2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
b'CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspa protein
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
5CBMA 1LOKA 4TNUA 2HB6A 2IMOA 1CG2A 3KGQA 4O23A 1RTQA 4P6YA 3SJXA 2PVWA 4NGTA 3I1UA 2JBKA 4ONWA 3KHXA 2NYQA 2C6PA 4UEZA 2PJ9A 2XEFA 1VHEA 3MN8A 2I3CA 1Z8LA 4TWEA 1XFOA 3BI1A 3MRUA 5K8NA 4NGPA 4OC3A 4BD9A 4NJRA 3RAMA 4DJLA 5J1QA 3SJGA 5LYFA 3RZAA 2V8DA 1H8LA 4MCPA 3GB0A 4OC2A 2J9AA 3KI9A 4NGNA 1R3NA 2PCUA 4UIBA 5IB9A 5D8NA 4AXVA 1YLOA 3IWWA 3KQXA 2JEWA 3FF3A 5F09A 4PPZA 3L2NA 1Z5RA 1PCAA 2G9DA 2ZEDA 4EMEA 4P44A 4ZX9A 3S9MA 3B3TA 3CPAA 4B6ZA 2PRQA 4UEFA 2AFMA 3JRUA 4R76A 3LWUA 3D7DA 4YWYA 4WJBA 2PE3A 4H2KA 4F9VA 5HVHA 2Q4ZA 3GLJA 2DEAA 4P4JA 2IJZA 3FMCA 3TC8A 4ZY0A 4ZI6A 4NFRA 3B3VA 3PFEA 3FJUA 2AFUA 4MRIA 3BXMA 3FECA 2VL1A 2PVVA 3K9TA 1Y0RA 3WC6A 5I4MA 1BAVA 4UF4A 4R7MA 3FX6A 3PB9X 4OMEA 2JBJA 2CF4A 3N5FA 1TXRA 4OC0A 2PJBA 3KL9A 4MHNA 4P10A 3QNVA 3PBBA 4ZY1A 1ZLHA 4PQAA 2ZEFA 3D7GA 1UWYA 3HUVA 1KWMA 1LCPA 3D7HA 1VHOA 4MMOA 2EK8A 1YW4A 2XEJA 3PB4X 3VH9A 4WWVA 2HC9A 5DS0A 4OC1A 1VGYA 1BLLE 1AYEA 3PEIA 4A94A 1CPSA 1CBXA 2POKA 1F2OA 1QQ9A 2ZOFA 4NGRA 4RUHA 4OC4A 4EWTA 3S9LA 1JQGA 2O4HA 3CT9A 4NGSA 1DTDA 3S9NA 4UEEA 1FT7A 1CP7A 1YW6A 2V8VA 3V38A 2V77A 3B3SA 5JGFA 2ANPA 3V7ZA 3KZWA 1HDUA 1EE3P 4YU9A 2PJ5A 2FVGA 2CTCA 2RFHA 2V8GA 2C6GA 2CIJA 2NSMA 4P4FA 2ZEGA 1ZG7A 3B7IA 4P45A 2ZENA 1FNOA 2GLJA 2CTBA 3T8WA 3NH8A 2XEIA 4PXEA 1R43A 2O53A 3WT4A 2PJ7A 4IAVA 2XEGA 1ARMA 2ZEPA 3WABA 4PXBA 4Q7AA 3PBEA 2WYRA 5LRKA 2C1CA 2EK9A 4OKOA 3KQZA 3CDXA 3BHXA 3LMSA 2GLFA 5K8MA 3D66A 2IQ6A 5LYLA 1CP6A 2QJ8A 4P4BA 2PJ3A 4NGQA 4R8FA 3KHZA 5HXDA 2GU2A 4OIDA 3D67A 3IC1A 2WZNA 1QMUA 4OIWA 1LANA 3PRTA 3FEDA 2BOAA 3SJFA 5ELYA 5JM6A 5JH9A 3NH4A 4ZX8A 1ZG8A 3FVLA 4FBEA 4FAIA 4DUKA 3RBUA 4LQGA 8CPAA 4IK2A 3H8EA 1M4LA 3NH5A 4MCRA 4DYOA 2PIZA 4G1PA 2EWBA 4MCQA 2PJ0A 3PFOA 4PXDA 4MXUA 3SI2A 3KR5A 1TF9A 4A38A 4PXCA 3ISZA 4CPAA 4GM5A 1ELLP 4MHPA 2AFWA 3B3WA 5K8OA 2PIYA 2PJ4A 2AFSA 2AFOA 4EFDA 2QYVA 3IFEA 5LRJA 1ZLIA 5HVFA 4K3NA 3D4UA 3H8FA 3IJ3A 3ISXA 3IIBA 1XRYA 1AMPA 4FUUA 1HEEA 3SI0A 2Q43A 3PB7X 3B2YA 1TKJA 4ZYQA 5LYDA 3WC7A 2RB7A 1OBRA 4ZY2A 3WC5A 3IEHA 3FEEA 2BO9A 2OR4A 4X2TA 4MHZA 2ABZA 2ZOGA 2ZEEA 2ZEHA 1Y0YA 4X3RA 4NJQA 3TX8A 1DE4C 2GREA 2ZEMA 1ARLA 5K8PA 4P4IA 1PYTB 1HDQA 2C6CA 1NSAA 4A37A 5D29A 3K2KA 4IHMA 1LFWA 1IY7A 3FH4A 3NA6A 1F2PA 1IGBA 3BI0A 3PB6X 2F8HA 2PJ1A 3IO1A 3B3CA 3SJEA 3DGVA 1BPMA 4OC5A 2ZEOA 1LAPA 1Y7EA 5THWA 2QVPA 1CX8A 4UIAA 4P4EA 4FWUA 1TF8A 2PJ2A 3KR4A 5LYIA 4KSIA 4JYWA 4MHYA 4OP4A 4F9UA 4W9YA 4NGMA 1XMBA 1YMEA 3KASA 2OOTA 3SI1A 1CPXA 1ELMP 4P4DA 1BPNA 2ZELA 1F57A 2PJAA 7CPAA 3NFZA 2V8HA 1GYTA 5LRGA 1TKFA 4JZ0A 1ZG9A 1XJOA 3B35A 2AFXA 3D68A 2PJ8A 4R6TA 4MCSA 5HVGA 3DLJA 4Z65A 3VARA 1VIXA 3GUXA 1Z2LA 2PJ6A 2F7VA 4F8ZA 3H8GA 1Q7LA 4X8IA 1XBUA 4A39A 1YSJA 3CPXA 3HLPA 6CPAA 5CPAA 3D7FA 3VATA 2AFZA 2BCOA 2PJCA 2Q51A 1LAMA 1TKHA 3PB8X
chains in the Genus database with same CATH superfamily
5CBMA 1LOKA 1LRZA 1FDOA 1Y8CA 3I4NI 1Y1VI 2Z3KA 4O23A 1RTQA 4P6YA 4CRYB 5EC4A 4NGTA 1S721 3KIFA 2V8JA 2R93I 2C6PA 4A3II 2GIVA 1VQ71 2IL4A 2E2II 1ZB8A 3MN8A 3IU1A 2GANA 1VQO1 1XFOA 4Q38A 2P6GA 5A28A 3PO2I 3QAHA 5ISVA 3G4SZ 4A3LI 3GY9A 4H89A 1KZFA 1QSNA 3RAMA 2QRCB 2EGTA 1H8LA 4E2XA 4MCPA 4KS9A 4E30A 2GE3A 5G1ZA 4MFPA 3LD2A 2J9AA 4Y49C 5IB9A 1JWQA 2R7HA 5D8NA 3D9XA 3J80f 4UFXA 5JQ4A 2B4DB 1ON0A 3TDHB 1S7MA 3C26A 2G9DA 2OZKA 4A2ZA 4CL1A 5A2Qb 3CC7Z 3CPAA 4B6ZA 3GTJI 2CNSA 4HKFA 2AFMA 2D4PA 4B12A 3JRUA 3CC2Z 1RO2A 1M1DA 4OADA 2G3AA 3LUSA 5DWNA 1SIWA 1P4NA 4WJBA 3VMGA 4H2KA 1Y7RA 1BOBA 2Q4ZA 2F4OA 2YGWA 3FMCA 4ZI6A 1YITZ 4NFRA 3B3VA 3GTMS 3FJUA 1LAMA 1YI21 4KOWA 1YJW1 3HOWI 3K9TA 3CD6Z 4Q36A 3KL9A 1I3QI 5GCNA 4CAWA 1YIJZ 4PQAA 4AVAA 5C88A 1KWMA 3EY5A 3CCMZ 2IZ3A 3CCLZ 2E2HI 4M6IA 3CCVZ 1NMTA 2CNTA 1YW4A 4B5OA 4OC1A 1VGYA 3SXOA 3IFUA 4CGMA 1AYEA 5A2Qf 1CPSA 1QQ9A 2WPXA 4B5PB 3H4QA 1QSRA 3S6HA 1I12A 1UFHA 2B4BA 1FT7A 1YW6A 1QVGZ 2V8VA 1USPA 5AG6A 2V77A 2QRDB 3TO6A 3V7ZA 2VEZA 1KUYA 4CAFA 5T6BA 1M902 4UA3A 4DGLA 4RI1A 2ZEGA 2GLJA 2AJ6A 3G4S1 1M901 2ZW7A 1YHQZ 3DNSA 4AYBA 4KOUA 4M3SA 1YK3A 2V8KA 3ZZIA 1ARMA 4PXBA 4UCNA 5LRKA 2GTIA 3KQZA 5BWAB 1QSMA 3CDXA 3LMSA 2B58A 2IQ6A 4OLLA 4P4BA 2GU2A 2FIWA 3CCE1 3D2PA 1LANA 5IB0A 4A32A 2JA8I 5ELYA 4ZX8A 2DPTA 1Z8WA 3CC71 1Y1VS 2QIRA 2EBJA 1S7NA 2EUIA 4PSWA 3H8EA 4M6GA 3HOVI 3W6SA 1I50I 2QEXZ 2RIQA 4G1PA 2PJ0A 2VZZA 4MXUA 1YIT1 1WZNA 2WSAA 2I00A 3ISZA 4MHPA 2AE6A 1M44A 1VQ61 4KVXA 3F0AA 