3CME1

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cme100
3I561 3CPWZ 3G6EZ 1YIT1 1VQ81 1K9M2 3CD61 1Q862 1NJI2 1JJ2Y 1Q821 1KD12 3CCL1 1VQ4Z 3I56Z 3CCS1 1JJ2Z 2OTJ1 1YJW1 1YITZ 1VQ8Z 1KC82 3CMA1 1K732 3CD6Z 1S721 1YJN1 1M902 1K8A2 3CC71 3CCLZ 3CCSZ 1M1K2 1VQ91 3CCE1 2OTL1 2OTJZ 1YJWZ 1N8R1 1VQ51 3CCJ1 3CMAZ 1W2BY 1S72Z 1YJNZ 1VQK1 2QEX1 1W2BZ 3CC7Z 1Q7Y2 1K9M1 1QVFY 1Q861 1VQ9Z 3CCEZ 1NJI1 1KQSY 2OTLZ 3CXCY 1YJ91 1VQ5Z 1KD11 3CCJZ 1VQ61 3CME1 1KQSZ 3CXCZ 1YI21 1VQKZ 2QEXZ 1VQP1 1VQN1 3I551 3CCU1 1Q812 1KC81 1K731 3G4S1 3CCQ1 3CCV1 1YJ9Z 1YHQ1 1VQ6Z 3CMEZ 2QA41 1YI2Z 3CC21 1VQPZ 1VQO1 1YIJ1 1VQNZ 3I55Z 3CCUZ 3G4SZ 3G711 3CCQZ 3CCVZ 1QVFZ 1Q822 1YHQZ 1Q7Y1 2QA4Z 1VQL1 3CC2Z 1VQOZ 3CC41 1YIJZ 1VQM1 1QVGY 1VQ71 3OW2Y 3CCR1 3G71Z 3CCM1 1M901 1K8A1 1QVGZ 3OW2Z 3G6E1 1Q811 1VQLZ 1M1K1 3CPWY 3CC4Z 1N8R2 1VQMZ 1VQ7Z 3CCRZ 3CCMZ 1VQ41
chains in the Genus database with same CATH superfamily
3I561 2P3YA 3IX0A 1YIT1 4E30A 3I4MI 2AKLA 3IR7A 3FQMA 1RO0A 3CCL1 1VQ4Z 1Y8CA 2E7ZA 1WJ2A 1X0TA 2OTJ1 2LIYA 2NVTI 1USPA 2OOXB 1TWAI 2DE7A 4RVHA 1QF8A 2M6NA 3KIFA 1I6HI 1VLAA 1TFIA 1SIWA 3GKQA 1VQ91 3CCE1 5T6BA 4A3GI 3T4NB 2M48A 1ZB8A 4AYBA 4E33A 4E2WA 2RBLA 2QLVB 5IP7I 2GTIA 4NB8A 4MRIA 1YJ91 4MXUA 2NVYI 2NVXI 3TE5B 4E2YA 3HOXI 3K7AI 1VQKZ 3D6WA 4Y52I 1VQN1 3GCFA 3I551 1KC81 2V45A 1N2FA 4MD9A 3U50C 2E9HA 4HGZA 4E2ZA 1YHQ1 5FLMI 4A93I 2RT9A 5A2Qb 1QYPA 4HGYA 4RVDA 3G711 3CCVZ 4RV9A 4A3LI 5IT9f 1DL6A 2QA4Z 2LFUA 1NUIA 3RZDI 3CC2Z 3Q87A 1YIJZ 3OW2Y 3CCM1 3MZLB 4NBHA 1M901 1Z01A 3OW2Z 3S2DI 2NAPA 3S1RI 2VUGA 1VQMZ 1VQ7Z 3CCRZ 4MONA 3GTOI 1WW9A 2Y0SA 1VQ81 3S14I 1K9M2 3CD61 1Q862 2PM9A 1Q821 1K83I 1WIIA 1KD12 1RO2A 3FQQA 3HOWI 3I56Z 3CCS1 4RVGA 1Y1WI 2WB1A 1YITZ 2W03A 3CMA1 1K732 1I3QI 1S721 2VUMI 1YJN1 1M902 2PMZA 4NFRA 2EGTA 2F4MA 3CC71 3CCLZ 2IZ4A 2K3RA 4EWCA 3JAMb 3VTNA 1TWHI 2OTJZ 1N8R1 4S1TA 1R9TI 3I4NI 4BBSI 5AN9F 2YU9I 2I3CA 1YUAA 3VMHA 4E32A 1VQ9Z 3CCEZ 1NJI1 2IV2X 3QWUA 3H3VJ 2O4HA 2GTHA 2DE5A 1YI21 3J7A4 3S17I 5T64A 2HF1A 4CL1A 3CCQ1 2R92I 1YJ9Z 1WZNA 3KIHA 1X3WA 3I07A 5D1PA 4TNUA 1Q16A 