1JJ2Z

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Z00
1YJWZ 2QEX1 1QVGY 1YITZ 3CXCZ 2OTL1 3CD6Z 3CCEZ 1KD11 1KD12 3CCV1 3G6EZ 3CCJ1 3CC41 3CCM1 2QA41 1QVGZ 1YI21 3CCR1 1QVFY 1KQSY 3CCQ1 1S72Z 3CCS1 1VQM1 1VQ91 3CCU1 3CPWZ 1JJ2Y 1VQL1 1VQO1 3CC71 1Q821 1QVFZ 1VQ61 1M1K1 1Q822 2OTJ1 1YIJ1 1KQSZ 1Q7Y1 1K731 1Q7Y2 1W2BY 3CCUZ 3I55Z 1VQLZ 1JJ2Z 1VQKZ 1KC81 1VQ4Z 1KC82 2OTJZ 3I56Z 1VQN1 1VQ71 1YIJZ 3CPWY 1W2BZ 3CMA1 2QEXZ 3CC21 1N8R1 2OTLZ 3G4S1 1N8R2 1YHQ1 1M901 1M902 3CCVZ 1K8A1 1VQP1 1K8A2 1NJI1 3CCJZ 3CCMZ 1NJI2 3CC4Z 3CME1 2QA4Z 3CMAZ 3G711 1YI2Z 3CCRZ 3G4SZ 3CCQZ 1M1K2 1YHQZ 3CCSZ 3OW2Y 1K732 1VQMZ 1VQ9Z 1VQ81 1YJN1 1VQOZ 3CC7Z 1VQ6Z 3CCL1 3OW2Z 1YJW1 1YIT1 1VQ8Z 3CCE1 1VQNZ 1VQ7Z 1K9M1 3G6E1 1Q811 1K9M2 1Q812 3CC2Z 1YJ91 1VQ51 1Q861 1Q862 1S721 1VQPZ 3CMEZ 3G71Z 1YJ9Z 1VQ5Z 3CXCY 3CD61 3I551 1YJNZ 1VQK1 1VQ41 3I561 3CCLZ
chains in the Genus database with same CATH superfamily
2E2JI 2OTL1 3CQZI 4TNUA 1KD12 3CCV1 3FQMA 2RT9A 1K83I 3CCJ1 3CC41 1VLAA 4A3GI 4NB9A 1Y1VS 4E2WA 3NDJA 5IP9I 2O4HA 3CCS1 2JIMA 1RLYA 5D1OA 3CPWZ 2RHBA 3S2DI 4A3EI 1Q821 1QVFZ 2JIQA 1Q7Y1 1K731 2R7ZI 2AKLA 1VQKZ 5AN9F 3BG0B 2OZKA 1KC82 5FLXf 3I56Z 1VQN1 2PK7A 3PO3I 3CPWY 4Y52I 1DL6A 2RIQA 1W2BZ 3CMA1 2OTLZ 4MXUA 1WZNA 4A3MI 2JS4A 1M902 3CCVZ 3I4MI 3CCJZ 3CC4Z 1NJI2 5FLMI 2JA6I 2V8KA 4QTTA 5IT9b 3CCSZ 4E31A 3OW2Y 2NVTI 3EEDA 2OOYB 1QF8A 5C4JI 3I07A 1Y1VI 3IFUA 2VUMI 3IX0A 3CCL1 3S15I 1YJW1 3D9XA 3S1RI 1YIT1 3ESWA 2JA5I 2HF1A 2NVXI 3CCE1 2E9HA 1VQNZ 1K9M1 3G6E1 2G2KA 1FDOA 3NH8A 1VQ51 3NDIA 2V8JA 1S721 3QWUA 4A3LI 3GCFA 2HU9A 1RO2A 2EGTA 4NBCA 5T67A 3JAMf 3S17I 2E7ZA 2WB1A 4NBHA 3Q87A 4BY7I 3CCLZ 3S1QI 4RVDA 3J81f 1YJWZ 3TE5B 1YITZ 3CXCZ 3CD6Z 3J80f 3CCEZ 2E2HI 2BJOA 1I50I 4X6AI 2B63I 3M4OI 3G6EZ 2JIPA 1Y1WI 1RNIA 4RVGA 1YI21 1S72Z 2DE6A 1VQ91 4NFRA 2NAPA 4A3BI 4DGLA 3VB9A 2RPRA 2VPYA 1Q822 1Z01A 3D2LA 1USPA 1Q7Y2 2W04A 1L1OC 3HOUI 3CCUZ 4NBEA 1QYPA 2Q4ZA 3GTMS 3GTPI 1SFOI 4NBFA 1VQ71 1YIJZ 2VPWA 2W03A 4S1TA 4HH4A 1I3QI 3HOZI 2F4MA 2QR1B 3D6WA 2GTIA 3IR7A 1LQLA 4NBBA 4HGYA 4E33A 4NOZA 3G711 1YI2Z 2DE5A 