2AKLA 3FKII 3CD61 1ZLIA 2Q0YA 4XNHB 4U9ZA 1XRYA 5IT9f 1YIJ1 3CC4Z 4FD5A 4NBDA 4E0AA 3R96A 3SI0A 1QXFA 4NBEA 1X12A 3B2YA 2JMOA 1IIDA 4ZYQA 2B3VA 2VZYA 3WC7A 1BO4A 3BG1B 3MONA 1OBRA 3IEHA 4X2TA 4MHZA 4C2XA 2BL1A 2F4MA 1JJ2Z 4A30A 3TX8A 4KOYA 4J3GA 1CJWA 3CPWZ 1ARLA 5K8PA 1HDQA 4CGOA 4A37A 2E7ZA 3PO3I 3R9FA 3FH4A 2P28A 2QREB 4GS4A 2PJ1A 3IO1A 3PB6X 2P0WA 4CS0B 2ZEOA 1Y7EA 3HKZA 3OW2Z 4NEXA 4B11A 1YHQ1 2Y0SA 1KD12 3GTGI 2FT0A 4C68A 5J8FA 2Z3OA 2YNEA 2VI7A 4F0XA 1KD11 3S1RI 3S6FA 1IYKA 3OWCA 4C7HA 4A33A 1FY7A 4IF5A 4MD8A 4CYQA 1P0HA 2PDOA 4P4DA 1TWCI 1F57A 1QVFY 3PP9A 4A3BI 1R57A 3G6E1 3BG0B 5T67A 5LRGA 1ZG9A 4B10A 1PUAA 2AFXA 1NE9A 1YJN1 1MJ9A 4MCSA 2FS5A 4KUBA 3VARA 3S1NI 1VIXA 2YNDA 2KPIA 2P3YA 1AA6A 2NVXI 1Q7LA 1P9NA 2QEX1 2K5TA 3VWEA 4EVYA 4MH4A 4X8IA 2A4NA 3EC4A 4BMHA 4KOTA 5HMNA 1YLEA 1NP6A 2Z3PA 1RXTA 2VPWA 3EFAA 3NE7A 2Z3NA 2PR1A 2W03A 1CG2A 1VQ9Z 4ZBGA 3CC41 3I1UA 2JBKA 5D1OA 1ML8A 5KTDA 3KKWA 3VTNA 3BLNA 2PSWA 4E32A 4MY0A 5JPHA 2GFQA 1S7KA 2PJ9A 1YUAA 3A9LA 2V8IA 2V3VA 5K8NA 3Q87A 2BJOA 2Q4VA 3SJGA 2DXQA 4DK1A 1IB1E 4A3MI 2Q04A 2HU9A 4F0YA 2DE5A 2P6FA 3KI9A 2JIQA 1CM0A 2RT9A 2CY2A 2H5MA 2PCUA 2Q44A 4MFQA 2JUBA 4AXVA 1YREA 2JEWA 3FF3A 3R1KA 5F09A 1Z5RA 1PCAA 1YQEA 3SXNA 4L89A 1WK4A 5IV0A 2ZEDA 4P44A 4YRHA 3B3TA 4XPKA 3TOBA 2X7BA 3S1MI 3TCVA 2YADA 3CXSA 3H3VJ 3D7DA 3S6KA 2PE3A 4JWPA 5HVHA 4S1TA 3GLJA 3IX0A 2DEAA 3ESWA 4X5KA 3PFEA 1KQSY 2VL1A 3DDDA 1Y0RA 4A3EI 3WC6A 1X10A 4UF4A 4R7MA 3FX6A 4QBJA 4RN7A 2Y0MA 2JBJA 2DE6A 2PJBA 1GHEA 1YR0A 4P10A 3D2MA 3T9YA 1ZLHA 3D7GA 1TWFI 1UWYA 2O28A 3R9EA 1LCPA 1YGHA 2R6MA 5AN9F 2HF1A 5EMIA 4II9A 4U9YA 1A2ZA 4AB7A 2POKA 1L1OC 5EBVA 3W6XA 2OH1A 2ZOFA 1VQ41 4RUHA 4EWTA 3V8IA 1JQGA 3NE8A 2VF1A 2O4HA 1V0CA 2GTHA 4NGSA 4KVME 2NVYI 1DTDA 2JDDA 4KVOE 3S9NA 4MD7A 1VQ91 2Z3MA 3V38A 4A31A 5JGFA 2FIAA 1HDUA 1EE3P 4MFZA 2Z10A 2CTCA 2RFHA 1MJAA 4A3GI 2PRBA 4LUAA 2K5RA 1YUKA 2CTBA 4DQYB 1M1K2 3NH8A 4NB8A 4UBRA 2JA6I 1R43A 2O53A 1VQPZ 3VWDA 4H6ZA 1M1K1 3PBEA 3CZXA 2AYDA 4OKOA 5K8MA 2JA7I 2QJ8A 4NGQA 1RO4A 4OIDA 3IC1A 2WZNA 4MHDA 3PRTA 3GTOI 4CAEA 4ORFA 5C44I 3LODA 1ZG8A 3R95A 1RO0A 3HOXI 4YGOA 4FAIA 3EEDA 1K731 3K7AI 4KUAA 4IK2A 3NH5A 1IYLA 1ZB9A 1X3WA 3HOZI 4JD6A 2PIZA 2RC4A 3IU2A 1RO5A 2YNCC 1TF9A 4A38A 4CPAA 4GM5A 2AFWA 3CCUZ 2PIYA 2AFOA 3M4OI 3RO0A 1YVOA 5J8CA 2E2JI 3TO7A 4XPDC 3IJ3A 3ISXA 3UY5A 4FD4A 1AMPA 4FUUA 1HEEA 4FD7A 3SHPA 4PSXA 2Z3LA 3PB7X 3EERA 1Y9KA 2LFUA 1TKJA 1L0CA 4UFWA 5LYDA 3CMEZ 3S2HI 3CCRZ 4CRZB 5H86A 1TWHI 1VQ8Z 2OR4A 2R98A 2ABZA 2ZEEA 3LACA 1Y0YA 2HUZA 3DR6A 3S16I 3QAYA 5C82A 1VQ5Z 1N71A 2ZEMA 3J81f 4P4IA 1PU9A 1IY7A 3TT2A 2WAQA 4ZGYB 2F8HA 1Z4EA 3B3CA 2DE7A 3CXCY 4OC5A 4RVDA 1QYPA 2I79A 4HGZA 3RZOI 3JTKA 1N8R2 1LQLA 5IT9b 1YJ9Z 1VQP1 4FWUA 2B5GA 1XOVA 2NVQI 3KR4A 5DWMA 1N8R1 4NGMA 2Z11A 1Z4RA 1YMEA 3KASA 2ATRA 3FB3A 2OOTA 1CPXA 1ELMP 1BPNA 5C3EI 2ZAEB 3CC21 1QVGY 2ZELA 2PJAA 5IP7I 4R57A 3NFZA 3S2DI 1GYTA 1TKFA 2C27A 4BBSI 3B35A 2JIOA 5LL6f 3D68A 4NF1A 4Y49B 3CCQZ 4C2ZA 2PK7A 2B3UA 2OB0A 5HVGA 3P2FA 5F46A 4MFLA 2QR1B 3GUXA 1Z2LA 1YX0A 3H8GA 1XBUA 4CGLA 2D4OA 1WW9A 5C4JI 1TFIA 1NSLA 6CPAA 3R9GA 5F47A 5AGEA 3CCU1 3CCM1 2VUGA 3CCL1 3CCV1 3PB8X 4CGNA 4TNUA 4MONA 2IMOA 3KGQA 2R7ZI 2QMLA 3SJXA 5KTAA 4CYOA 2PVWA 1SFOI 2XEFA 1VHEA 1Z8LA 4TWEA 3BI1A 3I4MI 3CME1 2VPYA 4BD9A 3CCR1 3I55Z 1TWGI 2OTLZ 4CAVA 4NJRA 1QVFZ 2Q7BA 1Q2CA 2ZW4A 1VQ81 3FXTA 3RZAA 2V8DA 4JJXA 2PQ8A 2G2KA 1USPB 1QSOA 4KOSA 3GB0A 3E0KA 1Q16A 1MJBA 1R3NA 3F5BA 2VPZA 2NVTI 3EO4A 1YLOA 3IWWA 3KQXA 3P5JB 3RZDI 1FDIA 1VQKZ 3L2NA 3IR7A 1B6BA 3EXNA 3PZJA 4NBCA 3S9MA 1YJ91 4FD6A 3TE4A 4KOVA 1J4JA 3I3GA 2W04A 4NBFA 2B5GB 4P4JA 1JJ2Y 4NH1C 4PK2A 4ZY0A 3BXMA 5I4MA 4KORA 2CF4A 3N5FA 3TFYA 4MHNA 1VHSA 4KZTA 3IF8A 4A93I 3CCQ1 3PBBA 4CAXA 1VKCA 2ZEFA 3CCSZ 5F49A 3GYAA 4MMOA 5E96A 2EK8A 2XEJA 2HC9A 5DS0A 5CM2M 1BLLE 3GKQA 3VB9A 4R3LA 5G20A 1CBXA 3VMHA 4LX9A 1F2OA 3S15I 5F48A 1SQHA 4NGRA 4QUSA 1RNIA 4OC4A 4B13A 4HNXB 2NAPA 1VQNZ 1DL6A 4Y52I 3JVNA 4K30A 1IICA 1Q812 3GTMI 1CP7A 3VMIA 3B3SA 4CYNA 4Y7NI 5H84A 3KIHA 1W2BY 2F5IA 2CXAA 2PJ5A 1Q811 1XMTA 1I1DA 3S14I 2V8GA 3CMAZ 3RNZA 2CIJA 2NSMA 4RVFA 4P4FA 4H6UA 3TOAA 3B7IA 4R87A 3U50C 3I551 1XEBA 2XEIA 1Q862 3JUWA 2FE7A 3WT4A 1I6HI 4E2YA 3I56Z 2XEGA 3WABA 4Q7AA 3RYOA 1Q861 2CNMA 3FRMA 3N7ZA 2GLFA 3P2HA 5LYLA 1S3ZA 1CP6A 2PJ3A 5HXDA 3J7A4 3D67A 1X3ZA 3F3FC 1RQFA 1VQK1 2WB1A 2BOAA 4A3KI 3SJFA 4KLVA 5JH9A 4FBEA 4MFKA 4LQ6A 4DUKA 4LQGA 3G3SA 4MCRA 4DYOA 1VQLZ 4NBGA 2EWBA 3PFOA 4X6AI 2RHBA 2JIPA 4PXDA 3SI2A 1K83I 3KR5A 4B14A 