3PO2I 4A3II 1Y1VS 1VQNZ 2B63I 3I55Z 4NBFA 2O53A 2QR1B 2HU9A 1YHQZ 2V8KA 1Q7Y1 5T67A 3MZKB 3NH8A 2Q51A 4NBGA 3J81b 3HOZI 1QVGY 4E31A 2KPIA 3BG0B 3G71Z 2H85A 5A2Qf 1K8A1 1QVGZ 3G6E1 1YUKA 1Q811 1FDIA 1TWFI 4BXXI 5FLXb 3GTMS 1Z02A 2NVQI 2WAQA 1RQFA 3CCMZ 3NFZA 4MD7A 3M4OI 2JIQA 3MONA 2JA8I 3NH4A 2V3VA 3GTGI 4NBDA 2K5RA 3EEDA 1JJ2Y 4A3DI 1ML8A 2BJOA 1LQLA 2JIRA 2JIMA 5D1OB 1JJ2Z 2Q4ZA 3BG1B 4DQYB 1YJW1 1VQ8Z 2JIPA 2JNYA 1KC82 3CD6Z 3NDJA 4QTTA 2JA5I 3CQZI 1K8A2 1Y1VI 3S2HI 2QRDB 3CCSZ 3GTJI 1FDOA 2OTL1 2JR6A 4BY1I 4A3EI 1VQ51 3CCJ1 3D2LA 3CMAZ 1S72Z 1YJNZ 2QEX1 1USPB 2KI7B 3CC7Z 1AA6A 1PFTA 2DE6A 3F3FC 1QVFY 3M3YI 3RZOI 4A3FI 3JAMf 4NBBA 1VQ61 3CME1 4RVFA 1VQP1 3GTMI 3CCU1 4DGLA 3G4S1 2VPXA 3P5JB 3J80b 2JMOA 2W04A 1YI2Z 4NBEA 1VQO1 2JIOA 3CCQZ 2ZAEB 1SFOI 1Q822 3LUSA 3S1NI 1VQL1 3CC41 4NBAA 2F4OA 3IF8A 3NDIA 2G2KA 4HH4A 4E2XA 3H0GI 3HKZA 2V8IA 2PK7A 3S1MI 2P28A 2RPRA 1M1K1 4QTUA 1S7MA 1ZB9A 3GTLI 3CPWY 1N8R2 1NP6A 5IP9I 2R93I 2RIQA 2JA7I 3J81f 1VQ41 3CPWZ 2GU2A 1RLYA 3G6EZ 4XX2A 1RNIA 2IZ3A 1NJI2 4BY7I 3VMGA 4MD8A 4A3MI 5FLXf 2E2HI 3EERA 3HOYI 4X6AI 3F3PC 1I50I 1P9NA 5CM2M 2R7ZI 4A3BI 3D9XA 3PO3S 5C3EI 5C44I 2VPYA 1KRLA 4NOZA 3GTKI 4Y7NI 4RS4A 1M1K2 1YJWZ 3GTPI 1W2BY 3IFUA 1L1OC 1JWHC 1VQK1 1W2BZ 2JUBA 1TWCI 1Q7Y2 2OZKA 3ESWA 1K9M1 2QKDA 1Q861 1KQSY 2OTLZ 3S16I 3GTQI 3CXCY 1VQ5Z 1KD11 3CCJZ 1X3ZA 1KQSZ 3VMIA 3CXCZ 3S1QI 2AYDA 2R6MA 2QEXZ 3HOUI 1ZH1A 2V8JA 3TDHB 1Q812 1K731 3FKII 5IT9b 1RO4A 3CCV1 1TWGI 4MH4A 4A3KI 4A3JI 2E2JI 5LL6f 4NB9A 2OOYB 1VQ6Z 3CMEZ 2QA41 2RHBA 2JA6I 5C4JI 3S15I 3CC21 1VQPZ 2QREB 4NH1C 2LEXA 1YIJ1 3CCUZ 3G4SZ 4A3CI 4BBRI 1WCMI 1Z03A 1QVFZ 5C4XI 2E2II 4DK1A 3J80f 1VQOZ 2YADA 3HOVI 3PO3I 2VF1A 1VQM1 1VQ71 3CCR1 1QXFA 3NH5A 2J6AA 2VPWA 1VQLZ 2QRCB 2VPZA 3CC4Z 5D1OA 2JS4A 4NBCA 3VB9A
chains in the Genus database with same CATH topology
