3CME1

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cme100
3CC4Z 1Q7Y2 3G711 1YJ9Z 3I551 3CC2Z 1KQSY 1VQO1 1M902 1VQK1 1VQ4Z 3I56Z 1W2BY 1Q812 1K8A2 3CCSZ 3CXCY 1VQ51 1YHQ1 3CMA1 3G4SZ 1VQ9Z 3CD6Z 2OTJZ 3CCM1 1N8R2 3CCV1 1QVGZ 1QVFY 3CC7Z 2OTLZ 3CPWY 1VQ61 3G6E1 3CME1 1KD11 1VQ7Z 1JJ2Y 1YIJZ 1YIT1 1YJN1 3G71Z 3I55Z 3CCU1 1Q7Y1 1VQOZ 1K9M1 1VQM1 1Q822 1S721 3CMAZ 1VQ81 1YHQZ 3CCR1 1Q811 1K8A1 1VQL1 3CCMZ 1YJWZ 1QVGY 3CCVZ 1YI21 1N8R1 1VQ6Z 1Q862 3CCE1 3CMEZ 1KC82 1VQN1 2QEX1 3OW2Z 1YITZ 1YJNZ 1KQSZ 1M1K2 1K732 1VQMZ 1VQKZ 1Q821 1VQ8Z 1W2BZ 1M901 3CXCZ 3CCQ1 3CCRZ 3CCL1 1VQP1 1NJI2 1VQ5Z 3G4S1 1VQLZ 2QA41 1YI2Z 1KD12 3CPWZ 3CCEZ 3CCJ1 1VQ71 1VQNZ 3G6EZ 2QEXZ 3CC41 3OW2Y 1Q861 1KC81 1YIJ1 1JJ2Z 1K9M2 1YJ91 3CCUZ 3CC21 1M1K1 1K731 1S72Z 1VQ41 3I561 3CCQZ 3CCLZ 1VQPZ 3CCS1 1YJW1 1NJI1 2QA4Z 1VQ91 3CD61 2OTJ1 3CC71 2OTL1 1QVFZ 3CCJZ
chains in the Genus database with same CATH superfamily
1VLAA 3HOWI 2R93I 1YJ9Z 2K3RA 3RZDI 2VPZA 2R6MA 1Y8CA 3KIFA 3P5JB 5A2Qf 1FDIA 1VQO1 1KQSY 3GTMS 2F4OA 2NAPA 1VQ4Z 1VQK1 3S1QI 1YHQ1 5D1OB 2JUBA 3IR7A 2OTJZ 3CCM1 3CC7Z 5A2Qb 1RO4A 3CPWY 4NBEA 5D1PA 4A3FI 3CME1 3T4NB 1ZB8A 1R9TI 1QYPA 3G71Z 3I55Z 4RVGA 2RPRA 1VQM1 1S721 1TWGI 4NBBA 3PO3I 2JIMA 2OZKA 3S2DI 3CCR1 3FKII 3S1RI 2JS4A 3NH4A 2VUMI 3S16I 1YI21 1N8R1 3D2LA 3FQMA 4HH4A 3GTGI 2GU2A 1TWFI 5C3EI 1VQN1 3GKQA 4E33A 3D9XA 1AA6A 3H0GI 1M1K2 1K83I 1RO0A 4A3CI 4S1TA 1VQKZ 2ZAEB 1Q821 4NFRA 4A3DI 3I4MI 4XX2A 1NUIA 1KD12 1X0TA 2JA6I 1JJ2Z 2DE7A 4QTUA 1K9M2 1YJ91 2HU9A 1Q16A 4MD8A 1S72Z 1VQ41 2LEXA 1JWHC 1X3ZA 2F4MA 3CCQZ 2E7ZA 4HGYA 3HOVI 4NBDA 2JR6A 2QA4Z 2OTJ1 2Q4ZA 3TE5B 1Z03A 1PFTA 4MD9A 3M3YI 3CC71 1I3QI 3CCJZ 3NDJA 1WCMI 3CC4Z 2JIPA 3G711 3GTMI 3I551 3F3PC 4RS4A 3CC2Z 2QRDB 2JIQA 2JIRA 4A3MI 1WW9A 3D6WA 1W2BY 4NOZA 2WB1A 1VQ51 3MZLB 1VQ9Z 4E2XA 1N8R2 5D1OA 1DL6A 3FQQA 3NDIA 2I3CA 4BY1I 1ZB9A 1KD11 1Y1VS 2V3VA 1ZH1A 2QRCB 3RZOI 3VB9A 1K9M1 2JNYA 2NVQI 1Q822 3GTKI 3CMAZ 2R92I 1Q811 1K8A1 3MONA 2VF1A 4NBFA 4A93I 5C4JI 3CCVZ 1WZNA 3S1MI 2P28A 1VQ6Z 1I6HI 4BY7I 1YITZ 2NVTI 3IF8A 3J81f 4BBSI 2LFUA 