1M1K2 3RZOI 2JIRA 3BG1B 2GU2A 1VQ9Z 2P28A 1P9NA 1ZH1A 2PM9A 3FQQA 3J81b 1PFTA 3OW2Z 2IV2X 1JWHC 3J7A4 3J80b 4A3CI 1VQ7Z 3MZLB 1Q811 1K9M2 3S1NI 1I6HI 2Y0SA 2R93I 2OOXB 4NBDA 3GTMI 4RS4A 1TWAI 2KI7B 3G71Z 3I4NI 1Z03A 2JA8I 3S14I 3M3YI 1USPB 3CD61 3I551 1WIIA 3GTJI 3HOXI 3H3VJ 3HOYI 2VPXA 4BBRI 2QEX1 1QVGY 2O53A 2K3RA 4NBGA 3S2HI 3CCM1 2WAQA 2QA41 3F3FC 4A93I 5D1OB 3CCR1 4RVHA 1KQSY 3CCQ1 1NUIA 1VQM1 1ZB9A 3CCU1 2V3VA 4A3JI 3GTLI 2JNYA 1JJ2Y 4E30A 5FLXb 5C4XI 1YIJ1 3KIFA 3FKII 2R6MA 2VPZA 1QXFA 1N2FA 4E32A 3I55Z 3F3PC 1VQLZ 3VMGA 2OTJZ 2QRDB 3H0GI 4RV9A 2QEXZ 3CC21 1N8R1 2QREB 4MD7A 3S1MI 1K8A1 3HOVI 3S16I 3K7AI 1VQP1 4CL1A 3CCMZ 4BY1I 5T64A 3CME1 2QA4Z 2H85A 4A3FI 1TWCI 3CCRZ 3G4SZ 4DK1A 5C3EI 2V45A 3CCQZ 1YHQZ 2IZ3A 1VQMZ 1K732 2I3CA 5IT9f 1X3ZA 2NVQI 4NB8A 1VQ8Z 1Z02A 1Q812 3CC2Z 1Q861 2PMZA 5A2Qf 3JAMb 5LL6f 3VMHA 1WJ2A 1RO4A 1VQPZ 1WW9A 3CMEZ 1YJ9Z 3P5JB 1YUAA 1KRLA 4MH4A 3PO2I 1RQFA 2LIYA 2E2II 1R9TI 1VQ41 2M6NA 2K5RA 2JA7I 2NVYI 2JMOA 4RVFA 1KD11 4HGZA 4E2YA 3TDHB 4A3DI 3NH4A 3VTNA 4MRIA 1QVGZ 1QVFY 3U50C 2KPIA 1Q16A 2ZAEB 4A3KI 1X3WA 1ML8A 2DE7A 1AA6A 2VUGA 2AYDA 1VQL1 1VQO1 5CM2M 3CC71 2OTJ1 1VQ61 3NH5A 1M1K1 1KQSZ 1W2BY 1TWFI 1FDIA 2QRCB 5IP7I 1JJ2Z 5T6BA 1KC81 1VQ4Z 4QTUA 3EERA 2JUBA 2F4OA 4MD9A 4EWCA 3GKQA 5A2Qb 2VF1A 3G4S1 1N8R2 4BBSI 4MONA 4A3II 1YHQ1 1M901 2JR6A 4BXXI 3KIHA 1K8A2 1NJI1 1SIWA 1NP6A 1ZB8A 4Y7NI 3CMAZ 3MZKB 1YUKA 3GTOI 1TWGI 4NBAA 2GTHA 3IF8A 4MD8A 2IZ4A 4XX2A 1WCMI 1TWHI 1VQ81 1YJN1 1VQOZ 3GTGI 3CC7Z 1VQ6Z 2LFUA 5D1PA 3MONA 4DQYB 2Q51A 3GTKI 2V8IA 3RZDI 2RBLA 1Y8CA 2R92I 3NFZA 2P3YA 3HKZA 1YJ91 3VMIA 1Q862 1S7MA 5C44I 3HOWI 4NH1C 4AYBA 2YU9I 3T4NB 3PO3S 1VQ5Z 2YADA 2QKDA 1TFIA 4E2ZA 3LUSA 2M48A 3CXCY 3GTQI 2QLVB 1YJNZ 1VQK1 2J6AA 2LEXA 2JIOA 3I561 4E2XA 1RO0A 1X0TA
chains in the Genus database with same CATH topology