3I561 2P3YA 3IX0A 1YIT1 4E30A 3I4MI 2AKLA 3FQMA 1RO0A 3CCL1 1VQ4Z 1X0TA 2OTJ1 2LIYA 2NVTI 1USPA 2OOXB 1TWAI 2DE7A 4RVHA 1QF8A 2M6NA 3KIFA 1I6HI 1VLAA 1TFIA 3GKQA 1VQ91 3CCE1 5T6BA 4A3GI 3T4NB 2M48A 1ZB8A 4AYBA 4E33A 4E2WA 2RBLA 2QLVB 5IP7I 2GTIA 4NB8A 4MRIA 1YJ91 4MXUA 2NVYI 2NVXI 3TE5B 4E2YA 3HOXI 3K7AI 1VQKZ 3D6WA 4Y52I 1VQN1 3GCFA 3I551 1KC81 1N2FA 4MD9A 3U50C 2E9HA 4HGZA 4E2ZA 1YHQ1 5FLMI 4A93I 2RT9A 5A2Qb 1QYPA 4HGYA 4RVDA 3G711 3CCVZ 4RV9A 4A3LI 5IT9f 1DL6A 2QA4Z 2LFUA 1NUIA 3RZDI 3CC2Z 3Q87A 1YIJZ 3OW2Y 3CCM1 3MZLB 4NBHA 1M901 1Z01A 3OW2Z 3S2DI 3S1RI 2VUGA 1VQMZ 1VQ7Z 3CCRZ 4MONA 3GTOI 1WW9A 2Y0SA 1VQ81 3S14I 1K9M2 3CD61 1Q862 2PM9A 1Q821 1K83I 1WIIA 1KD12 1RO2A 3FQQA 3HOWI 3I56Z 3CCS1 4RVGA 1Y1WI 2WB1A 1YITZ 2W03A 3CMA1 1K732 1I3QI 1S721 2VUMI 1YJN1 1M902 2PMZA 4NFRA 2EGTA 2F4MA 3CC71 3CCLZ 2IZ4A 2K3RA 4EWCA 3JAMb 3VTNA 1TWHI 2OTJZ 1N8R1 4S1TA 1R9TI 3I4NI 4BBSI 5AN9F 2YU9I 2I3CA 1YUAA 3VMHA 4E32A 1VQ9Z 3CCEZ 1NJI1 3QWUA 3H3VJ 2O4HA 2GTHA 2DE5A 1YI21 3J7A4 3S17I 5T64A 2HF1A 4CL1A 3CCQ1 2R92I 1YJ9Z 3KIHA 1X3WA 3I07A 5D1PA 4TNUA 3PO2I 4A3II 1Y1VS 1VQNZ 2B63I 3I55Z 4NBFA 2O53A 2QR1B 2HU9A 1YHQZ 2V8KA 1Q7Y1 5T67A 3MZKB 3NH8A 2Q51A 4NBGA 3J81b 3HOZI 1QVGY 4E31A 2KPIA 3BG0B 3G71Z 2H85A 5A2Qf 1K8A1 1QVGZ 3G6E1 1YUKA 1Q811 1TWFI 4BXXI 5FLXb 3GTMS 1Z02A 2NVQI 2WAQA 1RQFA 3CCMZ 3NFZA 4MD7A 3M4OI 3MONA 2JA8I 3NH4A 3GTGI 4NBDA 2K5RA 3EEDA 1JJ2Y 4A3DI 1ML8A 2BJOA 1LQLA 5D1OB 1JJ2Z 2Q4ZA 3BG1B 4DQYB 1YJW1 1VQ8Z 1KC82 2JNYA 3CD6Z 3NDJA 4QTTA 2JA5I 3CQZI 1K8A2 1Y1VI 3S2HI 2QRDB 3CCSZ 3GTJI 2OTL1 2JR6A 4BY1I 4A3EI 1VQ51 3CCJ1 3CMAZ 1S72Z 1YJNZ 2QEX1 1USPB 2KI7B 3CC7Z 1PFTA 2DE6A 3F3FC 1QVFY 3M3YI 3RZOI 4A3FI 3JAMf 4NBBA 1VQ61 3CME1 4RVFA 1VQP1 3GTMI 3CCU1 4DGLA 3G4S1 3P5JB 3J80b 2JMOA 2W04A 1YI2Z 4NBEA 1VQO1 3CCQZ 2ZAEB 1SFOI 1Q822 3LUSA 3S1NI 1VQL1 3CC41 4NBAA 2F4OA 3IF8A 3NDIA 2G2KA 4HH4A 4E2XA 3H0GI 3HKZA 2V8IA 2PK7A 3S1MI 2P28A 2RPRA 1M1K1 4QTUA 1S7MA 1ZB9A 3GTLI 3CPWY 1N8R2 1NP6A 5IP9I 2R93I 2RIQA 2JA7I 3J81f 1VQ41 3CPWZ 2GU2A 1RLYA 3G6EZ 4XX2A 1RNIA 2IZ3A 1NJI2 4BY7I 3VMGA 4MD8A 4A3MI 5FLXf 2E2HI 3EERA 3HOYI 4X6AI 3F3PC 1I50I 1P9NA 5CM2M 2R7ZI 4A3BI 3D9XA 3PO3S 5C3EI 5C44I 1KRLA 4NOZA 3GTKI 4Y7NI 4RS4A 1M1K2 1YJWZ 3GTPI 1W2BY 3IFUA 1L1OC 1JWHC 1VQK1 1W2BZ 2JUBA 1TWCI 1Q7Y2 2OZKA 3ESWA 1K9M1 2QKDA 1Q861 1KQSY 2OTLZ 