4X6AI 3M4OI 1RQFA 3CXCZ 3CCQ1 1LQLA 1VQ5Z 2RBLA 3S2HI 3J81b 2VPXA 2QA41 4NB8A 3VMGA 3CCEZ 5FLXb 4HGZA 3CCJ1 1VQ71 2DE5A 3CC41 1KC81 5T6BA 1YIJ1 1SFOI 3GTOI 1SIWA 2V8JA 2JA8I 2E2HI 3CC21 2JMOA 1K731 1S7MA 4QTTA 3BG0B 2IV2X 2V45A 2VPYA 4RVHA 4RV9A 1YJW1 1NJI1 1VQ91 3EERA 3J7A4 3VTNA 3H3VJ 2VPWA 1QVFZ 4RVDA 3NH8A 5LL6f 3HKZA 3GTQI 1Z01A 1KRLA 4NH1C 3U50C 1RLYA 2Y0SA 5CM2M 3IFUA 1RO2A 3I56Z 2JIOA 3HOUI 1Q812 1K8A2 3CMA1 4RVFA 1YUAA 4A3BI 2OOYB 2QLVB 1FDOA 3KIHA 4BBRI 5C44I 3CCV1 3GCFA 1QVGZ 2OTLZ 1QVFY 1QXFA 1Y1VI 1TFIA 2RIQA 1VQ61 3G6E1 2O4HA 5AN9F 1VQ7Z 3IX0A 4A3GI 1JJ2Y 1YIJZ 1YIT1 2G2KA 3I4NI 2YADA 2GTHA 1N2FA 1Q7Y1 2LIYA 2PM9A 3VMHA 4NBAA 2R7ZI 1RNIA 4MRIA 3VMIA 1YJWZ 5T67A 2NVXI 1QVGY 4E2ZA 2NVYI 3CCE1 1KC82 3GTLI 3S14I 2OOXB 3HOXI 1Z02A 1YJNZ 4TNUA 3K7AI 1KQSZ 4NBCA 1K732 2AKLA 2JA7I 1P9NA 1I50I 4Y7NI 1VQ8Z 2YU9I 5T64A 1NJI2 3QWUA 3GTPI 3G4S1 3S17I 1USPB 1VQLZ 3LUSA 5IT9b 2WAQA 2Q51A 3NH5A 4MD7A 3CPWZ 3Q87A 1QF8A 3G6EZ 2QEXZ 1Q861 2GTIA 4E2YA 4E32A 2EGTA 5C4XI 4A3II 1Y1WI 2KPIA 3CQZI 3MZKB 2AYDA 2M48A 5FLXf 1WIIA 3I561 2J6AA 1ML8A 3CCLZ 1VQPZ 4NB9A 4NBHA 3BG1B 2H85A 4NBGA 3F3FC 2OTL1 2BJOA 2V8IA 1TWCI 1Q7Y2 4E2WA 5IP7I 2KI7B 4MXUA 1M902 3JAMf 2IZ3A 3S15I 3CCSZ 3CXCY 2B63I 3G4SZ 3CD6Z 4CL1A 2IZ4A 3TDHB 3S1NI 3JAMb 2RT9A 2E9HA 1YJN1 1YUKA 3CCU1 2M6NA 4E31A 1VQOZ 2VUGA 2PMZA 2W04A 4A3EI 1VQ81 1YHQZ 1X3WA 3PO3S 5FLMI 3I07A 1VQL1 3CCMZ 3NFZA 2E2JI 4DGLA 4MONA 3PO2I 2QKDA 4A3JI 4DQYB 4MH4A 1Q862 3CMEZ 5IP9I 2QEX1 1L1OC 3OW2Z 2QR1B 4BXXI 1TWHI 3HOZI 1VQMZ 2DE6A 2V8KA 2P3YA 1W2BZ 1WJ2A 1M901 3CCRZ 3CCL1 1VQP1 1TWAI 2E2II 3ESWA 4A3LI 1YI2Z 3GTJI 1USPA 2HF1A 2O53A 1VQNZ 3OW2Y 2PK7A 4A3KI 3CCUZ 4DK1A 5IT9f 2W03A 4AYBA 3J80f 2QREB 1M1K1 2JA5I 3CCS1 4Y52I 4E30A 2RHBA 1NP6A 3CD61 3EEDA 3HOYI 3J80b 4EWCA 2K5RA
chains in the Genus database with same CATH topology