2E2JI 2OTL1 3CQZI 4TNUA 1KD12 3CCV1 3FQMA 2RT9A 1K83I 3CCJ1 3CC41 1VLAA 4A3GI 4NB9A 1Y1VS 4E2WA 3NDJA 5IP9I 2O4HA 3CCS1 1RLYA 5D1OA 3CPWZ 2RHBA 3S2DI 4A3EI 1Q821 1QVFZ 1Q7Y1 1K731 2R7ZI 2AKLA 1VQKZ 5AN9F 3BG0B 2OZKA 1KC82 5FLXf 3I56Z 1VQN1 2PK7A 3PO3I 3CPWY 4Y52I 1DL6A 2RIQA 1W2BZ 3CMA1 2OTLZ 4MXUA 4A3MI 2JS4A 1M902 3CCVZ 3I4MI 3CCJZ 3CC4Z 1NJI2 5FLMI 2JA6I 2V8KA 4QTTA 5IT9b 3CCSZ 4E31A 3OW2Y 2NVTI 3EEDA 2OOYB 1QF8A 5C4JI 3I07A 1Y1VI 3IFUA 2VUMI 3IX0A 3CCL1 3S15I 1YJW1 3D9XA 3S1RI 1YIT1 3ESWA 2JA5I 2HF1A 2NVXI 3CCE1 2E9HA 1VQNZ 1K9M1 3G6E1 2G2KA 3NH8A 1VQ51 3NDIA 2V8JA 1S721 3QWUA 4A3LI 3GCFA 2HU9A 1RO2A 2EGTA 4NBCA 5T67A 3JAMf 3S17I 2WB1A 4NBHA 3Q87A 4BY7I 3CCLZ 3S1QI 4RVDA 3J81f 1YJWZ 3TE5B 1YITZ 3CXCZ 3CD6Z 3J80f 3CCEZ 2E2HI 2BJOA 1I50I 4X6AI 2B63I 3M4OI 3G6EZ 1Y1WI 1RNIA 4RVGA 1YI21 1S72Z 2DE6A 1VQ91 4NFRA 4A3BI 4DGLA 3VB9A 2RPRA 1Q822 1Z01A 1USPA 1Q7Y2 2W04A 1L1OC 3HOUI 3CCUZ 4NBEA 1QYPA 2Q4ZA 3GTMS 3GTPI 1SFOI 4NBFA 1VQ71 1YIJZ 2W03A 4S1TA 4HH4A 1I3QI 3HOZI 2F4MA 2QR1B 3D6WA 2GTIA 1LQLA 4NBBA 4HGYA 4E33A 4NOZA 3G711 1YI2Z 2DE5A 1M1K2 3RZOI 3BG1B 2GU2A 1VQ9Z 2P28A 1P9NA 1ZH1A 2PM9A 3FQQA 3J81b 1PFTA 3OW2Z 1JWHC 3J7A4 3J80b 4A3CI 1VQ7Z 3MZLB 1Q811 1K9M2 3S1NI 1I6HI 2Y0SA 2R93I 2OOXB 4NBDA 3GTMI 4RS4A 1TWAI 2KI7B 3G71Z 3I4NI 1Z03A 2JA8I 3S14I 3M3YI 1USPB 3CD61 3I551 1WIIA 3GTJI 3HOXI 3H3VJ 3HOYI 4BBRI 2QEX1 1QVGY 2O53A 2K3RA 4NBGA 3S2HI 3CCM1 2WAQA 2QA41 3F3FC 4A93I 5D1OB 3CCR1 4RVHA 1KQSY 3CCQ1 1NUIA 1VQM1 1ZB9A 3CCU1 4A3JI 3GTLI 2JNYA 1JJ2Y 4E30A 5FLXb 5C4XI 1YIJ1 3KIFA 3FKII 2R6MA 1N2FA 4E32A 3I55Z 3F3PC 1VQLZ 3VMGA 2OTJZ 2QRDB 3H0GI 4RV9A 2QEXZ 3CC21 1N8R1 2QREB 4MD7A 3S1MI 1K8A1 3HOVI 3S16I 3K7AI 1VQP1 4CL1A 3CCMZ 4BY1I 5T64A 3CME1 2QA4Z 2H85A 4A3FI 1TWCI 3CCRZ 3G4SZ 4DK1A 5C3EI 3CCQZ 1YHQZ 2IZ3A 1VQMZ 1K732 2I3CA 5IT9f 1X3ZA 2NVQI 4NB8A 1VQ8Z 1Z02A 1Q812 3CC2Z 1Q861 2PMZA 5A2Qf 3JAMb 5LL6f 3VMHA 1RO4A 1VQPZ 1WW9A 3CMEZ 1YJ9Z 3P5JB 1YUAA 1KRLA 4MH4A 3PO2I 1RQFA 2LIYA 2E2II 1R9TI 1VQ41 2M6NA 2K5RA 2JA7I 2NVYI 2JMOA 4RVFA 1KD11 4HGZA 4E2YA 3TDHB 4A3DI 3NH4A 3VTNA 4MRIA 1QVGZ 1QVFY 3U50C 2KPIA 2ZAEB 4A3KI 1X3WA 1ML8A 2DE7A 2VUGA 1VQL1 1VQO1 5CM2M 3CC71 2OTJ1 1VQ61 3NH5A 1M1K1 1KQSZ 1W2BY 1TWFI 2QRCB 5IP7I 1JJ2Z 5T6BA 1KC81 1VQ4Z 4QTUA 3EERA 2JUBA 2F4OA 4MD9A 4EWCA 3GKQA 5A2Qb 2VF1A 3G4S1 1N8R2 4BBSI 4MONA 