2JDCA 2LIYA 2EO8A 5K8OA 3PO3S 3MZKB 2AFSA 4CYPA 4NCZA 1WCMI 4K3NA 3D4UA 4UWJA 1ZH1A 1K9M2 1S60A 4CGPA 1Z03A 3BJ8A 2PM9A 1K9M1 2BEIA 4NB9A 2ZPAA 3H5ZA 5CNPA 1WJ2A 3CCJZ 3WC5A 4E2WA 2ZOGA 5AG4A 3D2LA 1VQN1 1M4DA 1X0TA 4X3RA 4NJQA 5IP9I 1DE4C 5D1OB 1NUIA 4E33A 4PK3A 3PGPA 1LFWA 2WPWA 2VBQA 4R3KA 1XIXA 4RS4A 3BI0A 3CMA1 1Q822 4L8AA 2FL4A 3QWUA 3T90A 3SJEA 1QSTA 1BPMA 3S1QI 2VXKA 1Q821 4R9MA 2R8VA 4AG7A 1AUGA 1CX8A 3GTLI 5KTCA 3DR8A 3G8WA 4P4EA 3I561 3W91A 2PJ2A 4RVHA 5LYIA 3CCEZ 2JR6A 1K732 3CXPA 5FLMI 2JS4A 4XNHC 2J8MA 4OP4A 4F9UA 1M4GA 1XMBA 4E31A 3F8KA 3S6GA 2G0BA 2EVNA 5AG7A 4JZ0A 3J81b 1RLYA 2PJ8A 4R6TA 3FQMA 4A3JI 2RPRA 3DLJA 2PJ6A 2F7VA 4F8ZA 2JIRA 1VQL1 1VQ6Z 1Z02A 5AG5A 1Z9UA 3NDJA 3S17I 2J6AA 4A39A 1XF8A 1YSJA 4NBHA 2ZW6A 3CPXA 2G3TA 3I07A 3CXCZ 3D7FA 3VATA 2AFZA 4XX2A 2OTJZ 2BCOA 2PJCA 2YNCA 1OZPA 1MK4A 2HB6A 2OZHA 1K8A2 4ONUA 2KCWA 2B63I 4EWCA 4HNWB 4QB9A 1NJI2 5HH1A 4ONWA 3M3YI 3KHXA 2NYQA 1K8A1 2M6NA 4UEZA 3IGRA 5G21A 2I3CA 1JWHC 1NJI1 3MRUA 3CXQA 5G22A 3TTHA 4NGPA 4OC3A 4HGYA 3CCJ1 2KI7B 3HOUI 4DJLA 5J1QA 1KUXA 2JNYA 2HQYA 5LYFA 2PC1A 3MZLB 3NDIA 2WUUA 4QTUA 3BJ7A 5D1PA 1N2FA 2JEVA 4OC2A 4NGNA 4M85A 4UIBA 4JXRA 4RVGA 2DPSA 4E8OA 4PPZA 4U5YA 3DSBA 1KUVA 4MJ8A 2PMZA 2OOXB 1WWZA 4EMEA 4ZX9A 1Z8TA 2JA5I 2PRQA 4UEFA 4C7IA 4R76A 4A3DI 3LWUA 1S5KA 4QC6A 2LEXA 1Z01A 2BUEA 4YWYA 3G6EZ 4F9VA 4F6AA 2HV2A 4RS2A 2K3RA 2IJZA 3TC8A 3G71Z 3FNCA 1Q7Y2 1YJNZ 2AFUA 4MRIA 3FECA 2PVVA 1QF8A 3ZJ0A 1BAVA 3GCFA 2Z0ZA 1Q7Y1 3PB9X 4OMEA 4HH4A 1TXRA 4OC0A 2VUMI 3QNVA 4ZY1A 3GIUA 3IWGA 2QLVB 3HUVA 4AVBA 4C2YA 4MFJA 3D7HA 4XPLA 1VHOA 4BBRI 4QVTA 2J8NA 3PB4X 3VH9A 2DF5A 4IUSA 4WWVA 4KSFA 5IX3A 4I49A 2P6EA 3PEIA 4A94A 1IU8A 3TE5B 3S9LA 2OTJ1 3T4NB 3CT9A 2RBLA 4MD9A 1XE4A 2QA4Z 4UEEA 4MI4A 2VPXA 2ANPA 3KZWA 4YU9A 2FVGA 2JLMA 2C6GA 1YVKA 1VQ51 1ZG7A 4P45A 4MY3A 2ZENA 1FNOA 3T8WA 4XPDB 4UWIA 3GTQI 2ARHA 4PXEA 3JAMb 3TO9A 2PJ7A 4DNCA 1B87A 4IAVA 2ZEPA 4HPSA 2WYRA 2C1CA 2EK9A 4A3FI 3BHXA 1M4IA 3D66A 2QKDA 4R8FA 3KHZA 2REEA 2QECA 4QTTA 1IOIA 4A95A 1QMUA 1WIIA 4OIWA 3FQQA 2J8RA 3FEDA 5JM6A 3F3PC 3NH4A 3FVLA 2M48A 5FLXb 1VQMZ 5I0CA 3H0GI 3D6WA 4BBHA 3CPWY 3RBUA 8CPAA 2Q4YA 4AVCA 2NMTA 1S7LA 1M4LA 4NBAA 2VQYA 4HNYB 1W2BZ 5FVJA 4PV6A 4MCQA 1VLAA 3MGDA 1Q2YA 2OU2A 3G711 3JAMf 4BY7I 4E2ZA 4PXCA 3OW2Y 1ELLP 3B3WA 2PJ4A 4EFDA 2QYVA 3IFEA 3D8PA 5LRJA 3WR7A 1ZO0A 2E9HA 5HVFA 2FCKA 3B8GA 1K4JA 3H8FA 3IIBA 1S72Z 4NXYA 2Q7SA 3FBUA 2R1IA 2ZW5A 1VQ4Z 2Q43A 1S7FA 1VQ7Z 4NBBA 1VQOZ 3GTKI 2REFA 5FLXf 2RB7A 1IOFA 4NSQA 4UCPA 4ZY2A 4OAEA 2YU9I 3FEEA 4BY1I 2BO9A 4BXXI 1I21A 1U6MA 2ZEHA 2PR8A 4GXHA 2QA41 4RV9A 1KQSZ 2GREA 4M6HA 2BSWA 2H85A 2OTL1 2B4DA 1PYTB 2C6CA 1NSAA 2JIMA 5D29A 3K2KA 4IHMA 3NA6A 3D3SA 1F2PA 1IGBA 5C4XI 2IV2X 4NOZA 1R9TI 3DGVA 2OZGA 4KSAA 1TIQA 1LAPA 4UFVA 5THWA 5T64A 2QVPA 4UIAA 4MBUA 2R92I 1PFTA 3GTPI 1TF8A 2FXFA 2FSRA 4AG9A 4KSIA 4JYWA 4MHYA 4KOXA 2V45A 2OZUA 4W9YA 3HOYI 4A3CI 3IWEA 3SI1A 1YI2Z 1YJWZ 2IZ4A 7CPAA 2ZXVA 4E2AA 2V8HA 4JLYA 3I9SA 1Y1WI 1Y9WA 5A27A 3FIXA 1VQM1 1XJOA 4BINA 3QB8A 1KC82 4YFJA 2ODFA 4UCMA 4Z65A 3FYNA 1KC81 3K9UA 1TWAI 4JXQA 4B5PA 4KLWA 3HLPA 3CQZI 1KRLA 3GKRA 3CCS1 1Z8XA 5CPAA 3J80b 2OOYB 2Q51A 1Q2DA 1TKHA
chains in the Genus database with same CATH topology
5CBMA 1LOKA 4TNUA 3I4NI 2HB6A 4MONA 1Y1VI 1K8A2 2IMOA 2W03A 1CG2A 1VQ9Z 3KGQA 4O23A 2B63I 1RTQA 4EWCA 2R7ZI 4P6YA 3SJXA 1NJI2 2PVWA 3CC41 4NGTA 3I1UA 2JBKA 1S721 5D1OA 1ML8A 3KIFA 4ONWA 3M3YI 3KHXA 3VTNA 2V8JA 2NYQA 1K8A1 4E32A 2R93I 2M6NA 4A3II 2C6PA 2PJ9A 1SFOI 1VQ71 1YUAA 2XEFA 4UEZA 1VHEA 2V8IA 2E2II 1ZB8A 2I3CA 1Z8LA 1JWHC 3MN8A 4TWEA 1NJI1 1VQO1 1XFOA 3BI1A 3MRUA 5K8NA 3I4MI 3Q87A 2BJOA 4NGPA 3CME1 4OC3A 3PO2I 4BD9A 4HGYA 3CCJ1 3CCR1 3I55Z 3G4SZ 4A3LI 1TWGI 2OTLZ 4NJRA 2KI7B 1QVFZ 3RAMA 3HOUI 2QRCB 4DJLA 5J1QA 3SJGA 4DK1A 2JNYA 1VQ81 5LYFA 2EGTA 2V8DA 3RZAA 3MZLB 3NDIA 4A3MI 1H8LA 4E2XA 4MCPA 2HU9A 4QTUA 2DE5A 2G2KA 5D1PA 1USPB 4E30A 1N2FA 3GB0A 4OC2A 2J9AA 3KI9A 2RT9A 4NGNA 1R3NA 2PCUA 4UIBA 5IB9A 5D8NA 3D9XA 2NVTI 2JUBA 4AXVA 3J80f 4RVGA 1YLOA 3IWWA 3KQXA 2JEWA 3FF3A 3P5JB 3RZDI 5F09A 4PPZA 3TDHB 1VQKZ 3L2NA 1Z5RA 1S7MA 1PCAA 2G9DA 2PMZA 2OOXB 2OZKA 4NBCA 4CL1A 5A2Qb 2ZEDA 4P44A 4ZX9A 3S9MA 4EMEA 3B3TA 3CC7Z 3CPAA 1YJ91 4B6ZA 2JA5I 3GTJI 3S1MI 2PRQA 4UEFA 2AFMA 3JRUA 3CC2Z 1RO2A 2YADA 4R76A 4A3DI 3LWUA 2W04A 1Z01A 3LUSA 3H3VJ 4NBFA 3D7DA 4YWYA 4WJBA 3G6EZ 3VMGA 2PE3A 4H2KA 4F9VA 5HVHA 2Q4ZA 2F4OA 4S1TA 3GLJA 2K3RA 3IX0A 2DEAA 1JJ2Y 3ESWA 2IJZA 3FMCA 4P4JA 4NH1C 3TC8A 3G71Z 4ZY0A 4ZI6A 1Q7Y2 1YITZ 