1VLAA 3HOWI 2R93I 1YJ9Z 2K3RA 3RZDI 2R6MA 3KIFA 5A2Qf 3P5JB 1VQO1 1KQSY 3GTMS 2F4OA 1VQK1 1VQ4Z 3S1QI 1YHQ1 5D1OB 2JUBA 2OTJZ 3CCM1 3CC7Z 5A2Qb 1RO4A 3CPWY 4NBEA 5D1PA 4A3FI 3CME1 3T4NB 1ZB8A 1R9TI 1QYPA 3G71Z 3I55Z 4RVGA 2RPRA 1VQM1 1S721 1TWGI 4NBBA 3PO3I 2OZKA 3S2DI 3CCR1 3FKII 3S1RI 2JS4A 3NH4A 2VUMI 3S16I 1YI21 1N8R1 3FQMA 4HH4A 3GTGI 2GU2A 1TWFI 5C3EI 1VQN1 3GKQA 4E33A 3D9XA 3H0GI 1M1K2 1K83I 1RO0A 4A3CI 4S1TA 1VQKZ 2ZAEB 1Q821 4NFRA 4A3DI 3I4MI 4XX2A 1NUIA 1KD12 1X0TA 2JA6I 1JJ2Z 2DE7A 4QTUA 1K9M2 1YJ91 2HU9A 4MD8A 1S72Z 1VQ41 1JWHC 1X3ZA 2F4MA 3CCQZ 4HGYA 3HOVI 4NBDA 2JR6A 2QA4Z 2OTJ1 2Q4ZA 3TE5B 1Z03A 1PFTA 4MD9A 3M3YI 3CC71 1I3QI 3CCJZ 3NDJA 1WCMI 3CC4Z 3G711 3GTMI 3I551 3F3PC 4RS4A 3CC2Z 2QRDB 4A3MI 1WW9A 3D6WA 1W2BY 4NOZA 2WB1A 1VQ51 3MZLB 1VQ9Z 4E2XA 1N8R2 5D1OA 1DL6A 3FQQA 3NDIA 2I3CA 4BY1I 1ZB9A 1KD11 1Y1VS 1ZH1A 2QRCB 3RZOI 3VB9A 1K9M1 2JNYA 2NVQI 1Q822 3GTKI 3CMAZ 2R92I 1Q811 1K8A1 3MONA 2VF1A 4NBFA 4A93I 5C4JI 3CCVZ 3S1MI 2P28A 1VQ6Z 1I6HI 4BY7I 1YITZ 2NVTI 3IF8A 3J81f 4BBSI 2LFUA 4X6AI 3M4OI 1RQFA 3CXCZ 3CCQ1 1LQLA 1VQ5Z 2RBLA 3S2HI 3J81b 2QA41 4NB8A 3VMGA 3CCEZ 5FLXb 4HGZA 3CCJ1 1VQ71 2DE5A 3CC41 1KC81 5T6BA 1YIJ1 1SFOI 3GTOI 2V8JA 2JA8I 2E2HI 3CC21 2JMOA 1K731 1S7MA 4QTTA 3BG0B 4RVHA 4RV9A 1YJW1 1NJI1 1VQ91 3EERA 3J7A4 3VTNA 3H3VJ 1QVFZ 4RVDA 3NH8A 5LL6f 3HKZA 3GTQI 1Z01A 1KRLA 4NH1C 3U50C 1RLYA 2Y0SA 5CM2M 3IFUA 1RO2A 3I56Z 3HOUI 1Q812 1K8A2 3CMA1 4RVFA 1YUAA 4A3BI 2OOYB 2QLVB 3KIHA 4BBRI 5C44I 3CCV1 3GCFA 1QVGZ 2OTLZ 1QVFY 1Y1VI 1TFIA 2RIQA 1VQ61 3G6E1 2O4HA 5AN9F 1VQ7Z 3IX0A 4A3GI 1JJ2Y 1YIJZ 1YIT1 2G2KA 3I4NI 2YADA 2GTHA 1N2FA 1Q7Y1 2LIYA 2PM9A 3VMHA 4NBAA 2R7ZI 1RNIA 4MRIA 3VMIA 1YJWZ 5T67A 2NVXI 1QVGY 4E2ZA 2NVYI 3CCE1 1KC82 3GTLI 3S14I 2OOXB 3HOXI 1Z02A 1YJNZ 4TNUA 3K7AI 1KQSZ 4NBCA 1K732 2AKLA 2JA7I 1P9NA 1I50I 4Y7NI 1VQ8Z 2YU9I 5T64A 1NJI2 3QWUA 3GTPI 3G4S1 3S17I 1USPB 1VQLZ 3LUSA 5IT9b 2WAQA 2Q51A 3NH5A 4MD7A 3CPWZ 3Q87A 1QF8A 3G6EZ 2QEXZ 1Q861 2GTIA 4E2YA 4E32A 2EGTA 5C4XI 4A3II 1Y1WI 2KPIA 3CQZI 3MZKB 2M48A 5FLXf 1WIIA 3I561 2J6AA 1ML8A 3CCLZ 1VQPZ 4NB9A 4NBHA 3BG1B 2H85A 4NBGA 3F3FC 2OTL1 2BJOA 2V8IA 1TWCI 1Q7Y2 4E2WA 5IP7I 2KI7B 4MXUA 1M902 3JAMf 2IZ3A 3S15I 3CCSZ 3CXCY 2B63I 3G4SZ 3CD6Z 4CL1A 2IZ4A 3TDHB 3S1NI 3JAMb 2RT9A 2E9HA 1YJN1 1YUKA 3CCU1 2M6NA 4E31A 1VQOZ 2VUGA 