4A3II 1YHQ1 1M901 2JR6A 4BXXI 3KIHA 1K8A2 1NJI1 1NP6A 1ZB8A 4Y7NI 3CMAZ 3MZKB 1YUKA 3GTOI 1TWGI 4NBAA 2GTHA 3IF8A 4MD8A 2IZ4A 4XX2A 1WCMI 1TWHI 1VQ81 1YJN1 1VQOZ 3GTGI 3CC7Z 1VQ6Z 2LFUA 5D1PA 3MONA 4DQYB 2Q51A 3GTKI 2V8IA 3RZDI 2RBLA 2R92I 3NFZA 2P3YA 3HKZA 1YJ91 3VMIA 1Q862 1S7MA 5C44I 3HOWI 4NH1C 4AYBA 2YU9I 3T4NB 3PO3S 1VQ5Z 2YADA 2QKDA 1TFIA 4E2ZA 3LUSA 2M48A 3CXCY 3GTQI 2QLVB 1YJNZ 1VQK1 2J6AA 3I561 4E2XA 1RO0A 1X0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Z;  2QEX 1;  1QVG Y;  1YIT Z;  3CXC Z;  2OTL 1;  3CD6 Z;  3CCE Z;  1KD1 1;  1KD1 2;  3CCV 1;  3G6E Z;  3CCJ 1;  3CC4 1;  3CCM 1;  2QA4 1;  1QVG Z;  1YI2 1;  3CCR 1;  1QVF Y;  1KQS Y;  3CCQ 1;  1S72 Z;  3CCS 1;  1VQM 1;  1VQ9 1;  3CCU 1;  3CPW Z;  1JJ2 Y;  1VQL 1;  1VQO 1;  3CC7 1;  1Q82 1;  1QVF Z;  1VQ6 1;  1M1K 1;  1Q82 2;  2OTJ 1;  1YIJ 1;  1KQS Z;  1Q7Y 1;  1K73 1;  1Q7Y 2;  1W2B Y;  3CCU Z;  3I55 Z;  1VQL Z;  1JJ2 Z;  1VQK Z;  1KC8 1;  1VQ4 Z;  1KC8 2;  2OTJ Z;  3I56 Z;  1VQN 1;  1VQ7 1;  1YIJ Z;  3CPW Y;  1W2B Z;  3CMA 1;  2QEX Z;  3CC2 1;  1N8R 1;  2OTL Z;  3G4S 1;  1N8R 2;  1YHQ 1;  1M90 1;  1M90 2;  3CCV Z;  1K8A 1;  1VQP 1;  1K8A 2;  1NJI 1;  3CCJ Z;  3CCM Z;  1NJI 2;  3CC4 Z;  3CME 1;  2QA4 Z;  3CMA Z;  3G71 1;  1YI2 Z;  3CCR Z;  3G4S Z;  3CCQ Z;  1M1K 2;  1YHQ Z;  3CCS Z;  3OW2 Y;  1K73 2;  1VQM Z;  1VQ9 Z;  1VQ8 1;  1YJN 1;  1VQO Z;  3CC7 Z;  1VQ6 Z;  3CCL 1;  3OW2 Z;  1YJW 1;  1YIT 1;  1VQ8 Z;  3CCE 1;  1VQN Z;  1VQ7 Z;  1K9M 1;  3G6E 1;  1Q81 1;  1K9M 2;  1Q81 2;  3CC2 Z;  1YJ9 1;  1VQ5 1;  1Q86 1;  1Q86 2;  1S72 1;  1VQP Z;  3CME Z;  3G71 Z;  1YJ9 Z;  1VQ5 Z;  3CXC Y;  3CD6 1;  3I55 1;  1YJN Z;  1VQK 1;  1VQ4 1;  3I56 1;  3CCL Z; 
#chains in the Genus database with same CATH topology
 2E2J I;  2OTL 1;  3CQZ I;  4TNU A;  1KD1 2;  3CCV 1;  3FQM A;  2RT9 A;  1K83 I;  3CCJ 1;  3CC4 1;  1VLA A;  4A3G I;  4NB9 A;  1Y1V S;  4E2W A;  3NDJ A;  5IP9 I;  2O4H A;  3CCS 1;  2JIM A;  1RLY A;  5D1O A;  3CPW Z;  2RHB A;  3S2D I;  4A3E I;  1Q82 1;  1QVF Z;  2JIQ A;  1Q7Y 1;  1K73 1;  2R7Z I;  2AKL A;  1VQK Z;  5AN9 