA 2RHBA 3I561 3S2DI 3D6WA 1YJW1 1I50I 2V3VA 3EERA 2AYDA 4A3LI 1NP6A 3VMHA 4MRIA 1QF8A 2JUBA 3J7A4 1X3ZA 4A3MI 2V8KA 3MONA 1WCMI 3GTPI 2WB1A 3I551 2LEXA 1ZH1A 3S1QI 3GTKI 1Q16A 2OOYB 5C44I 2IZ3A 2PK7A 3VTNA 4TNUA 2DE7A 4E2WA 1VQ8Z 2Y0SA 3G711 2M48A 4RVFA 3U50C 1YJN1 4S1TA 3CCUZ 1P9NA 1N2FA 1TWFI 1WZNA 5D1PA 5FLXf 2W04A 2H85A 4AYBA 3HOUI 3M3YI 3GTGI 1ZB9A 4DQYB 2VPYA 3GTMI 2OOXB 1VQ51 3TE5B 2NVYI 2KPIA 3D2LA 4A3GI 1NUIA 3GTMS 3IFUA 3J80b 2JA6I 1Z01A 2VUGA 1YI2Z 3CD61 1Q811 4E2ZA 3H3VJ 3CMAZ 2P3YA 1KQSZ 5AN9F 4DK1A 2E2JI 1USPB 2OTL1 1K731 1VQ91 1KC81 1YJ91 1K732 3JAMf 3I07A 1KC82 3J81f 4BY7I 2KI7B 1YI21 1NJI1 3CCE1 3CMEZ 3CMA1 1RO0A 2OZKA 1KD11 3NFZA 3CCLZ 3CME1 2YADA 5A2Qb 2F4MA 2LFUA 3D9XA 3NH8A 3NDIA 3NDJA 2K5RA 2DE5A 4E2XA 3OW2Y 2VPWA 3CCL1 3NH4A 2Q51A 4A3II 2ZAEB 2O53A 1WIIA 3RZDI 4NOZA 1Q822 1ML8A 3GCFA 1VQOZ 2V8IA 1FDIA 3HKZA 5C4XI 3TDHB 1TFIA 1TWHI 4BY1I 1R9TI 1S7MA 2JMOA 3M4OI 3ESWA 5D1OA 2WAQA 4RVGA 1SFOI 2PM9A 4RVHA 1QXFA 2QA4Z 1VQO1 1M1K1 2QEXZ 1M1K2 3CCJZ 1W2BY 1W2BZ 2V45A 5T6BA 2RBLA 1AA6A 2O4HA 3S2HI 2HU9A 4A3FI 1VQNZ 3P5JB 3F3FC 2IZ4A 3RZOI 2NAPA 2G2KA
chains in the Genus database with same CATH topology
4RS4A 1K9M2 2QEX1 2R93I 3LUSA 3J80f 2QRCB 3CXCY 3CXCZ 1RO2A 2JA8I 3FQMA 4E33A 3CCSZ 1YUKA 3G6EZ 1VQ4Z 2JA5I 5LL6f 4BBSI 3PO3S 3IX0A 2B63I 4RVDA 1VQ81 2E2II 1N8R1 4NFRA 1YHQZ 4A93I 1N8R2 2NVQI 1ZB8A 4RV9A 3CCS1 2JA7I 4Y52I 2R7ZI 3G6E1 3CC4Z 3CCU1 3HOZI 3FQQA 3KIFA 1VQ41 3CCVZ 1TWAI 3VB9A 3HOYI 3H0GI 2LIYA 2DE6A 4NBFA 5C3EI 1YHQ1 3K7AI 1DL6A 4QTTA 5A2Qf 1KQSY 1X3WA 1QYPA 3CC41 4A3JI 4HH4A 1RO4A 1K8A1 3CC2Z 1K8A2 4NBAA 4A3EI 2QLVB 3I4NI 1Z02A 3MZKB 4HGYA 3CCMZ 2QREB 3S15I 2NVTI 3CCRZ 4A3DI 5IT9b 4QTUA 2JS4A 4NBEA 5IP7I 2HF1A 4A3BI 4X6AI 5FLXb 1VQMZ 4E30A 4MD9A 2Q4ZA 2R92I 4NBHA 1RNIA 3CCM1 4MXUA 1USPA 1M901 1Q861 3CCQZ 3CCR1 