4NFRA 1YJNZ 3B3VA 3GTMS 1KQSY 4MRIA 2AFUA 1YI21 3BXMA 3FJUA 3FECA 2VL1A 3PFEA 2PVVA 1YJW1 3HOWI 3K9TA 1QF8A 4A3EI 1Y0RA 3WC6A 5I4MA 1BAVA 4UF4A 4R7MA 3GCFA 3FX6A 1Q7Y1 3PB9X 4OMEA 4HH4A 3CD6Z 2JBJA 2CF4A 2DE6A 3N5FA 1TXRA 4OC0A 2PJBA 3KL9A 4MHNA 1I3QI 4P10A 2VUMI 3QNVA 3IF8A 4A93I 3CCQ1 3PBBA 4ZY1A 1YIJZ 1ZLHA 4PQAA 2ZEFA 3D7GA 1TWFI 3CCSZ 2QLVB 1UWYA 3HUVA 1KWMA 1LCPA 3CCMZ 3D7HA 2IZ3A 2R6MA 1VHOA 4MMOA 4BBRI 3CCLZ 2E2HI 3CCVZ 2EK8A 5AN9F 1YW4A 2HF1A 2XEJA 3PB4X 3VH9A 4WWVA 2HC9A 5DS0A 4OC1A 5CM2M 1VGYA 3IFUA 1BLLE 3GKQA 1AYEA 3VB9A 5A2Qf 3PEIA 4A94A 1CPSA 1CBXA 2POKA 3VMHA 1L1OC 1F2OA 1QQ9A 3S15I 2ZOFA 1VQ41 4NGRA 4RUHA 3TE5B 1RNIA 4OC4A 4EWTA 2OTJ1 3S9LA 1JQGA 2VF1A 2O4HA 1VQNZ 3T4NB 1DL6A 2GTHA 3CT9A 2RBLA 4Y52I 4NGSA 4MD9A 2NVYI 1DTDA 3S9NA 2QA4Z 4MD7A 4UEEA 1Q812 1VQ91 1FT7A 3GTMI 1CP7A 1QVGZ 1YW6A 2V8VA 1USPA 3VMIA 3V38A 2V77A 3B3SA 5JGFA 4Y7NI 2QRDB 2ANPA 3V7ZA 3KZWA 3KIHA 1W2BY 1HDUA 1EE3P 4YU9A 2PJ5A 2FVGA 1Q811 2CTCA 2RFHA 5T6BA 1M902 3S14I 3CMAZ 2V8GA 4DGLA 2C6GA 2CIJA 2NSMA 4A3GI 4RVFA 4P4FA 2ZEGA 2K5RA 1VQ51 1ZG7A 1YUKA 3B7IA 4P45A 2ZENA 1FNOA 2GLJA 3U50C 2CTBA 3I551 3G4S1 4DQYB 1M1K2 3T8WA 3NH8A 1M901 4NB8A 2XEIA 1YHQZ 1Q862 2JA6I 3GTQI 4PXEA 4AYBA 3JAMb 1R43A 2O53A 3WT4A 2PJ7A 1I6HI 4IAVA 2V8KA 4E2YA 3I56Z 1VQPZ 2XEGA 1ARMA 2ZEPA 3WABA 4PXBA 4Q7AA 1M1K1 3PBEA 1Q861 2WYRA 5LRKA 2C1CA 2GTIA 2EK9A 4OKOA 4A3FI 3KQZA 3CDXA 3BHXA 3LMSA 2GLFA 5K8MA 3D66A 2JA7I 2IQ6A 5LYLA 1CP6A 2QKDA 2QJ8A 4P4BA 2PJ3A 4NGQA 4R8FA 3KHZA 5HXDA 2GU2A 1RO4A 3J7A4 4QTTA 3D67A 3IC1A 4OIDA 1X3ZA 3F3FC 2WZNA 1QMUA 1WIIA 4OIWA 3FQQA 3CCE1 1RQFA 1LANA 3PRTA 1VQK1 2WB1A 3FEDA 2JA8I 4A3KI 2BOAA 3SJFA 3GTOI 5ELYA 5JM6A 3F3PC 5C44I 3NH4A 4ZX8A 5JH9A 1ZG8A 3FVLA 2M48A 5FLXb 1VQMZ 3H0GI 1RO0A 4FBEA 3D6WA 3HOXI 3CC71 4FAIA 1Y1VS 3EEDA 1K731 4DUKA 3CPWY 3K7AI 4LQGA 3RBUA 8CPAA 4IK2A 3H8EA 1M4LA 3NH5A 3HOVI 4NBAA 1ZB9A 4MCRA 4DYOA 1I50I 1X3WA 3HOZI 1VQLZ 2QEXZ 4NBGA 2PIZA 1W2BZ 2RIQA 4G1PA 1VLAA 2EWBA 4MCQA 2PJ0A 3PFOA 4X6AI 3G711 2RHBA 4PXDA 4MXUA 1YIT1 3SI2A 1K83I 3JAMf 4BY7I 3KR5A 4E2ZA 1TF9A 4A38A 4PXCA 2LIYA 3OW2Y 3ISZA 1ELLP 4GM5A 4MHPA 2AFWA 4CPAA 3B3WA 5K8OA 3CCUZ 2PIYA 2PJ4A 3PO3S 3MZKB 2AFSA 2AFOA 3M4OI 1VQ61 2AKLA 3FKII 4EFDA 2QYVA 3IFEA 3CD61 5LRJA 2E9HA 2E2JI 1WCMI 1ZLIA 5HVFA 4K3NA 3D4UA 3H8FA 3IJ3A 3ISXA 3IIBA 1ZH1A 1XRYA 5IT9f 1YIJ1 1AMPA 3CC4Z 1K9M2 4FUUA 4NBDA 1HEEA 1S72Z 3SI0A 1VQ4Z 2Q43A 4NBEA 3PB7X 3EERA 1Z03A 1VQ7Z 4NBBA 3B2YA 2LFUA 2JMOA 1VQOZ 2PM9A 1K9M1 3GTKI 1TKJA 4NB9A 4ZYQA 5FLXf 5LYDA 3CMEZ 2RB7A 3WC7A 3S2HI 3BG1B 3CCJZ 3MONA 3CCRZ 1OBRA 4ZY2A 3WC5A 2YU9I 3IEHA 3FEEA 1TWHI 4BY1I 4E2WA 2BO9A 4BXXI 1VQ8Z 2OR4A 4X2TA 4MHZA 2ABZA 2ZOGA 2F4MA 1VQN1 2ZEEA 2ZEHA 1X0TA 1JJ2Z 1Y0YA 4X3RA 4NJQA 3TX8A 5IP9I 3S16I 1DE4C 5D1OB 4RV9A 3CPWZ 1NUIA 4E33A 2QA41 1KQSZ 1VQ5Z 2GREA 2ZEMA 1ARLA 3J81f 2H85A 2OTL1 5K8PA 4P4IA 1PYTB 1HDQA 2C6CA 1NSAA 4A37A 5D29A 3PO3I 3K2KA 4IHMA 1LFWA 1IY7A 3FH4A 3NA6A 2WAQA 4RS4A 1F2PA 1IGBA 2P28A 2QREB 3CMA1 2F8HA 1Q822 2PJ1A 3BI0A 3IO1A 3PB6X 3B3CA 5C4XI 3QWUA 2DE7A 4NOZA 3SJEA 3CXCY 1R9TI 3DGVA 1BPMA 4OC5A 4RVDA 2ZEOA 3S1QI 1LAPA 3HKZA 3OW2Z 1Y7EA 1QYPA 5THWA 5T64A 1Q821 2QVPA 1YHQ1 2Y0SA 1KD12 4HGZA 1CX8A 3GTLI 3GTGI 3RZOI 1N8R2 1LQLA 5IT9b 1YJ9Z 4UIAA 1VQP1 4P4EA 3I561 2R92I 1PFTA 4FWUA 3GTPI 1TF8A 2PJ2A 4RVHA 2NVQI 3KR4A 5LYIA 1KD11 3CCEZ 2JR6A 3S1RI 1K732 1N8R1 4KSIA 4JYWA 4MHYA 5FLMI 2JS4A 4OP4A 4F9UA 4MD8A 4W9YA 4NGMA 1XMBA 4E31A 3HOYI 1YMEA 3KASA 4A3CI 2OOTA 3SI1A 1CPXA 1ELMP 4P4DA 1YI2Z 1BPNA 1TWCI 5C3EI 2ZAEB 3CC21 1YJWZ 1QVGY 1F57A 2IZ4A 2PJAA 2ZELA 1QVFY 7CPAA 4A3BI 5IP7I 3NFZA 2V8HA 3G6E1 3BG0B 5T67A 3S2DI 1GYTA 5LRGA 1Y1WI 1TKFA 4JZ0A 1VQM1 1ZG9A 4BBSI 1XJOA 3J81b 3B35A 5LL6f 1RLYA 2AFXA 1YJN1 2PJ8A 3D68A 1KC82 3CCQZ 2PK7A 4R6TA 4MCSA 3FQMA 5HVGA 4A3JI 2RPRA 3DLJA 4Z65A 3VARA 3S1NI 1VIXA 2QR1B 2KPIA 3GUXA 2P3YA 1Z2LA 2F7VA 2PJ6A 4F8ZA 2NVXI 3H8GA 1KC81 1P9NA 2QEX1 1Z02A 1VQL1 1TWAI 1VQ6Z 1Q7LA 4MH4A 4X8IA 1XBUA 3NDJA 3S17I 2J6AA 4A39A 1YSJA 1WW9A 4NBHA 3CPXA 3HLPA 3CQZI 5C4JI 1KRLA 1TFIA 6CPAA 3I07A 3CXCZ 3CCS1 5CPAA 3D7FA 1NP6A 3VATA 3CCU1 3J80b 3CCM1 2VUGA 2OOYB 4XX2A 2AFZA 2OTJZ 2BCOA 2PJCA 3CCL1 2Q51A 3CCV1 1LAMA 1TKHA 3PB8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBM A;  1LOK A;  4TNU A;  2HB6 A;  2IMO A;  1CG2 A;  3KGQ A;  4O23 A;  1RTQ A;  4P6Y A;  3SJX A;  2PVW A;  4NGT A;  3I1U A;  2JBK A;  4ONW A;  3KHX A;  2NYQ A;  2C6P A;  4UEZ A;  2PJ9 A;  2XEF A;  1VHE A;  3MN8 A;  2I3C A;  1Z8L A;  4TWE A;  1XFO A;  3BI1 