F;  3BG0 B;  2OZK A;  1KC8 2;  5FLX f;  3I56 Z;  1VQN 1;  2PK7 A;  3PO3 I;  3CPW Y;  4Y52 I;  1DL6 A;  2RIQ A;  1W2B Z;  3CMA 1;  2OTL Z;  4MXU A;  1WZN A;  4A3M I;  2JS4 A;  1M90 2;  3CCV Z;  3I4M I;  3CCJ Z;  3CC4 Z;  1NJI 2;  5FLM I;  2JA6 I;  2V8K A;  4QTT A;  5IT9 b;  3CCS Z;  4E31 A;  3OW2 Y;  2NVT I;  3EED A;  2OOY B;  1QF8 A;  5C4J I;  3I07 A;  1Y1V I;  3IFU A;  2VUM I;  3IX0 A;  3CCL 1;  3S15 I;  1YJW 1;  3D9X A;  3S1R I;  1YIT 1;  3ESW A;  2JA5 I;  2HF1 A;  2NVX I;  3CCE 1;  2E9H A;  1VQN Z;  1K9M 1;  3G6E 1;  2G2K A;  1FDO A;  3NH8 A;  1VQ5 1;  3NDI A;  2V8J A;  1S72 1;  3QWU A;  4A3L I;  3GCF A;  2HU9 A;  1RO2 A;  2EGT A;  4NBC A;  5T67 A;  3JAM f;  3S17 I;  2E7Z A;  2WB1 A;  4NBH A;  3Q87 A;  4BY7 I;  3CCL Z;  3S1Q I;  4RVD A;  3J81 f;  1YJW Z;  3TE5 B;  1YIT Z;  3CXC Z;  3CD6 Z;  3J80 f;  3CCE Z;  2E2H I;  2BJO A;  1I50 I;  4X6A I;  2B63 I;  3M4O I;  3G6E Z;  2JIP A;  1Y1W I;  1RNI A;  4RVG A;  1YI2 1;  1S72 Z;  2DE6 A;  1VQ9 1;  4NFR A;  2NAP A;  4A3B I;  4DGL A;  3VB9 A;  2RPR A;  2VPY A;  1Q82 2;  1Z01 A;  3D2L A;  1USP A;  1Q7Y 2;  2W04 A;  1L1O C;  3HOU I;  3CCU Z;  4NBE A;  1QYP A;  2Q4Z A;  3GTM S;  3GTP I;  1SFO I;  4NBF A;  1VQ7 1;  1YIJ Z;  2VPW A;  2W03 A;  4S1T A;  4HH4 A;  1I3Q I;  3HOZ I;  2F4M A;  2QR1 B;  3D6W A;  2GTI A;  3IR7 A;  1LQL A;  4NBB A;  4HGY A;  4E33 A;  4NOZ A;  3G71 1;  1YI2 Z;  2DE5 A;  1M1K 2;  3RZO I;  2JIR A;  3BG1 B;  2GU2 A;  1VQ9 Z;  2P28 A;  1P9N A;  1ZH1 A;  2PM9 A;  3FQQ A;  3J81 b;  1PFT A;  3OW2 Z;  2IV2 X;  1JWH C;  3J7A 4;  3J80 b;  4A3C I;  1VQ7 Z;  3MZL B;  1Q81 1;  1K9M 2;  3S1N I;  1I6H I;  2Y0S A;  2R93 I;  2OOX B;  4NBD A;  3GTM I;  4RS4 A;  1TWA I;  2KI7 B;  3G71 Z;  3I4N I;  1Z03 A;  2JA8 I;  3S14 I;  3M3Y I;  1USP B;  3CD6 1;  3I55 1;  1WII A;  3GTJ I;  3HOX I;  3H3V J;  3HOY I;  2VPX A;  4BBR I;  2QEX 1;  1QVG Y;  2O53 A;  2K3R A;  4NBG A;  3S2H I;  3CCM 1;  2WAQ A;  2QA4 1;  3F3F C;  4A93 I;  5D1O B;  3CCR 1;  4RVH A;  1KQS Y;  3CCQ 1;  1NUI A;  1VQM 1;  1ZB9 A;  3CCU 1;  2V3V A;  4A3J I;  3GTL I;  2JNY A;  1JJ2 