2PMZA 2W04A 4A3EI 1VQ81 1YHQZ 1X3WA 3PO3S 5FLMI 3I07A 1VQL1 3CCMZ 3NFZA 2E2JI 4DGLA 4MONA 3PO2I 2QKDA 4A3JI 4DQYB 4MH4A 1Q862 3CMEZ 5IP9I 2QEX1 1L1OC 3OW2Z 2QR1B 4BXXI 1TWHI 3HOZI 1VQMZ 2DE6A 2V8KA 2P3YA 1W2BZ 1M901 3CCRZ 3CCL1 1VQP1 1TWAI 2E2II 3ESWA 4A3LI 1YI2Z 3GTJI 1USPA 2HF1A 2O53A 1VQNZ 3OW2Y 2PK7A 4A3KI 3CCUZ 4DK1A 5IT9f 2W03A 4AYBA 3J80f 2QREB 1M1K1 2JA5I 3CCS1 4Y52I 4E30A 2RHBA 1NP6A 3CD61 3EEDA 3HOYI 3J80b 4EWCA 2K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Z;  1Q7Y 2;  3G71 1;  1YJ9 Z;  3I55 1;  3CC2 Z;  1KQS Y;  1VQO 1;  1M90 2;  1VQK 1;  1VQ4 Z;  3I56 Z;  1W2B Y;  1Q81 2;  1K8A 2;  3CCS Z;  3CXC Y;  1VQ5 1;  1YHQ 1;  3CMA 1;  3G4S Z;  1VQ9 Z;  3CD6 Z;  2OTJ Z;  3CCM 1;  1N8R 2;  3CCV 1;  1QVG Z;  1QVF Y;  3CC7 Z;  2OTL Z;  3CPW Y;  1VQ6 1;  3G6E 1;  3CME 1;  1KD1 1;  1VQ7 Z;  1JJ2 Y;  1YIJ Z;  1YIT 1;  1YJN 1;  3G71 Z;  3I55 Z;  3CCU 1;  1Q7Y 1;  1VQO Z;  1K9M 1;  1VQM 1;  1Q82 2;  1S72 1;  3CMA Z;  1VQ8 1;  1YHQ Z;  3CCR 1;  1Q81 1;  1K8A 1;  1VQL 1;  3CCM Z;  1YJW Z;  1QVG Y;  3CCV Z;  1YI2 1;  1N8R 1;  1VQ6 Z;  1Q86 2;  3CCE 1;  3CME Z;  1KC8 2;  1VQN 1;  2QEX 1;  3OW2 Z;  1YIT Z;  1YJN Z;  1KQS Z;  1M1K 2;  1K73 2;  1VQM Z;  1VQK Z;  1Q82 1;  1VQ8 Z;  1W2B Z;  1M90 1;  3CXC Z;  3CCQ 1;  3CCR Z;  3CCL 1;  1VQP 1;  1NJI 2;  1VQ5 Z;  3G4S 1;  1VQL Z;  2QA4 1;  1YI2 Z;  1KD1 2;  3CPW Z;  3CCE Z;  3CCJ 1;  1VQ7 1;  1VQN Z;  3G6E Z;  2QEX Z;  3CC4 1;  3OW2 Y;  1Q86 1;  1KC8 1;  1YIJ 1;  1JJ2 Z;  1K9M 2;  1YJ9 1;  3CCU Z;  3CC2 1;  1M1K 1;  1K73 1;  1S72 Z;  1VQ4 1;  3I56 1;  3CCQ Z;  3CCL Z;  1VQP Z;  3CCS 1;  1YJW 1;  1NJI 1;  2QA4 Z;  1VQ9 1;  3CD6 1;  2OTJ 1;  3CC7 1;  2OTL 1;  1QVF Z;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 1VLA A;  3HOW I;  2R93 I;  1YJ9 Z;  2K3R A;  3RZD I;  2VPZ A;  2R6M A;  1Y8C A;  3KIF A;  3P5J B;  5A2Q f;  1FDI A;  1VQO 1;  1KQS Y;  3GTM S;  2F4O A;  2NAP A;  1VQ4 Z;  1VQK 1;  3S1Q I;  1YHQ 1;  5D1O B;  2JUB A;  3IR7 A;  2OTJ Z;  3CCM 1;  3CC7 Z;  5A2Q b;  1RO4 A;  3CPW Y;  4NBE A;  5D1P A;  4A3F I;  3CME 1;  3T4N B;  