1JJ2Z

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Z00
3I561 1Q811 1K9M1 1VQK1 1KD12 3I55Z 1KC81 3CD61 1VQNZ 1Q862 3CPWZ 1VQP1 3CCVZ 3CCM1 3CMEZ 1QVFY 1YIJ1 3CCE1 1KD11 1YJ9Z 1VQ51 3CC21 1YITZ 2OTL1 3G711 1K731 1S721 1M902 3CC41 1VQ6Z 3G4S1 1JJ2Y 1NJI2 1VQ7Z 1QVGY 3CCUZ 1Q7Y2 1VQ41 1M1K2 1K8A1 1YJNZ 1KQSZ 3CCJZ 1Q822 1YI21 3I551 3CCQZ 3CXCZ 1VQMZ 3CCS1 2QEX1 3OW2Z 1N8R2 1NJI1 3I56Z 1VQN1 3CCRZ 3CCLZ 1W2BZ 1VQOZ 1VQKZ 1VQ81 3CMAZ 1YHQ1 2QA4Z 1YJW1 2OTJZ 1Q861 3G6EZ 3CC71 1VQ61 3CCMZ 1VQLZ 1Q812 1YIJZ 1K9M2 1VQ5Z 1KQSY 3G71Z 1KC82 3CC4Z 1VQ9Z 1M901 3G4SZ 3CCJ1 3CPWY 1JJ2Z 3OW2Y 3CCV1 1VQM1 1VQ4Z 1Q7Y1 1M1K1 3CCR1 3CCL1 3CD6Z 3CME1 1VQO1 3CMA1 1YI2Z 1Q821 1VQPZ 1YJ91 3CCSZ 1K732 2QEXZ 1YIT1 2QA41 2OTJ1 1N8R1 1VQ8Z 1VQ71 3CCU1 3CCEZ 1QVFZ 3G6E1 1YHQZ 3CC2Z 1K8A2 2OTLZ 1VQL1 1S72Z 1YJWZ 1YJN1 3CXCY 3CC7Z 3CCQ1 1QVGZ 1VQ91 1W2BY
chains in the Genus database with same CATH superfamily
3I561 2PK7A 1KRLA 1VQK1 2KI7B 2V45A 1KC81 2YU9I 1VLAA 1NP6A 5D1OB 1Q862 3CCVZ 2NVTI 1TWHI 5D1PA 1QVFY 3H0GI 4E2YA 1YJ9Z 3CC21 1Y1VS 2OTL1 3GCFA 1S721 1M902 3NH5A 4NB9A 1JJ2Y 2R7ZI 2E2HI 1Q7Y2 1I3QI 3NDIA 3M4OI 2OOXB 1RO0A 3BG1B 4A3BI 1Z01A 4NBDA 3I551 2RBLA 3CCQZ 1VQMZ 5AN9F 1N8R2 4DQYB 4HGZA 1VQN1 1W2BZ 3T4NB 3U50C 4EWCA 3GTJI 4HH4A 3IR7A 2OTJZ 1P9NA 3F3FC 3J80f 1Q861 3D2LA 3S14I 2K3RA 1YUKA 3G6EZ 1VQ61 2H85A 4S1TA 3CCMZ 4NBHA 1Q812 1YIJZ 4MONA 2OZKA 3Q87A 5IP9I 1KQSY 3G71Z 3CC4Z 1VQ9Z 1M901 2PM9A 3G4SZ 3HKZA 3CCJ1 1Z03A 1S7MA 2NVXI 4A3LI 4A3FI 1RLYA 1VQ4Z 4MD7A 1Q7Y1 1QYPA 2JIMA 3HOZI 5FLXf 2Q51A 3CCR1 4XX2A 4MH4A 4BBSI 4X6AI 3CD6Z 3CME1 1ZB8A 3CMA1 1YI2Z 3HOVI 4E30A 3TDHB 2QEXZ 1YIT1 1Q16A 1JWHC 1N8R1 4E32A 2RT9A 1VQ8Z 2JIOA 1QVFZ 3PO3I 1VQL1 1YJWZ 2DE6A 2QLVB 3NFZA 3P5JB 3QWUA 3PO2I 2V8KA 3RZDI 1W2BY 1Q811 2WAQA 3GTGI 2NAPA 2QRDB 4MRIA 3GTMS 3K7AI 2M48A 2JS4A 3JAMf 2K5RA 3VMHA 1YUAA 4A3JI 3MZKB 2VPZA 3MONA 2DE7A 1ZH1A 2JA7I 1N2FA 1Y1VI 2QKDA 3S2HI 3CCE1 1KD11 3NDJA 1WCMI 1L1OC 2Y0SA 2JIQA 5CM2M 1KQSZ 1WIIA 2HU9A 1USPA 3CXCZ 3HOUI 3CCS1 2V8IA 1I6HI 4RVFA 3I56Z 1VQKZ 2RIQA 3FQQA 1YHQ1 5T6BA 2JIPA 