Y;  4E30 A;  5FLX b;  5C4X I;  1YIJ 1;  3KIF A;  3FKI I;  2R6M A;  2VPZ A;  1QXF A;  1N2F A;  4E32 A;  3I55 Z;  3F3P C;  1VQL Z;  3VMG A;  2OTJ Z;  2QRD B;  3H0G I;  4RV9 A;  2QEX Z;  3CC2 1;  1N8R 1;  2QRE B;  4MD7 A;  3S1M I;  1K8A 1;  3HOV I;  3S16 I;  3K7A I;  1VQP 1;  4CL1 A;  3CCM Z;  4BY1 I;  5T64 A;  3CME 1;  2QA4 Z;  2H85 A;  4A3F I;  1TWC I;  3CCR Z;  3G4S Z;  4DK1 A;  5C3E I;  2V45 A;  3CCQ Z;  1YHQ Z;  2IZ3 A;  1VQM Z;  1K73 2;  2I3C A;  5IT9 f;  1X3Z A;  2NVQ I;  4NB8 A;  1VQ8 Z;  1Z02 A;  1Q81 2;  3CC2 Z;  1Q86 1;  2PMZ A;  5A2Q f;  3JAM b;  5LL6 f;  3VMH A;  1WJ2 A;  1RO4 A;  1VQP Z;  1WW9 A;  3CME Z;  1YJ9 Z;  3P5J B;  1YUA A;  1KRL A;  4MH4 A;  3PO2 I;  1RQF A;  2LIY A;  2E2I I;  1R9T I;  1VQ4 1;  2M6N A;  2K5R A;  2JA7 I;  2NVY I;  2JMO A;  4RVF A;  1KD1 1;  4HGZ A;  4E2Y A;  3TDH B;  4A3D I;  3NH4 A;  3VTN A;  4MRI A;  1QVG Z;  1QVF Y;  3U50 C;  2KPI A;  1Q16 A;  2ZAE B;  4A3K I;  1X3W A;  1ML8 A;  2DE7 A;  1AA6 A;  2VUG A;  2AYD A;  1VQL 1;  1VQO 1;  5CM2 M;  3CC7 1;  2OTJ 1;  1VQ6 1;  3NH5 A;  1M1K 1;  1KQS Z;  1W2B Y;  1TWF I;  1FDI A;  2QRC B;  5IP7 I;  1JJ2 Z;  5T6B A;  1KC8 1;  1VQ4 Z;  4QTU A;  3EER A;  2JUB A;  2F4O A;  4MD9 A;  4EWC A;  3GKQ A;  5A2Q b;  2VF1 A;  3G4S 1;  1N8R 2;  4BBS I;  4MON A;  4A3I I;  1YHQ 1;  1M90 1;  2JR6 A;  4BXX I;  3KIH A;  1K8A 2;  1NJI 1;  1SIW A;  1NP6 A;  1ZB8 A;  4Y7N I;  3CMA Z;  3MZK B;  1YUK A;  3GTO I;  1TWG I;  4NBA A;  2GTH A;  3IF8 A;  4MD8 A;  2IZ4 A;  4XX2 A;  1WCM I;  1TWH I;  1VQ8 1;  1YJN 1;  1VQO Z;  3GTG I;  3CC7 Z;  1VQ6 Z;  2LFU A;  5D1P A;  3MON A;  4DQY B;  2Q51 A;  3GTK I;  2V8I A;  3RZD I;  2RBL A;  1Y8C A;  2R92 I;  3NFZ A;  2P3Y A;  3HKZ A;  1YJ9 1;  3VMI A;  1Q86 2;  1S7M A;  5C44 I;  3HOW I;  4NH1 C;  4AYB A;  2YU9 I;  3T4N B;  3PO3 S;  1VQ5 Z;  2YAD A;  2QKD A;  1TFI A;  4E2Z A;  3LUS A;  2M48 A;  3CXC Y;  3GTQ I;  2QLV B;  1YJN Z;  1VQK 1;  2J6A A;  2LEX A;  2JIO A;  3I56 1;  4E2X A;  1RO0 A;  1X0T A; 
#chains in the Genus database with same CATH homology