A;  3MRU A;  5K8N A;  4NGP A;  4OC3 A;  4BD9 A;  4NJR A;  3RAM A;  4DJL A;  5J1Q A;  3SJG A;  5LYF A;  3RZA A;  2V8D A;  1H8L A;  4MCP A;  3GB0 A;  4OC2 A;  2J9A A;  3KI9 A;  4NGN A;  1R3N A;  2PCU A;  4UIB A;  5IB9 A;  5D8N A;  4AXV A;  1YLO A;  3IWW A;  3KQX A;  2JEW A;  3FF3 A;  5F09 A;  4PPZ A;  3L2N A;  1Z5R A;  1PCA A;  2G9D A;  2ZED A;  4EME A;  4P44 A;  4ZX9 A;  3S9M A;  3B3T A;  3CPA A;  4B6Z A;  2PRQ A;  4UEF A;  2AFM A;  3JRU A;  4R76 A;  3LWU A;  3D7D A;  4YWY A;  4WJB A;  2PE3 A;  4H2K A;  4F9V A;  5HVH A;  2Q4Z A;  3GLJ A;  2DEA A;  4P4J A;  2IJZ A;  3FMC A;  3TC8 A;  4ZY0 A;  4ZI6 A;  4NFR A;  3B3V A;  3PFE A;  3FJU A;  2AFU A;  4MRI A;  3BXM A;  3FEC A;  2VL1 A;  2PVV A;  3K9T A;  1Y0R A;  3WC6 A;  5I4M A;  1BAV A;  4UF4 A;  4R7M A;  3FX6 A;  3PB9 X;  4OME A;  2JBJ A;  2CF4 A;  3N5F A;  1TXR A;  4OC0 A;  2PJB A;  3KL9 A;  4MHN A;  4P10 A;  3QNV A;  3PBB A;  4ZY1 A;  1ZLH A;  4PQA A;  2ZEF A;  3D7G A;  1UWY A;  3HUV A;  1KWM A;  1LCP A;  3D7H A;  1VHO A;  4MMO A;  2EK8 A;  1YW4 A;  2XEJ A;  3PB4 X;  3VH9 A;  4WWV A;  2HC9 A;  5DS0 A;  4OC1 A;  1VGY A;  1BLL E;  1AYE A;  3PEI A;  4A94 A;  1CPS A;  1CBX A;  2POK A;  1F2O A;  1QQ9 A;  2ZOF A;  4NGR A;  4RUH A;  4OC4 A;  4EWT A;  3S9L A;  1JQG A;  2O4H A;  3CT9 A;  4NGS A;  1DTD A;  3S9N A;  4UEE A;  1FT7 A;  1CP7 A;  1YW6 A;  2V8V A;  3V38 A;  2V77 A;  3B3S A;  5JGF A;  2ANP A;  3V7Z A;  3KZW A;  1HDU A;  1EE3 P;  4YU9 A;  2PJ5 A;  2FVG A;  2CTC A;  2RFH A;  2V8G A;  2C6G A;  2CIJ A;  2NSM A;  4P4F A;  2ZEG A;  1ZG7 A;  3B7I A;  4P45 A;  2ZEN A;  1FNO A;  2GLJ A;  2CTB A;  3T8W A;  3NH8 A;  2XEI A;  4PXE A;  1R43 A;  2O53 A;  3WT4 A;  2PJ7 A;  4IAV A;  2XEG A;  1ARM A;  2ZEP A;  3WAB A;  4PXB A;  4Q7A A;  3PBE A;  2WYR A;  5LRK A;  2C1C A;  2EK9 A;  4OKO A;  3KQZ A;  3CDX A;  3BHX A;  3LMS A;  2GLF A;  5K8M A;  3D66 A;  2IQ6 A;  5LYL A;  1CP6 A;  2QJ8 A;  4P4B A;  2PJ3 A;  4NGQ A;  4R8F A;  3KHZ A;  5HXD A;  2GU2 A;  4OID A;  3D67 A;  3IC1 A;  2WZN A;  1QMU A;  4OIW A;  1LAN A;  3PRT A;  3FED A;  2BOA A;  3SJF A;  5ELY A;  5JM6 A;  5JH9 A;  3NH4 A;  4ZX8 A;  1ZG8 A;  3FVL A;  4FBE A;  4FAI A;  4DUK A;  3RBU A;  4LQG A;  8CPA A;  4IK2 A;  3H8E A;  1M4L A;  3NH5 A;  4MCR A;  4DYO A;  2PIZ A;  4G1P A;  2EWB A;  4MCQ A;  2PJ0 A;  3PFO A;  4PXD A;  4MXU A;  3SI2 A;  3KR5 A;  1TF9 A;  4A38 A;  4PXC A;  3ISZ A;  4CPA A;  4GM5 A;  1ELL P;  4MHP A;  2AFW A;  3B3W A;  5K8O A;  2PIY A;  2PJ4 A;  2AFS A;  2AFO A;  4EFD A;  2QYV A;  3IFE A;  5LRJ A;  1ZLI A;  5HVF A;  4K3N A;  3D4U A;  3H8F A;  3IJ3 A;  3ISX A;  3IIB A;  1XRY A;  1AMP A;  4FUU A;  1HEE A;  3SI0 A;  2Q43 A;  3PB7 X;  3B2Y A;  1TKJ A;  4ZYQ A;  5LYD A;  3WC7 A;  2RB7 A;  1OBR A;  4ZY2 A;  3WC5 A;  3IEH A;  3FEE A;  2BO9 A;  2OR4 A;  4X2T A;  4MHZ A;  2ABZ A;  2ZOG A;  2ZEE A;  2ZEH A;  1Y0Y A;  4X3R A;  4NJQ A;  3TX8 A;  1DE4 C;  2GRE A;  2ZEM A;  1ARL A;  5K8P A;  4P4I A;  1PYT B;  1HDQ A;  2C6C A;  1NSA A;  4A37 A;  5D29 A;  3K2K A;  4IHM A;  1LFW A;  1IY7 A;  3FH4 A;  3NA6 A;  1F2P A;  1IGB A;  3BI0 A;  3PB6 X;  2F8H A;  2PJ1 A;  3IO1 A;  3B3C A;  3SJE A;  3DGV A;  1BPM A;  4OC5 A;  2ZEO A;  1LAP A;  1Y7E A;  5THW A;  2QVP A;  1CX8 A;  4UIA A;  4P4E A;  4FWU A;  1TF8 A;  2PJ2 A;  3KR4 A;  5LYI A;  4KSI A;  4JYW A;  4MHY A;  4OP4 A;  4F9U A;  4W9Y A;  4NGM A;  1XMB A;  1YME A;  3KAS A;  2OOT A;  3SI1 A;  1CPX A;  1ELM P;  4P4D A;  1BPN A;  2ZEL A;  1F57 A;  2PJA A;  7CPA A;  3NFZ A;  2V8H A;  1GYT A;  5LRG A;  1TKF A;  4JZ0 A;  1ZG9 A;  1XJO A;  3B35 A;  2AFX A;  3D68 A;  2PJ8 A;  4R6T A;  4MCS A;  5HVG A;  3DLJ A;  4Z65 A;  3VAR A;  1VIX A;  3GUX A;  1Z2L A;  2PJ6 A;  2F7V A;  4F8Z A;  3H8G A;  1Q7L A;  4X8I A;  1XBU A;  4A39 A;  1YSJ A;  3CPX A;  3HLP A;  6CPA A;  5CPA A;  3D7F A;  3VAT A;  2AFZ A;  2BCO A;  2PJC A;  2Q51 A;  1LAM A;  1TKH A;  3PB8 X; 
#chains in the Genus database with same CATH topology