3S16I 3GTQI 3CXCY 1VQ5Z 1KD11 3CCJZ 1X3ZA 1KQSZ 3VMIA 3CXCZ 3S1QI 2R6MA 2QEXZ 3HOUI 1ZH1A 2V8JA 3TDHB 1Q812 1K731 3FKII 5IT9b 1RO4A 3CCV1 1TWGI 4MH4A 4A3KI 4A3JI 2E2JI 5LL6f 4NB9A 2OOYB 1VQ6Z 3CMEZ 2QA41 2RHBA 2JA6I 5C4JI 3S15I 3CC21 1VQPZ 2QREB 4NH1C 1YIJ1 3CCUZ 3G4SZ 4A3CI 4BBRI 1WCMI 1Z03A 1QVFZ 5C4XI 2E2II 4DK1A 3J80f 1VQOZ 2YADA 3HOVI 3PO3I 2VF1A 1VQM1 1VQ71 3CCR1 3NH5A 2J6AA 1VQLZ 2QRCB 3CC4Z 5D1OA 2JS4A 4NBCA 3VB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 1;  3CPW Z;  3G6E Z;  1YIT 1;  1VQ8 1;  1K9M 2;  3CD6 1;  1Q86 2;  1NJI 2;  1JJ2 Y;  1Q82 1;  1KD1 2;  3CCL 1;  1VQ4 Z;  3I56 Z;  3CCS 1;  1JJ2 Z;  2OTJ 1;  1YJW 1;  1YIT Z;  1VQ8 Z;  1KC8 2;  3CMA 1;  1K73 2;  3CD6 Z;  1S72 1;  1YJN 1;  1M90 2;  1K8A 2;  3CC7 1;  3CCL Z;  3CCS Z;  1M1K 2;  1VQ9 1;  3CCE 1;  2OTL 1;  2OTJ Z;  1YJW Z;  1N8R 1;  1VQ5 1;  3CCJ 1;  3CMA Z;  1W2B Y;  1S72 Z;  1YJN Z;  1VQK 1;  2QEX 1;  1W2B Z;  3CC7 Z;  1Q7Y 2;  1K9M 1;  1QVF Y;  1Q86 1;  1VQ9 Z;  3CCE Z;  1NJI 1;  1KQS Y;  2OTL Z;  3CXC Y;  1YJ9 1;  1VQ5 Z;  1KD1 1;  3CCJ Z;  1VQ6 1;  3CME 1;  1KQS Z;  3CXC Z;  1YI2 1;  1VQK Z;  2QEX Z;  1VQP 1;  1VQN 1;  3I55 1;  3CCU 1;  1Q81 2;  1KC8 1;  1K73 1;  3G4S 1;  3CCQ 1;  3CCV 1;  1YJ9 Z;  1YHQ 1;  1VQ6 Z;  3CME Z;  2QA4 1;  1YI2 Z;  3CC2 1;  1VQP Z;  1VQO 1;  1YIJ 1;  1VQN Z;  3I55 Z;  3CCU Z;  3G4S Z;  3G71 1;  3CCQ Z;  3CCV Z;  1QVF Z;  1Q82 2;  1YHQ Z;  1Q7Y 1;  2QA4 Z;  1VQL 1;  3CC2 Z;  1VQO Z;  3CC4 1;  1YIJ Z;  1VQM 1;  1QVG Y;  1VQ7 1;  3OW2 Y;  3CCR 1;  3G71 Z;  3CCM 1;  1M90 1;  1K8A 1;  1QVG Z;  3OW2 Z;  3G6E 1;  1Q81 1;  1VQL Z;  1M1K 1;  3CPW Y;  3CC4 Z;  1N8R 2;  1VQM Z;  1VQ7 Z;  3CCR Z;  3CCM Z;  1VQ4 1; 
#chains in the Genus database with same CATH topology
 3I56 1;  2P3Y A;  3IX0 A;  1YIT 1;  4E30 A;  3I4M I;  2AKL A;  3IR7 A;  3FQM A;  1RO0 A;  3CCL 1;  1VQ4 Z;  1Y8C A;  2E7Z A;  1WJ2 A;  1X0T A;  2OTJ 1;  2LIY A;  2NVT I;  1USP A;  2OOX B;  1TWA I;  2DE7 A;  4RVH A;  1QF8 A;  2M6N A;  3KIF A;  1I6H I;  1VLA A;  1TFI A;  1SIW A;  3GKQ A;  1VQ9 1;  3CCE 1;  5T6B A;  