1ZB8 A;  1R9T I;  1QYP A;  3G71 Z;  3I55 Z;  4RVG A;  2RPR A;  1VQM 1;  1S72 1;  1TWG I;  4NBB A;  3PO3 I;  2JIM A;  2OZK A;  3S2D I;  3CCR 1;  3FKI I;  3S1R I;  2JS4 A;  3NH4 A;  2VUM I;  3S16 I;  1YI2 1;  1N8R 1;  3D2L A;  3FQM A;  4HH4 A;  3GTG I;  2GU2 A;  1TWF I;  5C3E I;  1VQN 1;  3GKQ A;  4E33 A;  3D9X A;  1AA6 A;  3H0G I;  1M1K 2;  1K83 I;  1RO0 A;  4A3C I;  4S1T A;  1VQK Z;  2ZAE B;  1Q82 1;  4NFR A;  4A3D I;  3I4M I;  4XX2 A;  1NUI A;  1KD1 2;  1X0T A;  2JA6 I;  1JJ2 Z;  2DE7 A;  4QTU A;  1K9M 2;  1YJ9 1;  2HU9 A;  1Q16 A;  4MD8 A;  1S72 Z;  1VQ4 1;  2LEX A;  1JWH C;  1X3Z A;  2F4M A;  3CCQ Z;  2E7Z A;  4HGY A;  3HOV I;  4NBD A;  2JR6 A;  2QA4 Z;  2OTJ 1;  2Q4Z A;  3TE5 B;  1Z03 A;  1PFT A;  4MD9 A;  3M3Y I;  3CC7 1;  1I3Q I;  3CCJ Z;  3NDJ A;  1WCM I;  3CC4 Z;  2JIP A;  3G71 1;  3GTM I;  3I55 1;  3F3P C;  4RS4 A;  3CC2 Z;  2QRD B;  2JIQ A;  2JIR A;  4A3M I;  1WW9 A;  3D6W A;  1W2B Y;  4NOZ A;  2WB1 A;  1VQ5 1;  3MZL B;  1VQ9 Z;  4E2X A;  1N8R 2;  5D1O A;  1DL6 A;  3FQQ A;  3NDI A;  2I3C A;  4BY1 I;  1ZB9 A;  1KD1 1;  1Y1V S;  2V3V A;  1ZH1 A;  2QRC B;  3RZO I;  3VB9 A;  1K9M 1;  2JNY A;  2NVQ I;  1Q82 2;  3GTK I;  3CMA Z;  2R92 I;  1Q81 1;  1K8A 1;  3MON A;  2VF1 A;  4NBF A;  4A93 I;  5C4J I;  3CCV Z;  1WZN A;  3S1M I;  2P28 A;  1VQ6 Z;  1I6H I;  4BY7 I;  1YIT Z;  2NVT I;  3IF8 A;  3J81 f;  4BBS I;  2LFU A;  4X6A I;  3M4O I;  1RQF A;  3CXC Z;  3CCQ 1;  1LQL A;  1VQ5 Z;  2RBL A;  3S2H I;  3J81 b;  2VPX A;  2QA4 1;  4NB8 A;  3VMG A;  3CCE Z;  5FLX b;  4HGZ A;  3CCJ 1;  1VQ7 1;  2DE5 A;  3CC4 1;  1KC8 1;  5T6B A;  1YIJ 1;  1SFO I;  3GTO I;  1SIW A;  2V8J A;  2JA8 I;  2E2H I;  3CC2 1;  2JMO A;  1K73 1;  1S7M A;  4QTT A;  3BG0 B;  2IV2 X;  2V45 A;  2VPY A;  4RVH A;  4RV9 A;  1YJW 1;  1NJI 1;  1VQ9 1;  3EER A;  3J7A 4;  3VTN A;  3H3V J;  2VPW A;  1QVF Z;  4RVD A;  3NH8 A;  5LL6 f;  3HKZ A;  3GTQ I;  1Z01 A;  1KRL A;  4NH1 C;  3U50 C;  1RLY A;  2Y0S A;  5CM2 M;  3IFU A;  1RO2 A;  3I56 Z;  2JIO A;  3HOU I;  1Q81 2;  1K8A 2;  3CMA 1;  4RVF A;  1YUA A;  4A3B I;  2OOY B;  2QLV