 2E2J I;  2OTL 1;  3CQZ I;  4TNU A;  1KD1 2;  3CCV 1;  3FQM A;  2RT9 A;  1K83 I;  3CCJ 1;  3CC4 1;  1VLA A;  4A3G I;  4NB9 A;  1Y1V S;  4E2W A;  3NDJ A;  5IP9 I;  2O4H A;  3CCS 1;  1RLY A;  5D1O A;  3CPW Z;  2RHB A;  3S2D I;  4A3E I;  1Q82 1;  1QVF Z;  1Q7Y 1;  1K73 1;  2R7Z I;  2AKL A;  1VQK Z;  5AN9 F;  3BG0 B;  2OZK A;  1KC8 2;  5FLX f;  3I56 Z;  1VQN 1;  2PK7 A;  3PO3 I;  3CPW Y;  4Y52 I;  1DL6 A;  2RIQ A;  1W2B Z;  3CMA 1;  2OTL Z;  4MXU A;  4A3M I;  2JS4 A;  1M90 2;  3CCV Z;  3I4M I;  3CCJ Z;  3CC4 Z;  1NJI 2;  5FLM I;  2JA6 I;  2V8K A;  4QTT A;  5IT9 b;  3CCS Z;  4E31 A;  3OW2 Y;  2NVT I;  3EED A;  2OOY B;  1QF8 A;  5C4J I;  3I07 A;  1Y1V I;  3IFU A;  2VUM I;  3IX0 A;  3CCL 1;  3S15 I;  1YJW 1;  3D9X A;  3S1R I;  1YIT 1;  3ESW A;  2JA5 I;  2HF1 A;  2NVX I;  3CCE 1;  2E9H A;  1VQN Z;  1K9M 1;  3G6E 1;  2G2K A;  3NH8 A;  1VQ5 1;  3NDI A;  2V8J A;  1S72 1;  3QWU A;  4A3L I;  3GCF A;  2HU9 A;  1RO2 A;  2EGT A;  4NBC A;  5T67 A;  3JAM f;  3S17 I;  2WB1 A;  4NBH A;  3Q87 A;  4BY7 I;  3CCL Z;  3S1Q I;  4RVD A;  3J81 f;  1YJW Z;  3TE5 B;  1YIT Z;  3CXC Z;  3CD6 Z;  3J80 f;  3CCE Z;  2E2H I;  2BJO A;  1I50 I;  4X6A I;  2B63 I;  3M4O I;  3G6E Z;  1Y1W I;  1RNI A;  4RVG A;  1YI2 1;  1S72 Z;  2DE6 A;  1VQ9 1;  4NFR A;  4A3B I;  4DGL A;  3VB9 A;  2RPR A;  1Q82 2;  1Z01 A;  1USP A;  1Q7Y 2;  2W04 A;  1L1O C;  3HOU I;  3CCU Z;  4NBE A;  1QYP A;  2Q4Z A;  3GTM S;  3GTP I;  1SFO I;  4NBF A;  1VQ7 1;  1YIJ Z;  2W03 A;  4S1T A;  4HH4 A;  1I3Q I;  3HOZ I;  2F4M A;  2QR1 B;  3D6W A;  2GTI A;  1LQL A;  4NBB A;  4HGY A;  4E33 A;  4NOZ A;  3G71 1;  1YI2 Z;  2DE5 A;  1M1K 2;  3RZO I;  3BG1 B;  2GU2 A;  1VQ9 Z;  2P28 A;  1P9N A;  1ZH1 A;  2PM9 A;  3FQQ A;  3J81 b;  1PFT A;  3OW2 Z;  1JWH C;  3J7A 4;  3J80 b;  4A3C I;  1VQ7 Z;  3MZL B;  1Q81 1;  1K9M 2;  3S1N I;  1I6H I;  2Y0S A;  2R93 I;  2OOX B;  4NBD A;  3GTM I;  4RS4 A;  1TWA I;  2KI7 B;  3G71 Z;  3I4N I;  1Z03 A;  2JA8 I;  3S14 I;  3M3Y I;  1USP B;  3CD6 1;  3I55 1;  1WII A;  3GTJ I;  3HOX I;  3H3V J;  3HOY I;  4BBR I;  2QEX 1;  1QVG Y;  2O53 A;  2K3R A;  4NBG A;  3S2H I;  3CCM 