4EWCA 2JNYA 1M902 3CQZI 1Q862 2P28A 2YU9I 2OTJZ 2JR6A 1WW9A 1VQM1 1QVFY 1QVFZ 3FKII 2VUMI 1TWGI 1Q821 3CC7Z 1Y1WI 4E32A 5D1OB 3S17I 4HGZA 2OTJ1 2M6NA 1YJWZ 3KIHA 2GTIA 5C4JI 3PO2I 3J81b 3Q87A 1S72Z 3MZLB 3CC71 1JWHC 1JJ2Y 1JJ2Z 1VQKZ 3G4SZ 3CPWZ 1K83I 3CPWY 2E2HI 1X0TA 1YUAA 3GTLI 5T67A 4NBCA 4MH4A 1S721 3I55Z 3GKQA 2QA41 2BJOA 1K9M1 1Y1VI 1VQK1 1VQPZ 3G4S1 5T64A 3CCJ1 4MD8A 2RT9A 1VQLZ 3PO3I 1QVGY 1QVGZ 4NBDA 5CM2M 1Y1VS 2GTHA 1VQN1 4NH1C 3S1MI 3G71Z 2RPRA 1VQ7Z 1VQP1 2QKDA 1YJNZ 3I4MI 1YIJZ 3HOXI 2EGTA 1VQL1 1VQ6Z 4DGLA 3S1RI 1YITZ 3HOWI 4A3KI 1VLAA 1VQ5Z 1TWCI 5IT9f 2AKLA 1VQ71 2W03A 1YIJ1 1VQ61 1YIT1 2I3CA 2R6MA 3CD6Z 3BG1B 4BBRI 4NBGA 3T4NB 5FLMI 3VMGA 3CCV1 1I6HI 2OTLZ 2E9HA 1VQ9Z 1L1OC 1YJ9Z 1LQLA 4XX2A 2K3RA 3BG0B 3VMIA 3HOVI 4NB8A 1Q812 3CCEZ 2J6AA 3CC21 4MD7A 2QRDB 3S16I 1Z03A 1I3QI 3S14I 4BXXI 2F4OA 4CL1A 4E31A 1NJI2 3NH5A 2V8JA 2RIQA 3F3PC 4E2YA 3GTJI 2NVXI 2PMZA 4MONA 1KD12 4NBBA 3QWUA 1RQFA 4NB9A 3GTOI 3CCQ1 2VF1A 3EEDA 2GU2A 3I56Z 4A3CI 3S1NI 1Q7Y1 1KRLA 4Y7NI 2QR1B 3JAMb 3OW2Z 1Q7Y2 1PFTA 5IP9I 3GTQI 3IF8A 1RLYA 2RHBA 3I561 3S2DI 3D6WA 1YJW1 1I50I 3EERA 4A3LI 1NP6A 3VMHA 4MRIA 1QF8A 2JUBA 3J7A4 1X3ZA 4A3MI 2V8KA 3MONA 1WCMI 3GTPI 2WB1A 3I551 1ZH1A 3S1QI 3GTKI 2OOYB 5C44I 2IZ3A 2PK7A 3VTNA 4TNUA 2DE7A 4E2WA 1VQ8Z 2Y0SA 3G711 2M48A 4RVFA 3U50C 1YJN1 4S1TA 3CCUZ 1P9NA 1N2FA 1TWFI 5D1PA 5FLXf 2W04A 2H85A 4AYBA 3HOUI 3M3YI 3GTGI 1ZB9A 4DQYB 3GTMI 2OOXB 1VQ51 3TE5B 2NVYI 2KPIA 4A3GI 1NUIA 3GTMS 3IFUA 3J80b 2JA6I 1Z01A 2VUGA 1YI2Z 3CD61 1Q811 4E2ZA 3H3VJ 3CMAZ 2P3YA 1KQSZ 5AN9F 4DK1A 2E2JI 1USPB 2OTL1 1K731 1VQ91 1KC81 1YJ91 1K732 3JAMf 3I07A 1KC82 3J81f 4BY7I 2KI7B 1YI21 1NJI1 3CCE1 3CMEZ 3CMA1 1RO0A 2OZKA 1KD11 3NFZA 3CCLZ 3CME1 2YADA 5A2Qb 2F4MA 2LFUA 3D9XA 3NH8A 3NDIA 3NDJA 2K5RA 2DE5A 4E2XA 3OW2Y 3CCL1 3NH4A 2Q51A 4A3II 