 5CBM A;  1LOK A;  1LRZ A;  1FDO A;  1Y8C A;  3I4N I;  1Y1V I;  2Z3K A;  4O23 A;  1RTQ A;  4P6Y A;  4CRY B;  5EC4 A;  4NGT A;  1S72 1;  3KIF A;  2V8J A;  2R93 I;  2C6P A;  4A3I I;  2GIV A;  1VQ7 1;  2IL4 A;  2E2I I;  1ZB8 A;  3MN8 A;  3IU1 A;  2GAN A;  1VQO 1;  1XFO A;  4Q38 A;  2P6G A;  5A28 A;  3PO2 I;  3QAH A;  5ISV A;  3G4S Z;  4A3L I;  3GY9 A;  4H89 A;  1KZF A;  1QSN A;  3RAM A;  2QRC B;  2EGT A;  1H8L A;  4E2X A;  4MCP A;  4KS9 A;  4E30 A;  2GE3 A;  5G1Z A;  4MFP A;  3LD2 A;  2J9A A;  4Y49 C;  5IB9 A;  1JWQ A;  2R7H A;  5D8N A;  3D9X A;  3J80 f;  4UFX A;  5JQ4 A;  2B4D B;  1ON0 A;  3TDH B;  1S7M A;  3C26 A;  2G9D A;  2OZK A;  4A2Z A;  4CL1 A;  5A2Q b;  3CC7 Z;  3CPA A;  4B6Z A;  3GTJ I;  2CNS A;  4HKF A;  2AFM A;  2D4P A;  4B12 A;  3JRU A;  3CC2 Z;  1RO2 A;  1M1D A;  4OAD A;  2G3A A;  3LUS A;  5DWN A;  1SIW A;  1P4N A;  4WJB A;  3VMG A;  4H2K A;  1Y7R A;  1BOB A;  2Q4Z A;  2F4O A;  2YGW A;  3FMC A;  4ZI6 A;  1YIT Z;  4NFR A;  3B3V A;  3GTM S;  3FJU A;  1LAM A;  1YI2 1;  4KOW A;  1YJW 1;  3HOW I;  3K9T A;  3CD6 Z;  4Q36 A;  3KL9 A;  1I3Q I;  5GCN A;  4CAW A;  1YIJ Z;  4PQA A;  4AVA A;  5C88 A;  1KWM A;  3EY5 A;  3CCM Z;  2IZ3 A;  3CCL Z;  2E2H I;  4M6I A;  3CCV Z;  1NMT A;  2CNT A;  1YW4 A;  4B5O A;  4OC1 A;  1VGY A;  3SXO A;  3IFU A;  4CGM A;  1AYE A;  5A2Q f;  1CPS A;  1QQ9 A;  2WPX A;  4B5P B;  3H4Q A;  1QSR A;  3S6H A;  1I12 A;  1UFH A;  2B4B A;  1FT7 A;  1YW6 A;  1QVG Z;  2V8V A;  1USP A;  5AG6 A;  2V77 A;  2QRD B;  3TO6 A;  3V7Z A;  2VEZ A;  1KUY A;  4CAF A;  5T6B A;  1M90 2;  4UA3 A;  4DGL A;  4RI1 A;  2ZEG A;  2GLJ A;  2AJ6 A;  3G4S 1;  1M90 1;  2ZW7 A;  1YHQ Z;  3DNS A;  4AYB A;  4KOU A;  4M3S A;  1YK3 A;  2V8K A;  3ZZI A;  1ARM A;  4PXB A;  4UCN A;  5LRK A;  2GTI A;  3KQZ A;  5BWA B;  1QSM A;  3CDX A;  3LMS A;  2B58 A;  2IQ6 A;  4OLL A;  4P4B A;  2GU2 A;  2FIW A;  3CCE 1;  3D2P A;  1LAN A;  5IB0 A;  4A32 A;  2JA8 I;  5ELY A;  4ZX8 A;  2DPT A;  1Z8W A;  3CC7 1;  1Y1V S;  2QIR A;  2EBJ A;  1S7N A;  2EUI A;  4PSW A;  3H8E A;  4M6G A;  3HOV I;  3W6S A;  1I50 I;  2QEX Z;  2RIQ A;  4G1P A;  2PJ0 A;  2VZZ A;  4MXU A;  1YIT 1;  1WZN A;  2WSA A;  2I00 A;  3ISZ A;  4MHP A;  2AE6 A;  1M44 A;  1VQ6 1;  4KVX A;  3F0A A;  2AKL A;  3FKI I;  3CD6 1;  1ZLI A;  2Q0Y A;  4XNH B;  4U9Z A;  1XRY A;  5IT9 f;  1YIJ 1;  3CC4 Z;  4FD5 A;  4NBD A;  4E0A A;  3R96 A;  3SI0 A;  1QXF A;  4NBE A;  1X12 A;  3B2Y A;  2JMO A;  1IID A;  4ZYQ A;  2B3V A;  2VZY A;  3WC7 A;  1BO4 A;  3BG1 B;  3MON A;  1OBR A;  3IEH A;  4X2T A;  4MHZ A;  4C2X A;  2BL1 A;  2F4M A;  1JJ2 Z;  4A30 A;  3TX8 A;  4KOY A;  4J3G A;  1CJW A;  3CPW Z;  1ARL A;  5K8P A;  1HDQ A;  4CGO A;  4A37 A;  2E7Z A;  3PO3 I;  3R9F A;  3FH4 A;  2P28 A;  2QRE B;  4GS4 A;  2PJ1 A;  3IO1 A;  3PB6 X;  2P0W A;  4CS0 B;  2ZEO A;  1Y7E A;  3HKZ A;  3OW2 Z;  4NEX A;  4B11 A;  1YHQ 1;  2Y0S A;  1KD1 2;  3GTG I;  2FT0 A;  4C68 A;  5J8F A;  2Z3O A;  2YNE A;  2VI7 A;  4F0X A;  1KD1 1;  3S1R I;  3S6F A;  1IYK A;  3OWC A;  4C7H A;  4A33 A;  1FY7 A;  4IF5 A;  4MD8 A;  4CYQ A;  1P0H A;  2PDO A;  4P4D A;  1TWC I;  1F57 A;  1QVF Y;  3PP9 A;  4A3B I;  1R57 A;  3G6E 1;  3BG0 B;  5T67 A;  5LRG A;  1ZG9 A;  4B10 A;  1PUA A;  2AFX A;  1NE9 A;  1YJN 1;  1MJ9 A;  4MCS A;  2FS5 A;  4KUB A;  3VAR A;  3S1N I;  1VIX A;  2YND A;  2KPI A;  2P3Y A;  1AA6 A;  2NVX I;  1Q7L A;  1P9N A;  2QEX 1;  2K5T A;  3VWE A;  4EVY A;  4MH4 A;  4X8I A;  2A4N A;  3EC4 A;  4BMH A;  4KOT A;  5HMN A;  1YLE A;  1NP6 A;  2Z3P A;  1RXT A;  2VPW A;  3EFA A;  3NE7 A;  2Z3N A;  2PR1 A;  2W03 A;  1CG2 A;  1VQ9 Z;  4ZBG A;  3CC4 1;  3I1U A;  2JBK A;  5D1O A;  1ML8 A;  5KTD A;  3KKW A;  3VTN A;  3BLN A;  2PSW A;  4E32 A;  4MY0 A;  5JPH A;  2GFQ A;  1S7K A;  2PJ9 A;  1YUA A;  3A9L A;  2V8I A;  2V3V A;  5K8N A;  3Q87 A;  2BJO A;  2Q4V A;  3SJG A;  2DXQ A;  4DK1 A;  1IB1 E;  4A3M I;  2Q04 A;  2HU9 A;  4F0Y A;  2DE5 A;  2P6F A;  3KI9 A;  2JIQ A;  1CM0 A;  2RT9 A;  2CY2 A;  2H5M A;  2PCU A;  2Q44 A;  4MFQ A;  2JUB A;  4AXV A;  1YRE A;  2JEW A;  3FF3 A;  3R1K A;  5F09 A;  1Z5R A;  1PCA A;  1YQE A;  3SXN A;  4L89 A;  1WK4 A;  5IV0 A;  2ZED A;  4P44 A;  4YRH A;  3B3T A;  4XPK A;  3TOB A;  2X7B A;  3S1M I;  3TCV A;  2YAD A;  3CXS A;  3H3V J;  3D7D A;  3S6K A;  2PE3 A;  4JWP A;  5HVH A;  4S1T A;  3GLJ A;  3IX0 A;  2DEA A;  3ESW A;  4X5K A;  3PFE A;  1KQS Y;  2VL1 A;  3DDD A;  1Y0R A;  4A3E I;  3WC6 A;  1X10 A;  4UF4 A;  4R7M A;  3FX6 A;  4QBJ A;  4RN7 A;  2Y0M A;  2JBJ A;  2DE6 A;  2PJB A;  1GHE A;  1YR0 A;  4P10 A;  3D2M A;  3T9Y A;  1ZLH A;  3D7G A;  1TWF I;  1UWY A;  2O28 A;  3R9E A;  1LCP A;  1YGH A;  2R6M A;  5AN9 F;  2HF1 A;  5EMI A;  4II9 A;  4U9Y A;  1A2Z A;  4AB7 A;  2POK A;  1L1O C;  5EBV A;  3W6X A;  2OH1 A;  2ZOF A;  1VQ4 1;  4RUH A;  4EWT A;  3V8I A;  1JQG A;  3NE8 A;  2VF1 A;  2O4H A;  1V0C A;  2GTH A;  4NGS A;  4KVM E;  2NVY I;  1DTD A;  2JDD A;  4KVO E;  3S9N A;  4MD7 A;  1VQ9 1;  2Z3M A;  3V38 A;  4A31 A;  5JGF A;  2FIA A;  1HDU A;  1EE3 P;  4MFZ A;  2Z10 A;  2CTC A;  2RFH A;  1MJA A;  4A3G I;  2PRB