3NH4A 1Z02A 1K83I 1RQFA 2E9HA 1TWAI 2G2KA 2JNYA 2GU2A 2W03A 2VPYA 1K9M2 1R9TI 2JA8I 5C4JI 2VUMI 2E2II 4NBCA 1QXFA 2F4MA 3J80b 1VQM1 3NH8A 1VQPZ 4A93I 3IX0A 4NB8A 4A3GI 1K732 4A3CI 4CL1A 2I3CA 2JA6I 2OTJ1 3GTLI 2DE5A 1VQ71 3KIHA 3CCU1 3GTOI 3G6E1 1X3WA 3S17I 1TFIA 1YJN1 1Y8CA 2J6AA 4NBBA 4TNUA 5FLXb 5T67A 3CXCY 1FDIA 3BG0B 4E2XA 1VQ91 5A2Qf 3HOXI 2KPIA 5LL6f 3I4MI 1K9M1 3GTMI 1KD12 4BY1I 1Y1WI 1I50I 4RVDA 3CD61 4RS4A 5FLMI 3FQMA 3S15I 4MXUA 3J7A4 1ML8A 2BJOA 4E33A 3CMEZ 4BBRI 1AA6A 4NBEA 1VQ51 2JR6A 1YITZ 1K731 5C4XI 4E2ZA 3FKII 1WJ2A 4AYBA 3JAMb 3HOYI 2V3VA 5IT9f 1M1K2 3S16I 2IV2X 5D1OA 4DGLA 1X0TA 1NJI1 3GTKI 3CCLZ 1VQOZ 2E2JI 3J81f 1ZB9A 2QA4Z 3I4NI 4DK1A 3CC71 4E2WA 2NVYI 4QTUA 1PFTA 3VB9A 4A3MI 1DL6A 2OOYB 4NFRA 2B63I 1SIWA 3OW2Y 3CCV1 3MZLB 2QREB 1M1K1 4Y7NI 4HGYA 1TWCI 1QF8A 4A3II 2V8JA 1YJ91 3CCSZ 1WZNA 2W04A 4RVGA 2RPRA 1TWFI 1RO4A 3H3VJ 1YHQZ 3CC2Z 2M6NA 1K8A2 2OTLZ 3HOWI 1S72Z 2AKLA 3ESWA 3CQZI 4BY7I 2LEXA 5C3EI 3VTNA 3RZOI 3CCQ1 2RHBA 2R92I 2JA5I 2P3YA 2VF1A 2P28A 2Q4ZA 4E31A 3I55Z 4A3KI 3S1NI 2LFUA 5IP7I 1USPB 2IZ4A 1VQNZ 1WW9A 3CPWZ 1VQP1 2ZAEB 2JIRA 4NBGA 3F3PC 3M3YI 3CCM1 5A2Qb 2O53A 1YIJ1 3GTQI 3G711 3I07A 3IFUA 3CC41 1VQ6Z 4RVHA 3G4S1 1RNIA 1NJI2 4A3DI 1VQ7Z 1QVGY 3CCUZ 1RO2A 4BXXI 1TWGI 3IF8A 2NVQI 2F4OA 2VPXA 1NUIA 1VQ41 2R6MA 1K8A1 4NOZA 1YJNZ 3KIFA 3CCJZ 2E7ZA 1Q822 1YI21 1FDOA 3S1MI 4NBFA 2QEX1 3OW2Z 3LUSA 2QRCB 1SFOI 2JUBA 3CCRZ 4RV9A 1VQ81 2O4HA 3CMAZ 1LQLA 2JMOA 5C44I 3S2DI 5IT9b 1YJW1 4MD9A 4QTTA 2WB1A 3D9XA 3GTPI 3D6WA 1X3ZA 1VQLZ 2GTIA 4A3EI 1VQ5Z 3VMIA 1KC82 3S1QI 2PMZA 4MD8A 3J81b 3CPWY 1JJ2Z 2VUGA 2EGTA 2AYDA 3S1RI 3CCL1 1VQO1 1Q821 3EEDA 2QA41 2YADA 2VPWA 2R93I 2LIYA 2HF1A 3CCEZ 2GTHA 2IZ3A 3TE5B 2QR1B 3EERA 4NH1C 3GKQA 4NBAA 3PO3S 4Y52I 3VMGA 5T64A 3CC7Z 1QVGZ
chains in the Genus database with same CATH topology