B;  1FDO A;  3KIH A;  4BBR I;  5C44 I;  3CCV 1;  3GCF A;  1QVG Z;  2OTL Z;  1QVF Y;  1QXF A;  1Y1V I;  1TFI A;  2RIQ A;  1VQ6 1;  3G6E 1;  2O4H A;  5AN9 F;  1VQ7 Z;  3IX0 A;  4A3G I;  1JJ2 Y;  1YIJ Z;  1YIT 1;  2G2K A;  3I4N I;  2YAD A;  2GTH A;  1N2F A;  1Q7Y 1;  2LIY A;  2PM9 A;  3VMH A;  4NBA A;  2R7Z I;  1RNI A;  4MRI A;  3VMI A;  1YJW Z;  5T67 A;  2NVX I;  1QVG Y;  4E2Z A;  2NVY I;  3CCE 1;  1KC8 2;  3GTL I;  3S14 I;  2OOX B;  3HOX I;  1Z02 A;  1YJN Z;  4TNU A;  3K7A I;  1KQS Z;  4NBC A;  1K73 2;  2AKL A;  2JA7 I;  1P9N A;  1I50 I;  4Y7N I;  1VQ8 Z;  2YU9 I;  5T64 A;  1NJI 2;  3QWU A;  3GTP I;  3G4S 1;  3S17 I;  1USP B;  1VQL Z;  3LUS A;  5IT9 b;  2WAQ A;  2Q51 A;  3NH5 A;  4MD7 A;  3CPW Z;  3Q87 A;  1QF8 A;  3G6E Z;  2QEX Z;  1Q86 1;  2GTI A;  4E2Y A;  4E32 A;  2EGT A;  5C4X I;  4A3I I;  1Y1W I;  2KPI A;  3CQZ I;  3MZK B;  2AYD A;  2M48 A;  5FLX f;  1WII A;  3I56 1;  2J6A A;  1ML8 A;  3CCL Z;  1VQP Z;  4NB9 A;  4NBH A;  3BG1 B;  2H85 A;  4NBG A;  3F3F C;  2OTL 1;  2BJO A;  2V8I A;  1TWC I;  1Q7Y 2;  4E2W A;  5IP7 I;  2KI7 B;  4MXU A;  1M90 2;  3JAM f;  2IZ3 A;  3S15 I;  3CCS Z;  3CXC Y;  2B63 I;  3G4S Z;  3CD6 Z;  4CL1 A;  2IZ4 A;  3TDH B;  3S1N I;  3JAM b;  2RT9 A;  2E9H A;  1YJN 1;  1YUK A;  3CCU 1;  2M6N A;  4E31 A;  1VQO Z;  2VUG A;  2PMZ A;  2W04 A;  4A3E I;  1VQ8 1;  1YHQ Z;  1X3W A;  3PO3 S;  5FLM I;  3I07 A;  1VQL 1;  3CCM Z;  3NFZ A;  2E2J I;  4DGL A;  4MON A;  3PO2 I;  2QKD A;  4A3J I;  4DQY B;  4MH4 A;  1Q86 2;  3CME Z;  5IP9 I;  2QEX 1;  1L1O C;  3OW2 Z;  2QR1 B;  4BXX I;  1TWH I;  3HOZ I;  1VQM Z;  2DE6 A;  2V8K A;  2P3Y A;  1W2B Z;  1WJ2 A;  1M90 1;  3CCR Z;  3CCL 1;  1VQP 1;  1TWA I;  2E2I I;  3ESW A;  4A3L I;  1YI2 Z;  3GTJ I;  1USP A;  2HF1 A;  2O53 A;  1VQN Z;  3OW2 Y;  2PK7 A;  4A3K I;  3CCU Z;  4DK1 A;  5IT9 f;  2W03 A;  4AYB A;  3J80 f;  2QRE B;  1M1K 1;  2JA5 I;  3CCS 1;  4Y52 I;  4E30 A;  2RHB A;  1NP6 A;  3CD6 1;  3EED A;  3HOY I;  3J80 b;  4EWC A;  2K5R A; 
#chains in the Genus database with same CATH homology