1;  2WAQ A;  2QA4 1;  3F3F C;  4A93 I;  5D1O B;  3CCR 1;  4RVH A;  1KQS Y;  3CCQ 1;  1NUI A;  1VQM 1;  1ZB9 A;  3CCU 1;  4A3J I;  3GTL I;  2JNY A;  1JJ2 Y;  4E30 A;  5FLX b;  5C4X I;  1YIJ 1;  3KIF A;  3FKI I;  2R6M A;  1N2F A;  4E32 A;  3I55 Z;  3F3P C;  1VQL Z;  3VMG A;  2OTJ Z;  2QRD B;  3H0G I;  4RV9 A;  2QEX Z;  3CC2 1;  1N8R 1;  2QRE B;  4MD7 A;  3S1M I;  1K8A 1;  3HOV I;  3S16 I;  3K7A I;  1VQP 1;  4CL1 A;  3CCM Z;  4BY1 I;  5T64 A;  3CME 1;  2QA4 Z;  2H85 A;  4A3F I;  1TWC I;  3CCR Z;  3G4S Z;  4DK1 A;  5C3E I;  3CCQ Z;  1YHQ Z;  2IZ3 A;  1VQM Z;  1K73 2;  2I3C A;  5IT9 f;  1X3Z A;  2NVQ I;  4NB8 A;  1VQ8 Z;  1Z02 A;  1Q81 2;  3CC2 Z;  1Q86 1;  2PMZ A;  5A2Q f;  3JAM b;  5LL6 f;  3VMH A;  1RO4 A;  1VQP Z;  1WW9 A;  3CME Z;  1YJ9 Z;  3P5J B;  1YUA A;  1KRL A;  4MH4 A;  3PO2 I;  1RQF A;  2LIY A;  2E2I I;  1R9T I;  1VQ4 1;  2M6N A;  2K5R A;  2JA7 I;  2NVY I;  2JMO A;  4RVF A;  1KD1 1;  4HGZ A;  4E2Y A;  3TDH B;  4A3D I;  3NH4 A;  3VTN A;  4MRI A;  1QVG Z;  1QVF Y;  3U50 C;  2KPI A;  2ZAE B;  4A3K I;  1X3W A;  1ML8 A;  2DE7 A;  2VUG A;  1VQL 1;  1VQO 1;  5CM2 M;  3CC7 1;  2OTJ 1;  1VQ6 1;  3NH5 A;  1M1K 1;  1KQS Z;  1W2B Y;  1TWF I;  2QRC B;  5IP7 I;  1JJ2 Z;  5T6B A;  1KC8 1;  1VQ4 Z;  4QTU A;  3EER A;  2JUB A;  2F4O A;  4MD9 A;  4EWC A;  3GKQ A;  5A2Q b;  2VF1 A;  3G4S 1;  1N8R 2;  4BBS I;  4MON A;  4A3I I;  1YHQ 1;  1M90 1;  2JR6 A;  4BXX I;  3KIH A;  1K8A 2;  1NJI 1;  1NP6 A;  1ZB8 A;  4Y7N I;  3CMA Z;  3MZK B;  1YUK A;  3GTO I;  1TWG I;  4NBA A;  2GTH A;  3IF8 A;  4MD8 A;  2IZ4 A;  4XX2 A;  1WCM I;  1TWH I;  1VQ8 1;  1YJN 1;  1VQO Z;  3GTG I;  3CC7 Z;  1VQ6 Z;  2LFU A;  5D1P A;  3MON A;  4DQY B;  2Q51 A;  3GTK I;  2V8I A;  3RZD I;  2RBL A;  2R92 I;  3NFZ A;  2P3Y A;  3HKZ A;  1YJ9 1;  3VMI A;  1Q86 2;  1S7M A;  5C44 I;  3HOW I;  4NH1 C;  4AYB A;  2YU9 I;  3T4N B;  3PO3 S;  1VQ5 Z;  2YAD A;  2QKD A;  1TFI A;  4E2Z A;  3LUS A;  2M48 A;  3CXC Y;  3GTQ I;  2QLV B;  1YJN Z;  1VQK 1;  2J6A A;  3I56 1;  4E2X A;  1RO0 A;  1X0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...