A;  4LUA A;  2K5R A;  1YUK A;  2CTB A;  4DQY B;  1M1K 2;  3NH8 A;  4NB8 A;  4UBR A;  2JA6 I;  1R43 A;  2O53 A;  1VQP Z;  3VWD A;  4H6Z A;  1M1K 1;  3PBE A;  3CZX A;  2AYD A;  4OKO A;  5K8M A;  2JA7 I;  2QJ8 A;  4NGQ A;  1RO4 A;  4OID A;  3IC1 A;  2WZN A;  4MHD A;  3PRT A;  3GTO I;  4CAE A;  4ORF A;  5C44 I;  3LOD A;  1ZG8 A;  3R95 A;  1RO0 A;  3HOX I;  4YGO A;  4FAI A;  3EED A;  1K73 1;  3K7A I;  4KUA A;  4IK2 A;  3NH5 A;  1IYL A;  1ZB9 A;  1X3W A;  3HOZ I;  4JD6 A;  2PIZ A;  2RC4 A;  3IU2 A;  1RO5 A;  2YNC C;  1TF9 A;  4A38 A;  4CPA A;  4GM5 A;  2AFW A;  3CCU Z;  2PIY A;  2AFO A;  3M4O I;  3RO0 A;  1YVO A;  5J8C A;  2E2J I;  3TO7 A;  4XPD C;  3IJ3 A;  3ISX A;  3UY5 A;  4FD4 A;  1AMP A;  4FUU A;  1HEE A;  4FD7 A;  3SHP A;  4PSX A;  2Z3L A;  3PB7 X;  3EER A;  1Y9K A;  2LFU A;  1TKJ A;  1L0C A;  4UFW A;  5LYD A;  3CME Z;  3S2H I;  3CCR Z;  4CRZ B;  5H86 A;  1TWH I;  1VQ8 Z;  2OR4 A;  2R98 A;  2ABZ A;  2ZEE A;  3LAC A;  1Y0Y A;  2HUZ A;  3DR6 A;  3S16 I;  3QAY A;  5C82 A;  1VQ5 Z;  1N71 A;  2ZEM A;  3J81 f;  4P4I A;  1PU9 A;  1IY7 A;  3TT2 A;  2WAQ A;  4ZGY B;  2F8H A;  1Z4E A;  3B3C A;  2DE7 A;  3CXC Y;  4OC5 A;  4RVD A;  1QYP A;  2I79 A;  4HGZ A;  3RZO I;  3JTK A;  1N8R 2;  1LQL A;  5IT9 b;  1YJ9 Z;  1VQP 1;  4FWU A;  2B5G A;  1XOV A;  2NVQ I;  3KR4 A;  5DWM A;  1N8R 1;  4NGM A;  2Z11 A;  1Z4R A;  1YME A;  3KAS A;  2ATR A;  3FB3 A;  2OOT A;  1CPX A;  1ELM P;  1BPN A;  5C3E I;  2ZAE B;  3CC2 1;  1QVG Y;  2ZEL A;  2PJA A;  5IP7 I;  4R57 A;  3NFZ A;  3S2D I;  1GYT A;  1TKF A;  2C27 A;  4BBS I;  3B35 A;  2JIO A;  5LL6 f;  3D68 A;  4NF1 A;  4Y49 B;  3CCQ Z;  4C2Z A;  2PK7 A;  2B3U A;  2OB0 A;  5HVG A;  3P2F A;  5F46 A;  4MFL A;  2QR1 B;  3GUX A;  1Z2L A;  1YX0 A;  3H8G A;  1XBU A;  4CGL A;  2D4O A;  1WW9 A;  5C4J I;  1TFI A;  1NSL A;  6CPA A;  3R9G A;  5F47 A;  5AGE A;  3CCU 1;  3CCM 1;  2VUG A;  3CCL 1;  3CCV 1;  3PB8 X;  4CGN A;  4TNU A;  4MON A;  2IMO A;  3KGQ A;  2R7Z I;  2QML A;  3SJX A;  5KTA A;  4CYO A;  2PVW A;  1SFO I;  2XEF A;  1VHE A;  1Z8L A;  4TWE A;  3BI1 A;  3I4M I;  3CME 1;  2VPY A;  4BD9 A;  3CCR 1;  3I55 Z;  1TWG I;  2OTL Z;  4CAV A;  4NJR A;  1QVF Z;  2Q7B A;  1Q2C A;  2ZW4 A;  1VQ8 1;  3FXT A;  3RZA A;  2V8D A;  4JJX A;  2PQ8 A;  2G2K A;  1USP B;  1QSO A;  4KOS A;  3GB0 A;  3E0K A;  1Q16 A;  1MJB A;  1R3N A;  3F5B A;  2VPZ A;  2NVT I;  3EO4 A;  1YLO A;  3IWW A;  3KQX A;  3P5J B;  3RZD I;  1FDI A;  1VQK Z;  3L2N A;  3IR7 A;  1B6B A;  3EXN A;  3PZJ A;  4NBC A;  3S9M A;  1YJ9 1;  4FD6 A;  3TE4 A;  4KOV A;  1J4J A;  3I3G A;  2W04 A;  4NBF A;  2B5G B;  4P4J A;  1JJ2 Y;  4NH1 C;  4PK2 A;  4ZY0 A;  3BXM A;  5I4M A;  4KOR A;  2CF4 A;  3N5F A;  3TFY A;  4MHN A;  1VHS A;  4KZT A;  3IF8 A;  4A93 I;  3CCQ 1;  3PBB A;  4CAX A;  1VKC A;  2ZEF A;  3CCS Z;  5F49 A;  3GYA A;  4MMO A;  5E96 A;  2EK8 A;  2XEJ A;  2HC9 A;  5DS0 A;  5CM2 M;  1BLL E;  3GKQ A;  3VB9 A;  4R3L A;  5G20 A;  1CBX A;  3VMH A;  4LX9 A;  1F2O A;  3S15 I;  5F48 A;  1SQH A;  4NGR A;  4QUS A;  1RNI A;  4OC4 A;  4B13 A;  4HNX B;  2NAP A;  1VQN Z;  1DL6 A;  4Y52 I;  3JVN A;  4K30 A;  1IIC A;  1Q81 2;  3GTM I;  1CP7 A;  3VMI A;  3B3S A;  4CYN A;  4Y7N I;  5H84 A;  3KIH A;  1W2B Y;  2F5I A;  2CXA A;  2PJ5 A;  1Q81 1;  1XMT A;  1I1D A;  3S14 I;  2V8G A;  3CMA Z;  3RNZ A;  2CIJ A;  2NSM A;  4RVF A;  4P4F A;  4H6U A;  3TOA A;  3B7I A;  4R87 A;  3U50 C;  3I55 1;  1XEB A;  2XEI A;  1Q86 2;  3JUW A;  2FE7 A;  3WT4 A;  1I6H I;  4E2Y A;  3I56 Z;  2XEG A;  3WAB A;  4Q7A A;  3RYO A;  1Q86 1;  2CNM A;  3FRM A;  3N7Z A;  2GLF A;  3P2H A;  5LYL A;  1S3Z A;  1CP6 A;  2PJ3 A;  5HXD A;  3J7A 4;  3D67 A;  1X3Z A;  3F3F C;  1RQF A;  1VQK 1;  2WB1 A;  2BOA A;  4A3K I;  3SJF A;  4KLV A;  5JH9 A;  4FBE A;  4MFK A;  4LQ6 A;  4DUK A;  4LQG A;  3G3S A;  4MCR A;  4DYO A;  1VQL Z;  4NBG A;  2EWB A;  3PFO A;  4X6A I;  2RHB A;  2JIP A;  4PXD A;  3SI2 A;  1K83 I;  3KR5 A;  4B14 A;  2JDC A;  2LIY A;  2EO8 A;  5K8O A;  3PO3 S;  3MZK B;  2AFS A;  4CYP A;  4NCZ A;  1WCM I;  4K3N A;  3D4U A;  4UWJ A;  1ZH1 A;  1K9M 2;  1S60 A;  4CGP A;  1Z03 A;  3BJ8 A;  2PM9 A;  1K9M 1;  2BEI A;  4NB9 A;  2ZPA A;  3H5Z A;  5CNP A;  1WJ2 A;  3CCJ Z;  3WC5 A;  4E2W A;  2ZOG A;  5AG4 A;  3D2L A;  1VQN 1;  1M4D A;  1X0T A;  4X3R A;  4NJQ A;  5IP9 I;  1DE4 C;  5D1O B;  1NUI A;  4E33 A;  4PK3 A;  3PGP A;  1LFW A;  2WPW A;  2VBQ A;  4R3K A;  1XIX A;  4RS4 A;  3BI0 A;  3CMA 1;  1Q82 2;  4L8A A;  2FL4 A;  3QWU A;  3T90 A;  3SJE A;  1QST A;  1BPM A;  3S1Q