 1VLA A;  3HOW I;  2R93 I;  1YJ9 Z;  2K3R A;  3RZD I;  2R6M A;  3KIF A;  5A2Q f;  3P5J B;  1VQO 1;  1KQS Y;  3GTM S;  2F4O A;  1VQK 1;  1VQ4 Z;  3S1Q I;  1YHQ 1;  5D1O B;  2JUB A;  2OTJ Z;  3CCM 1;  3CC7 Z;  5A2Q b;  1RO4 A;  3CPW Y;  4NBE A;  5D1P A;  4A3F I;  3CME 1;  3T4N B;  1ZB8 A;  1R9T I;  1QYP A;  3G71 Z;  3I55 Z;  4RVG A;  2RPR A;  1VQM 1;  1S72 1;  1TWG I;  4NBB A;  3PO3 I;  2OZK A;  3S2D I;  3CCR 1;  3FKI I;  3S1R I;  2JS4 A;  3NH4 A;  2VUM I;  3S16 I;  1YI2 1;  1N8R 1;  3FQM A;  4HH4 A;  3GTG I;  2GU2 A;  1TWF I;  5C3E I;  1VQN 1;  3GKQ A;  4E33 A;  3D9X A;  3H0G I;  1M1K 2;  1K83 I;  1RO0 A;  4A3C I;  4S1T A;  1VQK Z;  2ZAE B;  1Q82 1;  4NFR A;  4A3D I;  3I4M I;  4XX2 A;  1NUI A;  1KD1 2;  1X0T A;  2JA6 I;  1JJ2 Z;  2DE7 A;  4QTU A;  1K9M 2;  1YJ9 1;  2HU9 A;  4MD8 A;  1S72 Z;  1VQ4 1;  1JWH C;  1X3Z A;  2F4M A;  3CCQ Z;  4HGY A;  3HOV I;  4NBD A;  2JR6 A;  2QA4 Z;  2OTJ 1;  2Q4Z A;  3TE5 B;  1Z03 A;  1PFT A;  4MD9 A;  3M3Y I;  3CC7 1;  1I3Q I;  3CCJ Z;  3NDJ A;  1WCM I;  3CC4 Z;  3G71 1;  3GTM I;  3I55 1;  3F3P C;  4RS4 A;  3CC2 Z;  2QRD B;  4A3M I;  1WW9 A;  3D6W A;  1W2B Y;  4NOZ A;  2WB1 A;  1VQ5 1;  3MZL B;  1VQ9 Z;  4E2X A;  1N8R 2;  5D1O A;  1DL6 A;  3FQQ A;  3NDI A;  2I3C A;  4BY1 I;  1ZB9 A;  1KD1 1;  1Y1V S;  1ZH1 A;  2QRC B;  3RZO I;  3VB9 A;  1K9M 1;  2JNY A;  2NVQ I;  1Q82 2;  3GTK I;  3CMA Z;  2R92 I;  1Q81 1;  1K8A 1;  3MON A;  2VF1 A;  4NBF A;  4A93 I;  5C4J I;  3CCV Z;  3S1M I;  2P28 A;  1VQ6 Z;  1I6H I;  4BY7 I;  1YIT Z;  2NVT I;  3IF8 A;  3J81 f;  4BBS I;  2LFU A;  4X6A I;  3M4O I;  1RQF A;  3CXC Z;  3CCQ 1;  1LQL A;  1VQ5 Z;  2RBL A;  3S2H I;  3J81 b;  2QA4 1;  4NB8 A;  3VMG A;  3CCE Z;  5FLX b;  4HGZ A;  3CCJ 1;  1VQ7 1;  2DE5 A;  3CC4 1;  1KC8 1;  5T6B A;  1YIJ 1;  1SFO I;  3GTO I;  2V8J A;  2JA8 I;  2E2H I;  3CC2 1;  2JMO A;  1K73 1;  1S7M A;  4QTT A;  3BG0 B;  4RVH A;  4RV9 A;  1YJW 1;  1NJI 1;  1VQ9 1;  3EER A;  3J7A 4;  3VTN A;  3H3V J;  1QVF Z;  4RVD A;  3NH8 A;  5LL6 f;  3HKZ A;  3GTQ I;  1Z01 A;  1KRL A;  4NH1 C;  3U50 C;  1RLY A;  2Y0S A;  5CM2 M;  3IFU A;  1RO2 A;  3I56 Z;  