2ZAEB 2O53A 1WIIA 3RZDI 4NOZA 1Q822 1ML8A 3GCFA 1VQOZ 2V8IA 3HKZA 5C4XI 3TDHB 1TFIA 1TWHI 4BY1I 1R9TI 1S7MA 2JMOA 3M4OI 3ESWA 5D1OA 2WAQA 4RVGA 1SFOI 2PM9A 4RVHA 2QA4Z 1VQO1 1M1K1 2QEXZ 1M1K2 3CCJZ 1W2BY 1W2BZ 5T6BA 2RBLA 2O4HA 3S2HI 2HU9A 4A3FI 1VQNZ 3P5JB 3F3FC 2IZ4A 3RZOI 2G2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q b;  5IT9 b;  3J7A 4;  3J80 b;  3J81 b;  5LL6 f;  3JAM b;  5FLX b; 
#chains in the Genus database with same CATH topology
 4RS4 A;  1K9M 2;  2QEX 1;  2R93 I;  3LUS A;  3J80 f;  2QRC B;  3CXC Y;  3CXC Z;  1RO2 A;  2JIQ A;  2JA8 I;  3FQM A;  4E33 A;  3CCS Z;  1YUK A;  3G6E Z;  1VQ4 Z;  2JA5 I;  5LL6 f;  4BBS I;  3PO3 S;  3IX0 A;  2B63 I;  4RVD A;  1VQ8 1;  2E2I I;  1N8R 1;  4NFR A;  1YHQ Z;  4A93 I;  1N8R 2;  2NVQ I;  1ZB8 A;  4RV9 A;  3CCS 1;  2JA7 I;  4Y52 I;  2R7Z I;  3G6E 1;  3CC4 Z;  3CCU 1;  3HOZ I;  3FQQ A;  3KIF A;  1VQ4 1;  3CCV Z;  1TWA I;  3VB9 A;  3HOY I;  3H0G I;  2LIY A;  2DE6 A;  4NBF A;  5C3E I;  1YHQ 1;  3K7A I;  1DL6 A;  4QTT A;  5A2Q f;  1KQS Y;  1X3W A;  1QYP A;  3CC4 1;  4A3J I;  1SIW A;  4HH4 A;  1RO4 A;  1K8A 1;  3CC2 Z;  1K8A 2;  4NBA A;  4A3E I;  2VPZ A;  2QLV B;  3I4N I;  1Z02 A;  3MZK B;  4HGY A;  3CCM Z;  2JIR A;  2QRE B;  3S15 I;  2NVT I;  3CCR Z;  4A3D I;  5IT9 b;  4QTU A;  2JS4 A;  4NBE A;  5IP7 I;  2HF1 A;  4A3B I;  4X6A I;  5FLX b;  1VQM Z;  4E30 A;  4MD9 A;  2Q4Z A;  2R92 I;  4NBH A;  1RNI A;  3CCM 1;  4MXU A;  1USP A;  2IV2 X;  1M90 1;  1Q86 1;  3CCQ Z;  3CCR 1;  4EWC A;  2JNY A;  1M90 2;  3CQZ I;  1Q86 2;  2P28 A;  2YU9 I;  2OTJ Z;  2JR6 A;  1WW9 A;  1VQM 1;  1QVF Y;  1QVF Z;  3FKI I;  1FDO A;  2VUM I;  1TWG I;  1Q82 1;  3CC7 Z;  1Y1W I;  4E32 A;  5D1O B;  3S17 I;  4HGZ A;  2OTJ 1;  2M6N A;  1YJW Z;  3KIH A;  2GTI A;  5C4J I;  3PO2 I;  3J81 b;  3Q87 A;  1S72 Z;  3MZL B;  3CC7 1;  