3I561 2PK7A 1KRLA 1VQK1 2KI7B 1KC81 2YU9I 1VLAA 1NP6A 5D1OB 1Q862 3CCVZ 2NVTI 1TWHI 5D1PA 1QVFY 3H0GI 4E2YA 1YJ9Z 3CC21 1Y1VS 2OTL1 3GCFA 1S721 1M902 3NH5A 4NB9A 1JJ2Y 2R7ZI 2E2HI 1Q7Y2 1I3QI 3NDIA 3M4OI 2OOXB 1RO0A 3BG1B 4A3BI 1Z01A 4NBDA 3I551 2RBLA 3CCQZ 1VQMZ 5AN9F 1N8R2 4DQYB 4HGZA 1VQN1 1W2BZ 3T4NB 3U50C 4EWCA 3GTJI 4HH4A 2OTJZ 1P9NA 3F3FC 3J80f 1Q861 3S14I 2K3RA 1YUKA 3G6EZ 1VQ61 2H85A 4S1TA 3CCMZ 4NBHA 1Q812 1YIJZ 4MONA 2OZKA 3Q87A 5IP9I 1KQSY 3G71Z 3CC4Z 1VQ9Z 1M901 2PM9A 3G4SZ 3HKZA 3CCJ1 1Z03A 1S7MA 2NVXI 4A3LI 4A3FI 1RLYA 1VQ4Z 4MD7A 1Q7Y1 1QYPA 3HOZI 5FLXf 2Q51A 3CCR1 4XX2A 4MH4A 4BBSI 4X6AI 3CD6Z 3CME1 1ZB8A 3CMA1 1YI2Z 3HOVI 4E30A 3TDHB 2QEXZ 1YIT1 1JWHC 1N8R1 4E32A 2RT9A 1VQ8Z 1QVFZ 3PO3I 1VQL1 1YJWZ 2DE6A 2QLVB 3NFZA 3P5JB 3QWUA 3PO2I 2V8KA 3RZDI 1W2BY 1Q811 2WAQA 3GTGI 2QRDB 4MRIA 3GTMS 3K7AI 2M48A 2JS4A 3JAMf 2K5RA 3VMHA 1YUAA 4A3JI 3MZKB 3MONA 2DE7A 1ZH1A 2JA7I 1N2FA 1Y1VI 2QKDA 3S2HI 3CCE1 1KD11 3NDJA 1WCMI 1L1OC 2Y0SA 5CM2M 1KQSZ 1WIIA 2HU9A 1USPA 3CXCZ 3HOUI 3CCS1 2V8IA 1I6HI 4RVFA 3I56Z 1VQKZ 2RIQA 3FQQA 1YHQ1 5T6BA 3NH4A 1Z02A 1K83I 1RQFA 2E9HA 1TWAI 2G2KA 2JNYA 2GU2A 2W03A 1K9M2 1R9TI 2JA8I 5C4JI 2VUMI 2E2II 4NBCA 2F4MA 3J80b 1VQM1 3NH8A 1VQPZ 4A93I 3IX0A 4NB8A 4A3GI 1K732 4A3CI 4CL1A 2I3CA 2JA6I 2OTJ1 3GTLI 2DE5A 1VQ71 3KIHA 3CCU1 3GTOI 3G6E1 1X3WA 3S17I 1TFIA 1YJN1 2J6AA 4NBBA 4TNUA 5FLXb 5T67A 3CXCY 3BG0B 4E2XA 1VQ91 5A2Qf 3HOXI 2KPIA 5LL6f 3I4MI 1K9M1 3GTMI 1KD12 4BY1I 1Y1WI 1I50I 4RVDA 3CD61 4RS4A 5FLMI 3FQMA 3S15I 4MXUA 3J7A4 1ML8A 2BJOA 4E33A 3CMEZ 4BBRI 4NBEA 1VQ51 2JR6A 1YITZ 1K731 5C4XI 4E2ZA 3FKII 4AYBA 3JAMb 3HOYI 5IT9f 1M1K2 3S16I 5D1OA 4DGLA 1X0TA 1NJI1 3GTKI 3CCLZ 1VQOZ 2E2JI 3J81f 1ZB9A 2QA4Z 3I4NI 4DK1A 3CC71 4E2WA 2NVYI 4QTUA 1PFTA 3VB9A 4A3MI 1DL6A 2OOYB 4NFRA 2B63I 3OW2Y 3CCV1 3MZLB 2QREB 1M1K1 4Y7NI 4HGYA 1TWCI 1QF8A 4A3II 2V8JA 1YJ91 3CCSZ 2W04A 4RVGA 2RPRA 1TWFI 1RO4A 3H3VJ 1YHQZ 3CC2Z 2M6NA 1K8A2 2OTLZ 3HOWI 1S72Z 2AKLA 3ESWA 3CQZI 4BY7I 5C3EI 3VTNA 3RZOI 3CCQ1 2RHBA 2R92I 2JA5I 2P3YA 2VF1A 2P28A 2Q4ZA 4E31A 3I55Z 4A3KI 3S1NI 2LFUA 5IP7I 1USPB 2IZ4A 1VQNZ 1WW9A 3CPWZ 1VQP1 2ZAEB 4NBGA 3F3PC 3M3YI 3CCM1 5A2Qb 2O53A 1YIJ1 3GTQI 3G711 3I07A 3IFUA 3CC41 1VQ6Z 4RVHA 3G4S1 1RNIA 1NJI2 4A3DI 1VQ7Z 1QVGY 3CCUZ 1RO2A 4BXXI 1TWGI 3IF8A 2NVQI 2F4OA 1NUIA 1VQ41 2R6MA 1K8A1 