3HOU I;  1Q81 2;  1K8A 2;  3CMA 1;  4RVF A;  1YUA A;  4A3B I;  2OOY B;  2QLV B;  3KIH A;  4BBR I;  5C44 I;  3CCV 1;  3GCF A;  1QVG Z;  2OTL Z;  1QVF Y;  1Y1V I;  1TFI A;  2RIQ A;  1VQ6 1;  3G6E 1;  2O4H A;  5AN9 F;  1VQ7 Z;  3IX0 A;  4A3G I;  1JJ2 Y;  1YIJ Z;  1YIT 1;  2G2K A;  3I4N I;  2YAD A;  2GTH A;  1N2F A;  1Q7Y 1;  2LIY A;  2PM9 A;  3VMH A;  4NBA A;  2R7Z I;  1RNI A;  4MRI A;  3VMI A;  1YJW Z;  5T67 A;  2NVX I;  1QVG Y;  4E2Z A;  2NVY I;  3CCE 1;  1KC8 2;  3GTL I;  3S14 I;  2OOX B;  3HOX I;  1Z02 A;  1YJN Z;  4TNU A;  3K7A I;  1KQS Z;  4NBC A;  1K73 2;  2AKL A;  2JA7 I;  1P9N A;  1I50 I;  4Y7N I;  1VQ8 Z;  2YU9 I;  5T64 A;  1NJI 2;  3QWU A;  3GTP I;  3G4S 1;  3S17 I;  1USP B;  1VQL Z;  3LUS A;  5IT9 b;  2WAQ A;  2Q51 A;  3NH5 A;  4MD7 A;  3CPW Z;  3Q87 A;  1QF8 A;  3G6E Z;  2QEX Z;  1Q86 1;  2GTI A;  4E2Y A;  4E32 A;  2EGT A;  5C4X I;  4A3I I;  1Y1W I;  2KPI A;  3CQZ I;  3MZK B;  2M48 A;  5FLX f;  1WII A;  3I56 1;  2J6A A;  1ML8 A;  3CCL Z;  1VQP Z;  4NB9 A;  4NBH A;  3BG1 B;  2H85 A;  4NBG A;  3F3F C;  2OTL 1;  2BJO A;  2V8I A;  1TWC I;  1Q7Y 2;  4E2W A;  5IP7 I;  2KI7 B;  4MXU A;  1M90 2;  3JAM f;  2IZ3 A;  3S15 I;  3CCS Z;  3CXC Y;  2B63 I;  3G4S Z;  3CD6 Z;  4CL1 A;  2IZ4 A;  3TDH B;  3S1N I;  3JAM b;  2RT9 A;  2E9H A;  1YJN 1;  1YUK A;  3CCU 1;  2M6N A;  4E31 A;  1VQO Z;  2VUG A;  2PMZ A;  2W04 A;  4A3E I;  1VQ8 1;  1YHQ Z;  1X3W A;  3PO3 S;  5FLM I;  3I07 A;  1VQL 1;  3CCM Z;  3NFZ A;  2E2J I;  4DGL A;  4MON A;  3PO2 I;  2QKD A;  4A3J I;  4DQY B;  4MH4 A;  1Q86 2;  3CME Z;  5IP9 I;  2QEX 1;  1L1O C;  3OW2 Z;  2QR1 B;  4BXX I;  1TWH I;  3HOZ I;  1VQM Z;  2DE6 A;  2V8K A;  2P3Y A;  1W2B Z;  1M90 1;  3CCR Z;  3CCL 1;  1VQP 1;  1TWA I;  2E2I I;  3ESW A;  4A3L I;  1YI2 Z;  3GTJ I;  1USP A;  2HF1 A;  2O53 A;  1VQN Z;  3OW2 Y;  2PK7 A;  4A3K I;  3CCU Z;  4DK1 A;  5IT9 f;  2W03 A;  4AYB A;  3J80 f;  2QRE B;  1M1K 1;  2JA5 I;  3CCS 1;  4Y52 I;  4E30 A;  2RHB A;  1NP6 A;  3CD6 1;  3EED A;  3HOY I;  3J80 b;  4EWC A;  2K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...