1JWH C;  1JJ2 Y;  1JJ2 Z;  1VQK Z;  3G4S Z;  3CPW Z;  1K83 I;  3CPW Y;  2E2H I;  1X0T A;  1YUA A;  3GTL I;  1WJ2 A;  5T67 A;  4NBC A;  4MH4 A;  1S72 1;  3I55 Z;  3GKQ A;  2QA4 1;  2BJO A;  2VPX A;  1K9M 1;  1Y1V I;  1VQK 1;  1VQP Z;  3G4S 1;  5T64 A;  3CCJ 1;  2JIM A;  4MD8 A;  2RT9 A;  1VQL Z;  3PO3 I;  1QVG Y;  1QVG Z;  4NBD A;  5CM2 M;  1Y1V S;  2GTH A;  2JIP A;  1VQN 1;  4NH1 C;  3S1M I;  3G71 Z;  2RPR A;  1VQ7 Z;  1VQP 1;  2QKD A;  1YJN Z;  3I4M I;  1YIJ Z;  3HOX I;  2EGT A;  1VQL 1;  1VQ6 Z;  4DGL A;  3S1R I;  1YIT Z;  3HOW I;  4A3K I;  1VLA A;  1VQ5 Z;  1TWC I;  5IT9 f;  2AKL A;  1VQ7 1;  2W03 A;  1YIJ 1;  2E7Z A;  1VQ6 1;  1Y8C A;  1YIT 1;  2I3C A;  2R6M A;  3CD6 Z;  3BG1 B;  4BBR I;  4NBG A;  3T4N B;  5FLM I;  3VMG A;  3CCV 1;  1I6H I;  2OTL Z;  2E9H A;  1VQ9 Z;  1L1O C;  1YJ9 Z;  1LQL A;  4XX2 A;  2K3R A;  3BG0 B;  3VMI A;  3HOV I;  4NB8 A;  1Q81 2;  3CCE Z;  2J6A A;  2JIO A;  3CC2 1;  4MD7 A;  2QRD B;  3S16 I;  1Z03 A;  3IR7 A;  1I3Q I;  3S14 I;  4BXX I;  2F4O A;  4CL1 A;  4E31 A;  1NJI 2;  3NH5 A;  2V8J A;  2RIQ A;  3F3P C;  4E2Y A;  3GTJ I;  2NVX I;  2PMZ A;  4MON A;  1KD1 2;  4NBB A;  3QWU A;  1RQF A;  4NB9 A;  3GTO I;  3CCQ 1;  2VF1 A;  3EED A;  2GU2 A;  3I56 Z;  4A3C I;  3S1N I;  1Q7Y 1;  1KRL A;  4Y7N I;  2QR1 B;  3JAM b;  3OW2 Z;  1Q7Y 2;  1PFT A;  5IP9 I;  3GTQ I;  3IF8 A;  1RLY A;  2RHB A;  3I56 1;  3S2D I;  3D6W A;  1YJW 1;  1I50 I;  2V3V A;  3EER A;  2AYD A;  4A3L I;  1NP6 A;  3VMH A;  4MRI A;  1QF8 A;  2JUB A;  3J7A 4;  1X3Z A;  4A3M I;  2V8K A;  3MON A;  1WCM I;  3GTP I;  2WB1 A;  3I55 1;  2LEX A;  1ZH1 A;  3S1Q I;  3GTK I;  1Q16 A;  2OOY B;  5C44 I;  2IZ3 A;  2PK7 A;  3VTN A;  4TNU A;  2DE7 A;  4E2W A;  1VQ8 Z;  2Y0S A;  3G71 1;  2M48 A;  4RVF A;  3U50 C;  1YJN 1;  4S1T A;  3CCU Z;  1P9N A;  1N2F A;  1TWF I;  