4A3G I;  3T4N B;  2M48 A;  1ZB8 A;  4AYB A;  4E33 A;  4E2W A;  2RBL A;  2QLV B;  5IP7 I;  2GTI A;  4NB8 A;  4MRI A;  1YJ9 1;  4MXU A;  2NVY I;  2NVX I;  3TE5 B;  4E2Y A;  3HOX I;  3K7A I;  1VQK Z;  3D6W A;  4Y52 I;  1VQN 1;  3GCF A;  3I55 1;  1KC8 1;  2V45 A;  1N2F A;  4MD9 A;  3U50 C;  2E9H A;  4HGZ A;  4E2Z A;  1YHQ 1;  5FLM I;  4A93 I;  2RT9 A;  5A2Q b;  1QYP A;  4HGY A;  4RVD A;  3G71 1;  3CCV Z;  4RV9 A;  4A3L I;  5IT9 f;  1DL6 A;  2QA4 Z;  2LFU A;  1NUI A;  3RZD I;  3CC2 Z;  3Q87 A;  1YIJ Z;  3OW2 Y;  3CCM 1;  3MZL B;  4NBH A;  1M90 1;  1Z01 A;  3OW2 Z;  3S2D I;  2NAP A;  3S1R I;  2VUG A;  1VQM Z;  1VQ7 Z;  3CCR Z;  4MON A;  3GTO I;  1WW9 A;  2Y0S A;  1VQ8 1;  3S14 I;  1K9M 2;  3CD6 1;  1Q86 2;  2PM9 A;  1Q82 1;  1K83 I;  1WII A;  1KD1 2;  1RO2 A;  3FQQ A;  3HOW I;  3I56 Z;  3CCS 1;  4RVG A;  1Y1W I;  2WB1 A;  1YIT Z;  2W03 A;  3CMA 1;  1K73 2;  1I3Q I;  1S72 1;  2VUM I;  1YJN 1;  1M90 2;  2PMZ A;  4NFR A;  2EGT A;  2F4M A;  3CC7 1;  3CCL Z;  2IZ4 A;  2K3R A;  4EWC A;  3JAM b;  3VTN A;  1TWH I;  2OTJ Z;  1N8R 1;  4S1T A;  1R9T I;  3I4N I;  4BBS I;  5AN9 F;  2YU9 I;  2I3C A;  1YUA A;  3VMH A;  4E32 A;  1VQ9 Z;  3CCE Z;  1NJI 1;  2IV2 X;  3QWU A;  3H3V J;  2O4H A;  2GTH A;  2DE5 A;  1YI2 1;  3J7A 4;  3S17 I;  5T64 A;  2HF1 A;  4CL1 A;  3CCQ 1;  2R92 I;  1YJ9 Z;  1WZN A;  3KIH A;  1X3W A;  3I07 A;  5D1P A;  4TNU A;  1Q16 A;  3PO2 I;  4A3I I;  1Y1V S;  1VQN Z;  2B63 I;  3I55 Z;  4NBF A;  2O53 A;  2QR1 B;  2HU9 A;  1YHQ Z;  2V8K A;  1Q7Y 1;  5T67 A;  3MZK B;  3NH8 A;  2Q51 A;  4NBG A;  3J81 b;  3HOZ I;  1QVG Y;  4E31 A;  2KPI A;  3BG0 B;  3G71 Z;  2H85 A;  5A2Q f;  1K8A 1;  1QVG Z;  3G6E 1;  1YUK A;  1Q81 1;  1FDI A;  1TWF I;  4BXX I;  5FLX b;  3GTM S;  1Z02 A;  2NVQ I;  2WAQ A;  1RQF A;  3CCM Z;  3NFZ A;  4MD7 A;  3M4O I;  2JIQ A;  3MON A;  2JA8 I;  3NH4 A;  2V3V A;  3GTG I;  4NBD A;  2K5R A;  3EED A;  1JJ2 Y;  4A3D I;  1ML8 A;  2BJO A;  1LQL A;  2JIR A;  2JIM A;  5D1O B;  1JJ2 Z;  2Q4Z A;  3BG1 B;  4DQY B;  1YJW 1;  1VQ8 Z;  2JIP A;  2JNY A;  1KC8 2;  3CD6 Z;  3NDJ A;  4QTT A;  