4NOZA 1YJNZ 3KIFA 3CCJZ 1Q822 1YI21 3S1MI 4NBFA 2QEX1 3OW2Z 3LUSA 2QRCB 1SFOI 2JUBA 3CCRZ 4RV9A 1VQ81 2O4HA 3CMAZ 1LQLA 2JMOA 5C44I 3S2DI 5IT9b 1YJW1 4MD9A 4QTTA 2WB1A 3D9XA 3GTPI 3D6WA 1X3ZA 1VQLZ 2GTIA 4A3EI 1VQ5Z 3VMIA 1KC82 3S1QI 2PMZA 4MD8A 3J81b 3CPWY 1JJ2Z 2VUGA 2EGTA 3S1RI 3CCL1 1VQO1 1Q821 3EEDA 2QA41 2YADA 2R93I 2LIYA 2HF1A 3CCEZ 2GTHA 2IZ3A 3TE5B 2QR1B 3EERA 4NH1C 3GKQA 4NBAA 3PO3S 4Y52I 3VMGA 5T64A 3CC7Z 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 1;  1Q81 1;  1K9M 1;  1VQK 1;  1KD1 2;  3I55 Z;  1KC8 1;  3CD6 1;  1VQN Z;  1Q86 2;  3CPW Z;  1VQP 1;  3CCV Z;  3CCM 1;  3CME Z;  1QVF Y;  1YIJ 1;  3CCE 1;  1KD1 1;  1YJ9 Z;  1VQ5 1;  3CC2 1;  1YIT Z;  2OTL 1;  3G71 1;  1K73 1;  1S72 1;  1M90 2;  3CC4 1;  1VQ6 Z;  3G4S 1;  1JJ2 Y;  1NJI 2;  1VQ7 Z;  1QVG Y;  3CCU Z;  1Q7Y 2;  1VQ4 1;  1M1K 2;  1K8A 1;  1YJN Z;  1KQS Z;  3CCJ Z;  1Q82 2;  1YI2 1;  3I55 1;  3CCQ Z;  3CXC Z;  1VQM Z;  3CCS 1;  2QEX 1;  3OW2 Z;  1N8R 2;  1NJI 1;  3I56 Z;  1VQN 1;  3CCR Z;  3CCL Z;  1W2B Z;  1VQO Z;  1VQK Z;  1VQ8 1;  3CMA Z;  1YHQ 1;  2QA4 Z;  1YJW 1;  2OTJ Z;  1Q86 1;  3G6E Z;  3CC7 1;  1VQ6 1;  3CCM Z;  1VQL Z;  1Q81 2;  1YIJ Z;  1K9M 2;  1VQ5 Z;  1KQS Y;  3G71 Z;  1KC8 2;  3CC4 Z;  1VQ9 Z;  1M90 1;  3G4S Z;  3CCJ 1;  3CPW Y;  1JJ2 Z;  3OW2 Y;  3CCV 1;  1VQM 1;  1VQ4 Z;  1Q7Y 1;  1M1K 1;  3CCR 1;  3CCL 1;  3CD6 Z;  3CME 1;  1VQO 1;  3CMA 1;  1YI2 Z;  1Q82 1;  1VQP Z;  1YJ9 1;  3CCS Z;  1K73 2;  2QEX Z;  1YIT 1;  2QA4 1;  2OTJ 1;  1N8R 1;  1VQ8 Z;  1VQ7 1;  3CCU 1;  3CCE Z;  1QVF Z;  3G6E 1;  1YHQ Z;  3CC2 Z;  1K8A 2;  2OTL Z;  1VQL 1;  1S72 Z;  1YJW Z;  1YJN 1;  3CXC Y;  3CC7 Z;  3CCQ 1;  1QVG Z;  1VQ9 1;  1W2B Y; 
#chains in the Genus database with same CATH topology
 3I56 1;  2PK7 A;  1KRL A;  1VQK 1;  2KI7 B;  2V45 A;  1KC8 1;  2YU9 I;  1VLA A;  1NP6 A;  5D1O B;  1Q86 2;  3CCV Z;  2NVT I;  1TWH I;  5D1P A;  1QVF Y;  3H0G I;  4E2Y A;  1YJ9 Z;  3CC2 1;  1Y1V S;  2OTL 1;  3GCF A;  1S72 1;  1M90 2;  3NH5 A;  4NB9 A;  1JJ2 Y;  2R7Z I;  2E2H I;  1Q7Y 2;  1I3Q I;  3NDI A;  3M4O I;  2OOX