1WZN A;  5D1P A;  5FLX f;  2W04 A;  2H85 A;  4AYB A;  3HOU I;  3M3Y I;  3GTG I;  1ZB9 A;  4DQY B;  2VPY A;  3GTM I;  2OOX B;  1VQ5 1;  3TE5 B;  2NVY I;  2KPI A;  3D2L A;  4A3G I;  1NUI A;  3GTM S;  3IFU A;  3J80 b;  2JA6 I;  1Z01 A;  2VUG A;  1YI2 Z;  3CD6 1;  1Q81 1;  4E2Z A;  3H3V J;  3CMA Z;  2P3Y A;  1KQS Z;  5AN9 F;  4DK1 A;  2E2J I;  1USP B;  2OTL 1;  1K73 1;  1VQ9 1;  1KC8 1;  1YJ9 1;  1K73 2;  3JAM f;  3I07 A;  1KC8 2;  3J81 f;  4BY7 I;  2KI7 B;  1YI2 1;  1NJI 1;  3CCE 1;  3CME Z;  3CMA 1;  1RO0 A;  2OZK A;  1KD1 1;  3NFZ A;  3CCL Z;  3CME 1;  2YAD A;  5A2Q b;  2F4M A;  2LFU A;  3D9X A;  3NH8 A;  3NDI A;  3NDJ A;  2K5R A;  2DE5 A;  4E2X A;  3OW2 Y;  2VPW A;  3CCL 1;  3NH4 A;  2Q51 A;  4A3I I;  2ZAE B;  2O53 A;  1WII A;  3RZD I;  4NOZ A;  1Q82 2;  1ML8 A;  3GCF A;  1VQO Z;  2V8I A;  1FDI A;  3HKZ A;  5C4X I;  3TDH B;  1TFI A;  1TWH I;  4BY1 I;  1R9T I;  1S7M A;  2JMO A;  3M4O I;  3ESW A;  5D1O A;  2WAQ A;  4RVG A;  1SFO I;  2PM9 A;  4RVH A;  1QXF A;  2QA4 Z;  1VQO 1;  1M1K 1;  2QEX Z;  1M1K 2;  3CCJ Z;  1W2B Y;  1W2B Z;  2V45 A;  5T6B A;  2RBL A;  1AA6 A;  2O4H A;  3S2H I;  2HU9 A;  4A3F I;  1VQN Z;  3P5J B;  3F3F C;  2IZ4 A;  3RZO I;  2NAP A;  2G2K A; 
#chains in the Genus database with same CATH homology
 4RS4 A;  1K9M 2;  2QEX 1;  2R93 I;  3LUS A;  3J80 f;  2QRC B;  3CXC Y;  3CXC Z;  1RO2 A;  2JA8 I;  3FQM A;  4E33 A;  3CCS Z;  1YUK A;  3G6E Z;  1VQ4 Z;  2JA5 I;  5LL6 f;  4BBS I;  3PO3 S;  3IX0 A;  2B63 I;  4RVD A;  1VQ8 1;  2E2I I;  1N8R 1;  4NFR A;  1YHQ Z;  4A93 I;  1N8R 2;  2NVQ I;  1ZB8 A;  4RV9 A;  3CCS 1;  2JA7 I;  4Y52 I;  2R7Z I;  3G6E 1;  3CC4 Z;  3CCU 1;  3HOZ I;  3FQQ A;  3KIF A;  1VQ4 1;  3CCV Z;  1TWA I;  3VB9 A;  3HOY I;  3H0G I;  2LIY A;  2DE6 A;  4NBF A;  5C3E I;  1YHQ 1;  3K7A I;  1DL6 A;  4QTT A;  5A2Q f;  