2JA5 I;  3CQZ I;  1K8A 2;  1Y1V I;  3S2H I;  2QRD B;  3CCS Z;  3GTJ I;  1FDO A;  2OTL 1;  2JR6 A;  4BY1 I;  4A3E I;  1VQ5 1;  3CCJ 1;  3D2L A;  3CMA Z;  1S72 Z;  1YJN Z;  2QEX 1;  1USP B;  2KI7 B;  3CC7 Z;  1AA6 A;  1PFT A;  2DE6 A;  3F3F C;  1QVF Y;  3M3Y I;  3RZO I;  4A3F I;  3JAM f;  4NBB A;  1VQ6 1;  3CME 1;  4RVF A;  1VQP 1;  3GTM I;  3CCU 1;  4DGL A;  3G4S 1;  2VPX A;  3P5J B;  3J80 b;  2JMO A;  2W04 A;  1YI2 Z;  4NBE A;  1VQO 1;  2JIO A;  3CCQ Z;  2ZAE B;  1SFO I;  1Q82 2;  3LUS A;  3S1N I;  1VQL 1;  3CC4 1;  4NBA A;  2F4O A;  3IF8 A;  3NDI A;  2G2K A;  4HH4 A;  4E2X A;  3H0G I;  3HKZ A;  2V8I A;  2PK7 A;  3S1M I;  2P28 A;  2RPR A;  1M1K 1;  4QTU A;  1S7M A;  1ZB9 A;  3GTL I;  3CPW Y;  1N8R 2;  1NP6 A;  5IP9 I;  2R93 I;  2RIQ A;  2JA7 I;  3J81 f;  1VQ4 1;  3CPW Z;  2GU2 A;  1RLY A;  3G6E Z;  4XX2 A;  1RNI A;  2IZ3 A;  1NJI 2;  4BY7 I;  3VMG A;  4MD8 A;  4A3M I;  5FLX f;  2E2H I;  3EER A;  3HOY I;  4X6A I;  3F3P C;  1I50 I;  1P9N A;  5CM2 M;  2R7Z I;  4A3B I;  3D9X A;  3PO3 S;  5C3E I;  5C44 I;  2VPY A;  1KRL A;  4NOZ A;  3GTK I;  4Y7N I;  4RS4 A;  1M1K 2;  1YJW Z;  3GTP I;  1W2B Y;  3IFU A;  1L1O C;  1JWH C;  1VQK 1;  1W2B Z;  2JUB A;  1TWC I;  1Q7Y 2;  2OZK A;  3ESW A;  1K9M 1;  2QKD A;  1Q86 1;  1KQS Y;  2OTL Z;  3S16 I;  3GTQ I;  3CXC Y;  1VQ5 Z;  1KD1 1;  3CCJ Z;  1X3Z A;  1KQS Z;  3VMI A;  3CXC Z;  3S1Q I;  2AYD A;  2R6M A;  2QEX Z;  3HOU I;  1ZH1 A;  2V8J A;  3TDH B;  1Q81 2;  1K73 1;  3FKI I;  5IT9 b;  1RO4 A;  3CCV 1;  1TWG I;  4MH4 A;  4A3K I;  4A3J I;  2E2J I;  5LL6 f;  4NB9 A;  2OOY B;  1VQ6 Z;  3CME Z;  2QA4 1;  2RHB A;  2JA6 I;  5C4J I;  3S15 I;  3CC2 1;  1VQP Z;  2QRE B;  4NH1 C;  2LEX A;  1YIJ 1;  3CCU Z;  3G4S Z;  4A3C I;  4BBR I;  1WCM I;  1Z03 A;  1QVF Z;  5C4X I;  2E2I I;  4DK1 A;  3J80 f;  1VQO Z;  2YAD A;  3HOV I;  3PO3 I;  2VF1 A;  1VQM 1;  1VQ7 1;  3CCR 1;  1QXF A;  3NH5 A;  2J6A A;  2VPW A;  1VQL Z;  2QRC B;  2VPZ A;  3CC4 Z;  5D1O A;  2JS4 A;  4NBC A;  3VB9 A; 
#chains in the Genus database with same CATH homology