B;  1RO0 A;  3BG1 B;  4A3B I;  1Z01 A;  4NBD A;  3I55 1;  2RBL A;  3CCQ Z;  1VQM Z;  5AN9 F;  1N8R 2;  4DQY B;  4HGZ A;  1VQN 1;  1W2B Z;  3T4N B;  3U50 C;  4EWC A;  3GTJ I;  4HH4 A;  3IR7 A;  2OTJ Z;  1P9N A;  3F3F C;  3J80 f;  1Q86 1;  3D2L A;  3S14 I;  2K3R A;  1YUK A;  3G6E Z;  1VQ6 1;  2H85 A;  4S1T A;  3CCM Z;  4NBH A;  1Q81 2;  1YIJ Z;  4MON A;  2OZK A;  3Q87 A;  5IP9 I;  1KQS Y;  3G71 Z;  3CC4 Z;  1VQ9 Z;  1M90 1;  2PM9 A;  3G4S Z;  3HKZ A;  3CCJ 1;  1Z03 A;  1S7M A;  2NVX I;  4A3L I;  4A3F I;  1RLY A;  1VQ4 Z;  4MD7 A;  1Q7Y 1;  1QYP A;  2JIM A;  3HOZ I;  5FLX f;  2Q51 A;  3CCR 1;  4XX2 A;  4MH4 A;  4BBS I;  4X6A I;  3CD6 Z;  3CME 1;  1ZB8 A;  3CMA 1;  1YI2 Z;  3HOV I;  4E30 A;  3TDH B;  2QEX Z;  1YIT 1;  1Q16 A;  1JWH C;  1N8R 1;  4E32 A;  2RT9 A;  1VQ8 Z;  2JIO A;  1QVF Z;  3PO3 I;  1VQL 1;  1YJW Z;  2DE6 A;  2QLV B;  3NFZ A;  3P5J B;  3QWU A;  3PO2 I;  2V8K A;  3RZD I;  1W2B Y;  1Q81 1;  2WAQ A;  3GTG I;  2NAP A;  2QRD B;  4MRI A;  3GTM S;  3K7A I;  2M48 A;  2JS4 A;  3JAM f;  2K5R A;  3VMH A;  1YUA A;  4A3J I;  3MZK B;  2VPZ A;  3MON A;  2DE7 A;  1ZH1 A;  2JA7 I;  1N2F A;  1Y1V I;  2QKD A;  3S2H I;  3CCE 1;  1KD1 1;  3NDJ A;  1WCM I;  1L1O C;  2Y0S A;  2JIQ A;  5CM2 M;  1KQS Z;  1WII A;  2HU9 A;  1USP A;  3CXC Z;  3HOU I;  3CCS 1;  2V8I A;  1I6H I;  4RVF A;  3I56 Z;  1VQK Z;  2RIQ A;  3FQQ A;  1YHQ 1;  5T6B A;  2JIP A;  3NH4 A;  1Z02 A;  1K83 I;  1RQF A;  2E9H A;  1TWA I;  2G2K A;  2JNY A;  2GU2 A;  2W03 A;  2VPY A;  1K9M 2;  1R9T I;  2JA8 I;  5C4J I;  2VUM I;  2E2I I;  4NBC A;  1QXF A;  2F4M A;  3J80 b;  1VQM 1;  3NH8 A;  1VQP Z;  4A93 I;  3IX0 A;  4NB8 A;  4A3G I;  1K73 2;  4A3C I;  4CL1 A;  2I3C A;  2JA6 I;  2OTJ 1;  3GTL I;  2DE5 A;  1VQ7 1;  3KIH A;  3CCU 1;  3GTO I;  3G6E 1;  1X3W A;  3S17 I;  1TFI A;  1YJN 1;  1Y8C A;  2J6A A;  4NBB A;  4TNU A;  5FLX b;  5T67 A;  3CXC Y;  1FDI A;  3BG0 B;  4E2X A;  1VQ9 1;  5A2Q f;  3HOX I;  2KPI A;  5LL6 f;  3I4M I;  1K9M 1;  3GTM I;  1KD1 2;  4BY1 I;  1Y1W I;  1I50 I;  4RVD A;  3CD6 1;  4RS4 A;  5FLM I;  3FQM A;  3S15 I;  