1KQS Y;  1X3W A;  1QYP A;  3CC4 1;  4A3J I;  4HH4 A;  1RO4 A;  1K8A 1;  3CC2 Z;  1K8A 2;  4NBA A;  4A3E I;  2QLV B;  3I4N I;  1Z02 A;  3MZK B;  4HGY A;  3CCM Z;  2QRE B;  3S15 I;  2NVT I;  3CCR Z;  4A3D I;  5IT9 b;  4QTU A;  2JS4 A;  4NBE A;  5IP7 I;  2HF1 A;  4A3B I;  4X6A I;  5FLX b;  1VQM Z;  4E30 A;  4MD9 A;  2Q4Z A;  2R92 I;  4NBH A;  1RNI A;  3CCM 1;  4MXU A;  1USP A;  1M90 1;  1Q86 1;  3CCQ Z;  3CCR 1;  4EWC A;  2JNY A;  1M90 2;  3CQZ I;  1Q86 2;  2P28 A;  2YU9 I;  2OTJ Z;  2JR6 A;  1WW9 A;  1VQM 1;  1QVF Y;  1QVF Z;  3FKI I;  2VUM I;  1TWG I;  1Q82 1;  3CC7 Z;  1Y1W I;  4E32 A;  5D1O B;  3S17 I;  4HGZ A;  2OTJ 1;  2M6N A;  1YJW Z;  3KIH A;  2GTI A;  5C4J I;  3PO2 I;  3J81 b;  3Q87 A;  1S72 Z;  3MZL B;  3CC7 1;  1JWH C;  1JJ2 Y;  1JJ2 Z;  1VQK Z;  3G4S Z;  3CPW Z;  1K83 I;  3CPW Y;  2E2H I;  1X0T A;  1YUA A;  3GTL I;  5T67 A;  4NBC A;  4MH4 A;  1S72 1;  3I55 Z;  3GKQ A;  2QA4 1;  2BJO A;  1K9M 1;  1Y1V I;  1VQK 1;  1VQP Z;  3G4S 1;  5T64 A;  3CCJ 1;  4MD8 A;  2RT9 A;  1VQL Z;  3PO3 I;  1QVG Y;  1QVG Z;  4NBD A;  5CM2 M;  1Y1V S;  2GTH A;  1VQN 1;  4NH1 C;  3S1M I;  3G71 Z;  2RPR A;  1VQ7 Z;  1VQP 1;  2QKD A;  1YJN Z;  3I4M I;  1YIJ Z;  3HOX I;  2EGT A;  1VQL 1;  1VQ6 Z;  4DGL A;  3S1R I;  1YIT Z;  3HOW I;  4A3K I;  1VLA A;  1VQ5 Z;  1TWC I;  5IT9 f;  2AKL A;  1VQ7 1;  2W03 A;  1YIJ 1;  1VQ6 1;  1YIT 1;  2I3C A;  2R6M A;  3CD6 Z;  3BG1 B;  4BBR I;  4NBG A;  3T4N B;  5FLM I;  3VMG A;  3CCV 1;  1I6H I;  2OTL Z;  2E9H A;  1VQ9 Z;  1L1O C;  1YJ9 Z;  1LQL A;  4XX2 A;  2K3R A;  3BG0 B;  3VMI A;  3HOV I;  4NB8 A;  1Q81 2;  3CCE Z;  2J6A A;  3CC2 1;  4MD7 A;  2QRD B;  3S16 I;  1Z03 A;  1I3Q I;  3S14 I;  4BXX I;  2F4O A;  4CL1 A;  4E31 A;  1NJI 2;  3NH5 A;  2V8J A;  2RIQ A;  3F3P C;  4E2Y A;  3GTJ I;  2NVX I;  2PMZ A;  4MON A;  1KD1 2;  4NBB