 3I56 1;  2P3Y A;  3IX0 A;  1YIT 1;  4E30 A;  3I4M I;  2AKL A;  3FQM A;  1RO0 A;  3CCL 1;  1VQ4 Z;  1X0T A;  2OTJ 1;  2LIY A;  2NVT I;  1USP A;  2OOX B;  1TWA I;  2DE7 A;  4RVH A;  1QF8 A;  2M6N A;  3KIF A;  1I6H I;  1VLA A;  1TFI A;  3GKQ A;  1VQ9 1;  3CCE 1;  5T6B A;  4A3G I;  3T4N B;  2M48 A;  1ZB8 A;  4AYB A;  4E33 A;  4E2W A;  2RBL A;  2QLV B;  5IP7 I;  2GTI A;  4NB8 A;  4MRI A;  1YJ9 1;  4MXU A;  2NVY I;  2NVX I;  3TE5 B;  4E2Y A;  3HOX I;  3K7A I;  1VQK Z;  3D6W A;  4Y52 I;  1VQN 1;  3GCF A;  3I55 1;  1KC8 1;  1N2F A;  4MD9 A;  3U50 C;  2E9H A;  4HGZ A;  4E2Z A;  1YHQ 1;  5FLM I;  4A93 I;  2RT9 A;  5A2Q b;  1QYP A;  4HGY A;  4RVD A;  3G71 1;  3CCV Z;  4RV9 A;  4A3L I;  5IT9 f;  1DL6 A;  2QA4 Z;  2LFU A;  1NUI A;  3RZD I;  3CC2 Z;  3Q87 A;  1YIJ Z;  3OW2 Y;  3CCM 1;  3MZL B;  4NBH A;  1M90 1;  1Z01 A;  3OW2 Z;  3S2D I;  3S1R I;  2VUG A;  1VQM Z;  1VQ7 Z;  3CCR Z;  4MON A;  3GTO I;  1WW9 A;  2Y0S A;  1VQ8 1;  3S14 I;  1K9M 2;  3CD6 1;  1Q86 2;  2PM9 A;  1Q82 1;  1K83 I;  1WII A;  1KD1 2;  1RO2 A;  3FQQ A;  3HOW I;  3I56 Z;  3CCS 1;  4RVG A;  1Y1W I;  2WB1 A;  1YIT Z;  2W03 A;  3CMA 1;  1K73 2;  1I3Q I;  1S72 1;  2VUM I;  1YJN 1;  1M90 2;  2PMZ A;  4NFR A;  2EGT A;  2F4M A;  3CC7 1;  3CCL Z;  2IZ4 A;  2K3R A;  4EWC A;  3JAM b;  3VTN A;  1TWH I;  2OTJ Z;  1N8R 1;  4S1T A;  1R9T I;  3I4N I;  4BBS I;  5AN9 F;  2YU9 I;  2I3C A;  1YUA A;  3VMH A;  4E32 A;  1VQ9 Z;  3CCE Z;  1NJI 1;  3QWU A;  3H3V J;  2O4H A;  2GTH A;  2DE5 A;  1YI2 1;  3J7A 4;  3S17 I;  5T64 A;  2HF1 A;  4CL1 A;  3CCQ 1;  2R92 I;  1YJ9 Z;  3KIH A;  1X3W A;  3I07 A;  5D1P A;  4TNU A;  3PO2 I;  4A3I I;  1Y1V S;  1VQN Z;  2B63 I;  3I55 Z;  4NBF A;  2O53 A;  2QR1 B;  2HU9 A;  1YHQ Z;  2V8K A;  1Q7Y 1;  5T67 A;  3MZK B;  3NH8 A;  2Q51 A;  4NBG A;  3J81 b;  3HOZ I;  1QVG Y;  4E31 A;  2KPI A;  3BG0 B;  3G71 Z;  2H85 A;  5A2Q f;  1K8A 1;  1QVG Z;  3G6E 1;  1YUK A;  1Q81 1;  1TWF I;  4BXX I;  5FLX b;  3GTM S;  1Z02 A;  2NVQ I;  2WAQ A;  1RQF A;  3CCM Z;  3NFZ A;  4MD7 A;  3M4O I;  3MON A;  2JA8 I;  3NH4 A;  3GTG I;  4NBD A;  2K5R A;  3EED A;  1JJ2 Y;  4A3D