4MXU A;  3J7A 4;  1ML8 A;  2BJO A;  4E33 A;  3CME Z;  4BBR I;  1AA6 A;  4NBE A;  1VQ5 1;  2JR6 A;  1YIT Z;  1K73 1;  5C4X I;  4E2Z A;  3FKI I;  1WJ2 A;  4AYB A;  3JAM b;  3HOY I;  2V3V A;  5IT9 f;  1M1K 2;  3S16 I;  2IV2 X;  5D1O A;  4DGL A;  1X0T A;  1NJI 1;  3GTK I;  3CCL Z;  1VQO Z;  2E2J I;  3J81 f;  1ZB9 A;  2QA4 Z;  3I4N I;  4DK1 A;  3CC7 1;  4E2W A;  2NVY I;  4QTU A;  1PFT A;  3VB9 A;  4A3M I;  1DL6 A;  2OOY B;  4NFR A;  2B63 I;  1SIW A;  3OW2 Y;  3CCV 1;  3MZL B;  2QRE B;  1M1K 1;  4Y7N I;  4HGY A;  1TWC I;  1QF8 A;  4A3I I;  2V8J A;  1YJ9 1;  3CCS Z;  1WZN A;  2W04 A;  4RVG A;  2RPR A;  1TWF I;  1RO4 A;  3H3V J;  1YHQ Z;  3CC2 Z;  2M6N A;  1K8A 2;  2OTL Z;  3HOW I;  1S72 Z;  2AKL A;  3ESW A;  3CQZ I;  4BY7 I;  2LEX A;  5C3E I;  3VTN A;  3RZO I;  3CCQ 1;  2RHB A;  2R92 I;  2JA5 I;  2P3Y A;  2VF1 A;  2P28 A;  2Q4Z A;  4E31 A;  3I55 Z;  4A3K I;  3S1N I;  2LFU A;  5IP7 I;  1USP B;  2IZ4 A;  1VQN Z;  1WW9 A;  3CPW Z;  1VQP 1;  2ZAE B;  2JIR A;  4NBG A;  3F3P C;  3M3Y I;  3CCM 1;  5A2Q b;  2O53 A;  1YIJ 1;  3GTQ I;  3G71 1;  3I07 A;  3IFU A;  3CC4 1;  1VQ6 Z;  4RVH A;  3G4S 1;  1RNI A;  1NJI 2;  4A3D I;  1VQ7 Z;  1QVG Y;  3CCU Z;  1RO2 A;  4BXX I;  1TWG I;  3IF8 A;  2NVQ I;  2F4O A;  2VPX A;  1NUI A;  1VQ4 1;  2R6M A;  1K8A 1;  4NOZ A;  1YJN Z;  3KIF A;  3CCJ Z;  2E7Z A;  1Q82 2;  1YI2 1;  1FDO A;  3S1M I;  4NBF A;  2QEX 1;  3OW2 Z;  3LUS A;  2QRC B;  1SFO I;  2JUB A;  3CCR Z;  4RV9 A;  1VQ8 1;  2O4H A;  3CMA Z;  1LQL A;  2JMO A;  5C44 I;  3S2D I;  5IT9 b;  1YJW 1;  4MD9 A;  4QTT A;  2WB1 A;  3D9X A;  3GTP I;  3D6W A;  1X3Z A;  1VQL Z;  2GTI A;  4A3E I;  1VQ5 Z;  3VMI A;  1KC8 2;  3S1Q I;  2PMZ A;  4MD8 A;  3J81 b;  3CPW Y;  1JJ2 Z;  2VUG A;  2EGT A;  2AYD A;  3S1R I;  3CCL 1;  1VQO 1;  1Q82 1;  3EED A;  2QA4 1;  2YAD A;  2VPW A;  2R93 I;  2LIY A;  2HF1 A;  3CCE Z;  2GTH A;  2IZ3 A;  3TE5 B;  2QR1 B;  3EER A;  4NH1 C;  3GKQ A;  4NBA A;  3PO3 S;  4Y52 I;  3VMG A;  5T64 A;  3CC7 Z;  1QVG Z; 
#chains in the Genus database with same CATH homology