A;  3QWU A;  1RQF A;  4NB9 A;  3GTO I;  3CCQ 1;  2VF1 A;  3EED A;  2GU2 A;  3I56 Z;  4A3C I;  3S1N I;  1Q7Y 1;  1KRL A;  4Y7N I;  2QR1 B;  3JAM b;  3OW2 Z;  1Q7Y 2;  1PFT A;  5IP9 I;  3GTQ I;  3IF8 A;  1RLY A;  2RHB A;  3I56 1;  3S2D I;  3D6W A;  1YJW 1;  1I50 I;  3EER A;  4A3L I;  1NP6 A;  3VMH A;  4MRI A;  1QF8 A;  2JUB A;  3J7A 4;  1X3Z A;  4A3M I;  2V8K A;  3MON A;  1WCM I;  3GTP I;  2WB1 A;  3I55 1;  1ZH1 A;  3S1Q I;  3GTK I;  2OOY B;  5C44 I;  2IZ3 A;  2PK7 A;  3VTN A;  4TNU A;  2DE7 A;  4E2W A;  1VQ8 Z;  2Y0S A;  3G71 1;  2M48 A;  4RVF A;  3U50 C;  1YJN 1;  4S1T A;  3CCU Z;  1P9N A;  1N2F A;  1TWF I;  5D1P A;  5FLX f;  2W04 A;  2H85 A;  4AYB A;  3HOU I;  3M3Y I;  3GTG I;  1ZB9 A;  4DQY B;  3GTM I;  2OOX B;  1VQ5 1;  3TE5 B;  2NVY I;  2KPI A;  4A3G I;  1NUI A;  3GTM S;  3IFU A;  3J80 b;  2JA6 I;  1Z01 A;  2VUG A;  1YI2 Z;  3CD6 1;  1Q81 1;  4E2Z A;  3H3V J;  3CMA Z;  2P3Y A;  1KQS Z;  5AN9 F;  4DK1 A;  2E2J I;  1USP B;  2OTL 1;  1K73 1;  1VQ9 1;  1KC8 1;  1YJ9 1;  1K73 2;  3JAM f;  3I07 A;  1KC8 2;  3J81 f;  4BY7 I;  2KI7 B;  1YI2 1;  1NJI 1;  3CCE 1;  3CME Z;  3CMA 1;  1RO0 A;  2OZK A;  1KD1 1;  3NFZ A;  3CCL Z;  3CME 1;  2YAD A;  5A2Q b;  2F4M A;  2LFU A;  3D9X A;  3NH8 A;  3NDI A;  3NDJ A;  2K5R A;  2DE5 A;  4E2X A;  3OW2 Y;  3CCL 1;  3NH4 A;  2Q51 A;  4A3I I;  2ZAE B;  2O53 A;  1WII A;  3RZD I;  4NOZ A;  1Q82 2;  1ML8 A;  3GCF A;  1VQO Z;  2V8I A;  3HKZ A;  5C4X I;  3TDH B;  1TFI A;  1TWH I;  4BY1 I;  1R9T I;  1S7M A;  2JMO A;  3M4O I;  3ESW A;  5D1O A;  2WAQ A;  4RVG A;  1SFO I;  2PM9 A;  4RVH A;  2QA4 Z;  1VQO 1;  1M1K 1;  2QEX Z;  1M1K 2;  3CCJ Z;  1W2B Y;  1W2B Z;  5T6B A;  2RBL A;  2O4H A;  3S2H I;  2HU9 A;  4A3F I;  1VQN Z;  3P5J B;  3F3F C;  2IZ4 A;  3RZO I;  2G2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...