I;  1ML8 A;  2BJO A;  1LQL A;  5D1O B;  1JJ2 Z;  2Q4Z A;  3BG1 B;  4DQY B;  1YJW 1;  1VQ8 Z;  1KC8 2;  2JNY A;  3CD6 Z;  3NDJ A;  4QTT A;  2JA5 I;  3CQZ I;  1K8A 2;  1Y1V I;  3S2H I;  2QRD B;  3CCS Z;  3GTJ I;  2OTL 1;  2JR6 A;  4BY1 I;  4A3E I;  1VQ5 1;  3CCJ 1;  3CMA Z;  1S72 Z;  1YJN Z;  2QEX 1;  1USP B;  2KI7 B;  3CC7 Z;  1PFT A;  2DE6 A;  3F3F C;  1QVF Y;  3M3Y I;  3RZO I;  4A3F I;  3JAM f;  4NBB A;  1VQ6 1;  3CME 1;  4RVF A;  1VQP 1;  3GTM I;  3CCU 1;  4DGL A;  3G4S 1;  3P5J B;  3J80 b;  2JMO A;  2W04 A;  1YI2 Z;  4NBE A;  1VQO 1;  3CCQ Z;  2ZAE B;  1SFO I;  1Q82 2;  3LUS A;  3S1N I;  1VQL 1;  3CC4 1;  4NBA A;  2F4O A;  3IF8 A;  3NDI A;  2G2K A;  4HH4 A;  4E2X A;  3H0G I;  3HKZ A;  2V8I A;  2PK7 A;  3S1M I;  2P28 A;  2RPR A;  1M1K 1;  4QTU A;  1S7M A;  1ZB9 A;  3GTL I;  3CPW Y;  1N8R 2;  1NP6 A;  5IP9 I;  2R93 I;  2RIQ A;  2JA7 I;  3J81 f;  1VQ4 1;  3CPW Z;  2GU2 A;  1RLY A;  3G6E Z;  4XX2 A;  1RNI A;  2IZ3 A;  1NJI 2;  4BY7 I;  3VMG A;  4MD8 A;  4A3M I;  5FLX f;  2E2H I;  3EER A;  3HOY I;  4X6A I;  3F3P C;  1I50 I;  1P9N A;  5CM2 M;  2R7Z I;  4A3B I;  3D9X A;  3PO3 S;  5C3E I;  5C44 I;  1KRL A;  4NOZ A;  3GTK I;  4Y7N I;  4RS4 A;  1M1K 2;  1YJW Z;  3GTP I;  1W2B Y;  3IFU A;  1L1O C;  1JWH C;  1VQK 1;  1W2B Z;  2JUB A;  1TWC I;  1Q7Y 2;  2OZK A;  3ESW A;  1K9M 1;  2QKD A;  1Q86 1;  1KQS Y;  2OTL Z;  3S16 I;  3GTQ I;  3CXC Y;  1VQ5 Z;  1KD1 1;  3CCJ Z;  1X3Z A;  1KQS Z;  3VMI A;  3CXC Z;  3S1Q I;  2R6M A;  2QEX Z;  3HOU I;  1ZH1 A;  2V8J A;  3TDH B;  1Q81 2;  1K73 1;  3FKI I;  5IT9 b;  1RO4 A;  3CCV 1;  1TWG I;  4MH4 A;  4A3K I;  4A3J I;  2E2J I;  5LL6 f;  4NB9 A;  2OOY B;  1VQ6 Z;  3CME Z;  2QA4 1;  2RHB A;  2JA6 I;  5C4J I;  3S15 I;  3CC2 1;  1VQP Z;  2QRE B;  4NH1 C;  1YIJ 1;  3CCU Z;  3G4S Z;  4A3C I;  4BBR I;  1WCM I;  1Z03 A;  1QVF Z;  5C4X I;  2E2I I;  4DK1 A;  3J80 f;  1VQO Z;  2YAD A;  3HOV I;  3PO3 I;  2VF1 A;  1VQM 1;  1VQ7 1;  3CCR 1;  3NH5 A;  2J6A A;  1VQL Z;  2QRC B;  3CC4 Z;  5D1O A;  2JS4 A;  4NBC A;  3VB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...