 3I56 1;  2PK7 A;  1KRL A;  1VQK 1;  2KI7 B;  1KC8 1;  2YU9 I;  1VLA A;  1NP6 A;  5D1O B;  1Q86 2;  3CCV Z;  2NVT I;  1TWH I;  5D1P A;  1QVF Y;  3H0G I;  4E2Y A;  1YJ9 Z;  3CC2 1;  1Y1V S;  2OTL 1;  3GCF A;  1S72 1;  1M90 2;  3NH5 A;  4NB9 A;  1JJ2 Y;  2R7Z I;  2E2H I;  1Q7Y 2;  1I3Q I;  3NDI A;  3M4O I;  2OOX B;  1RO0 A;  3BG1 B;  4A3B I;  1Z01 A;  4NBD A;  3I55 1;  2RBL A;  3CCQ Z;  1VQM Z;  5AN9 F;  1N8R 2;  4DQY B;  4HGZ A;  1VQN 1;  1W2B Z;  3T4N B;  3U50 C;  4EWC A;  3GTJ I;  4HH4 A;  2OTJ Z;  1P9N A;  3F3F C;  3J80 f;  1Q86 1;  3S14 I;  2K3R A;  1YUK A;  3G6E Z;  1VQ6 1;  2H85 A;  4S1T A;  3CCM Z;  4NBH A;  1Q81 2;  1YIJ Z;  4MON A;  2OZK A;  3Q87 A;  5IP9 I;  1KQS Y;  3G71 Z;  3CC4 Z;  1VQ9 Z;  1M90 1;  2PM9 A;  3G4S Z;  3HKZ A;  3CCJ 1;  1Z03 A;  1S7M A;  2NVX I;  4A3L I;  4A3F I;  1RLY A;  1VQ4 Z;  4MD7 A;  1Q7Y 1;  1QYP A;  3HOZ I;  5FLX f;  2Q51 A;  3CCR 1;  4XX2 A;  4MH4 A;  4BBS I;  4X6A I;  3CD6 Z;  3CME 1;  1ZB8 A;  3CMA 1;  1YI2 Z;  3HOV I;  4E30 A;  3TDH B;  2QEX Z;  1YIT 1;  1JWH C;  1N8R 1;  4E32 A;  2RT9 A;  1VQ8 Z;  1QVF Z;  3PO3 I;  1VQL 1;  1YJW Z;  2DE6 A;  2QLV B;  3NFZ A;  3P5J B;  3QWU A;  3PO2 I;  2V8K A;  3RZD I;  1W2B Y;  1Q81 1;  2WAQ A;  3GTG I;  2QRD B;  4MRI A;  3GTM S;  3K7A I;  2M48 A;  2JS4 A;  3JAM f;  2K5R A;  3VMH A;  1YUA A;  4A3J I;  3MZK B;  3MON A;  2DE7 A;  1ZH1 A;  2JA7 I;  1N2F A;  1Y1V I;  2QKD A;  3S2H I;  3CCE 1;  1KD1 1;  3NDJ A;  1WCM I;  1L1O C;  2Y0S A;  5CM2 M;  1KQS Z;  1WII A;  2HU9 A;  1USP A;  3CXC Z;  3HOU I;  3CCS 1;  2V8I A;  1I6H I;  4RVF A;  3I56 Z;  1VQK Z;  2RIQ A;  3FQQ A;  1YHQ 1;  5T6B A;  3NH4 A;  1Z02 A;  1K83 I;  1RQF A;  2E9H A;  1TWA I;  2G2K A;  2JNY A;  2GU2 A;  2W03 A;  1K9M 2;  1R9T I;  2JA8 I;  5C4J I;  2VUM I;  2E2I I;  4NBC A;  2F4M A;  3J80 b;  1VQM 1;  3NH8 A;  1VQP Z;  4A93 I;  3IX0 A;  4NB8 A;  4A3G I;  1K73 2;  4A3C I;  4CL1 A;  2I3C A;  2JA6 I;  2OTJ 1;  3GTL I;  2DE5 A;  1VQ7 1;  3KIH A;  3CCU 1;  3GTO I;  3G6E 1;  1X3W A;  3S17 I;  1TFI A;  1YJN 1;  2J6A A;  4NBB A;  4TNU A;  5FLX b;  5T67 A;  3CXC Y;  3BG0 B;  4E2X A;  1VQ9 1;  5A2Q f;  3HOX I;  2KPI A;  5LL6 f;  3I4M I;  1K9M 1;  3GTM I;  1KD1 2;  4BY1 I;  1Y1W I;  1I50 I;  4RVD A;  3CD6 1;  4RS4 A;  5FLM I;  3FQM A;  3S15 I;  4MXU A;  3J7A 4;  1ML8 A;  2BJO A;  4E33 A;  3CME Z;  4BBR I;  4NBE A;  1VQ5 1;  2JR6 A;  1YIT Z;  1K73 1;  5C4X I;  4E2Z A;  3FKI I;  4AYB A;  3JAM b;  3HOY I;  5IT9 f;  1M1K 2;  3S16 I;  5D1O A;  4DGL A;  1X0T A;  1NJI 1;  3GTK I;  3CCL Z;  1VQO Z;  2E2J I;  3J81 f;  1ZB9 A;  2QA4 Z;  3I4N I;  4DK1 A;  3CC7 1;  4E2W A;  2NVY I;  4QTU A;  1PFT A;  3VB9 A;  4A3M I;  1DL6 A;  2OOY B;  4NFR A;  2B63 I;  3OW2 Y;  3CCV 1;  3MZL B;  2QRE B;  1M1K 1;  4Y7N I;  4HGY A;  1TWC I;  1QF8 A;  4A3I I;  2V8J A;  1YJ9 1;  3CCS Z;  2W04 A;  4RVG A;  2RPR A;  1TWF I;  1RO4 A;  3H3V J;  1YHQ Z;  3CC2 Z;  2M6N A;  1K8A 2;  2OTL Z;  3HOW I;  1S72 Z;  2AKL A;  3ESW A;  3CQZ I;  4BY7 I;  5C3E I;  3VTN A;  3RZO I;  3CCQ 1;  2RHB A;  2R92 I;  2JA5 I;  2P3Y A;  2VF1 A;  2P28 A;  2Q4Z A;  4E31 A;  3I55 Z;  4A3K I;  3S1N I;  2LFU A;  5IP7 I;  1USP B;  2IZ4 A;  1VQN Z;  1WW9 A;  3CPW Z;  1VQP 1;  2ZAE B;  4NBG A;  3F3P C;  3M3Y I;  3CCM 1;  5A2Q b;  2O53 A;  1YIJ 1;  3GTQ I;  3G71 1;  3I07 A;  3IFU A;  3CC4 1;  1VQ6 Z;  4RVH A;  3G4S 1;  1RNI A;  1NJI 2;  4A3D I;  1VQ7 Z;  1QVG Y;  3CCU Z;  1RO2 A;  4BXX I;  1TWG I;  3IF8 A;  2NVQ I;  2F4O A;  1NUI A;  1VQ4 1;  2R6M A;  1K8A 1;  4NOZ A;  1YJN Z;  3KIF A;  3CCJ Z;  1Q82 2;  1YI2 1;  3S1M I;  4NBF A;  2QEX 1;  3OW2 Z;  3LUS A;  2QRC B;  1SFO I;  2JUB A;  3CCR Z;  4RV9 A;  1VQ8 1;  2O4H A;  3CMA Z;  1LQL A;  2JMO A;  5C44 I;  3S2D I;  5IT9 b;  1YJW 1;  4MD9 A;  4QTT A;  2WB1 A;  3D9X A;  3GTP I;  3D6W A;  1X3Z A;  1VQL Z;  2GTI A;  4A3E I;  1VQ5 Z;  3VMI A;  1KC8 2;  3S1Q I;  2PMZ A;  4MD8 A;  3J81 b;  3CPW Y;  1JJ2 Z;  2VUG A;  2EGT A;  3S1R I;  3CCL 1;  1VQO 1;  1Q82 1;  3EED A;  2QA4 1;  2YAD A;  2R93 I;  2LIY A;  2HF1 A;  3CCE Z;  2GTH A;  2IZ3 A;  3TE5 B;  2QR1 B;  3EER A;  4NH1 C;  3GKQ A;  4NBA A;  3PO3 S;  4Y52 I;  3VMG A;  5T64 A;  3CC7 Z;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...