I;  2VXK A;  1Q82 1;  4R9M A;  2R8V A;  4AG7 A;  1AUG A;  1CX8 A;  3GTL I;  5KTC A;  3DR8 A;  3G8W A;  4P4E A;  3I56 1;  3W91 A;  2PJ2 A;  4RVH A;  5LYI A;  3CCE Z;  2JR6 A;  1K73 2;  3CXP A;  5FLM I;  2JS4 A;  4XNH C;  2J8M A;  4OP4 A;  4F9U A;  1M4G A;  1XMB A;  4E31 A;  3F8K A;  3S6G A;  2G0B A;  2EVN A;  5AG7 A;  4JZ0 A;  3J81 b;  1RLY A;  2PJ8 A;  4R6T A;  3FQM A;  4A3J I;  2RPR A;  3DLJ A;  2PJ6 A;  2F7V A;  4F8Z A;  2JIR A;  1VQL 1;  1VQ6 Z;  1Z02 A;  5AG5 A;  1Z9U A;  3NDJ A;  3S17 I;  2J6A A;  4A39 A;  1XF8 A;  1YSJ A;  4NBH A;  2ZW6 A;  3CPX A;  2G3T A;  3I07 A;  3CXC Z;  3D7F A;  3VAT A;  2AFZ A;  4XX2 A;  2OTJ Z;  2BCO A;  2PJC A;  2YNC A;  1OZP A;  1MK4 A;  2HB6 A;  2OZH A;  1K8A 2;  4ONU A;  2KCW A;  2B63 I;  4EWC A;  4HNW B;  4QB9 A;  1NJI 2;  5HH1 A;  4ONW A;  3M3Y I;  3KHX A;  2NYQ A;  1K8A 1;  2M6N A;  4UEZ A;  3IGR A;  5G21 A;  2I3C A;  1JWH C;  1NJI 1;  3MRU A;  3CXQ A;  5G22 A;  3TTH A;  4NGP A;  4OC3 A;  4HGY A;  3CCJ 1;  2KI7 B;  3HOU I;  4DJL A;  5J1Q A;  1KUX A;  2JNY A;  2HQY A;  5LYF A;  2PC1 A;  3MZL B;  3NDI A;  2WUU A;  4QTU A;  3BJ7 A;  5D1P A;  1N2F A;  2JEV A;  4OC2 A;  4NGN A;  4M85 A;  4UIB A;  4JXR A;  4RVG A;  2DPS A;  4E8O A;  4PPZ A;  4U5Y A;  3DSB A;  1KUV A;  4MJ8 A;  2PMZ A;  2OOX B;  1WWZ A;  4EME A;  4ZX9 A;  1Z8T A;  2JA5 I;  2PRQ A;  4UEF A;  4C7I A;  4R76 A;  4A3D I;  3LWU A;  1S5K A;  4QC6 A;  2LEX A;  1Z01 A;  2BUE A;  4YWY A;  3G6E Z;  4F9V A;  4F6A A;  2HV2 A;  4RS2 A;  2K3R A;  2IJZ A;  3TC8 A;  3G71 Z;  3FNC A;  1Q7Y 2;  1YJN Z;  2AFU A;  4MRI A;  3FEC A;  2PVV A;  1QF8 A;  3ZJ0 A;  1BAV A;  3GCF A;  2Z0Z A;  1Q7Y 1;  3PB9 X;  4OME A;  4HH4 A;  1TXR A;  4OC0 A;  2VUM I;  3QNV A;  4ZY1 A;  3GIU A;  3IWG A;  2QLV B;  3HUV A;  4AVB A;  4C2Y A;  4MFJ A;  3D7H A;  4XPL A;  1VHO A;  4BBR I;  4QVT A;  2J8N A;  3PB4 X;  3VH9 A;  2DF5 A;  4IUS A;  4WWV A;  4KSF A;  5IX3 A;  4I49 A;  2P6E A;  3PEI A;  4A94 A;  1IU8 A;  3TE5 B;  3S9L A;  2OTJ 1;  3T4N B;  3CT9 A;  2RBL A;  4MD9 A;  1XE4 A;  2QA4 Z;  4UEE A;  4MI4 A;  2VPX A;  2ANP A;  3KZW A;  4YU9 A;  2FVG A;  2JLM A;  2C6G A;  1YVK A;  1VQ5 1;  1ZG7 A;  4P45 A;  4MY3 A;  2ZEN A;  1FNO A;  3T8W A;  4XPD B;  4UWI A;  3GTQ I;  2ARH A;  4PXE A;  3JAM b;  3TO9 A;  2PJ7 A;  4DNC A;  1B87 A;  4IAV A;  2ZEP A;  4HPS A;  2WYR A;  2C1C A;  2EK9 A;  4A3F I;  3BHX A;  1M4I A;  3D66 A;  2QKD A;  4R8F A;  3KHZ A;  2REE A;  2QEC A;  4QTT A;  1IOI A;  4A95 A;  1QMU A;  1WII A;  4OIW A;  3FQQ A;  2J8R A;  3FED A;  5JM6 A;  3F3P C;  3NH4 A;  3FVL A;  2M48 A;  5FLX b;  1VQM Z;  5I0C A;  3H0G I;  3D6W A;  4BBH A;  3CPW Y;  3RBU A;  8CPA A;  2Q4Y A;  4AVC A;  2NMT A;  1S7L A;  1M4L A;  4NBA A;  2VQY A;  4HNY B;  1W2B Z;  5FVJ A;  4PV6 A;  4MCQ A;  1VLA A;  3MGD A;  1Q2Y A;  2OU2 A;  3G71 1;  3JAM f;  4BY7 I;  4E2Z A;  4PXC A;  3OW2 Y;  1ELL P;  3B3W A;  2PJ4 A;  4EFD A;  2QYV A;  3IFE A;  3D8P A;  5LRJ A;  3WR7 A;  1ZO0 A;  2E9H A;  5HVF A;  2FCK A;  3B8G A;  1K4J A;  3H8F A;  3IIB A;  1S72 Z;  4NXY A;  2Q7S A;  3FBU A;  2R1I A;  2ZW5 A;  1VQ4 Z;  2Q43 A;  1S7F A;  1VQ7 Z;  4NBB A;  1VQO Z;  3GTK I;  2REF A;  5FLX f;  2RB7 A;  1IOF A;  4NSQ A;  4UCP A;  4ZY2 A;  4OAE A;  2YU9 I;  3FEE A;  4BY1 I;  2BO9 A;  4BXX I;  1I21 A;  1U6M A;  2ZEH A;  2PR8 A;  4GXH A;  2QA4 1;  4RV9 A;  1KQS Z;  2GRE A;  4M6H A;  2BSW A;  2H85 A;  2OTL 1;  2B4D A;  1PYT B;  2C6C A;  1NSA A;  2JIM A;  5D29 A;  3K2K A;  4IHM A;  3NA6 A;  3D3S A;  1F2P A;  1IGB A;  5C4X I;  2IV2 X;  4NOZ A;  1R9T I;  3DGV A;  2OZG A;  4KSA A;  1TIQ A;  1LAP A;  4UFV A;  5THW A;  5T64 A;  2QVP A;  4UIA A;  4MBU A;  2R92 I;  1PFT A;  3GTP I;  1TF8 A;  2FXF A;  2FSR A;  4AG9 A;  4KSI A;  4JYW A;  4MHY A;  4KOX A;  2V45 A;  2OZU A;  4W9Y A;  3HOY I;  4A3C I;  3IWE A;  3SI1 A;  1YI2 Z;  1YJW Z;  2IZ4 A;  7CPA A;  2ZXV A;  4E2A A;  2V8H A;  4JLY A;  3I9S A;  1Y1W I;  1Y9W A;  5A27 A;  3FIX A;  1VQM 1;  1XJO A;  4BIN A;  3QB8 A;  1KC8 2;  4YFJ A;  2ODF A;  4UCM A;  4Z65 A;  3FYN A;  1KC8 1;  3K9U A;  1TWA I;  4JXQ A;  4B5P A;  4KLW A;  3HLP A;  3CQZ I;  1KRL A;  3GKR A;  3CCS 1;  1Z8X A;  5CPA A;  3J80 b;  2OOY B;  2Q51 A;  1Q2D A;  1TKH A; 
#chains in the Genus database with same CATH homology
 5CBM A;  1LOK A;  4TNU A;  3I4N I;  2HB6 A;  4MON A;  1Y1V I;  1K8A 2;  2IMO A;  2W03 A;  1CG2 A;  1VQ9 Z;  3KGQ A;  4O23 A;  2B63 I;  1RTQ A;  4EWC A;  2R7Z I;  4P6Y A;  3SJX A;  1NJI 2;  2PVW A;  3CC4 1;  4NGT A;  3I1U A;  2JBK A;  1S72 1;  5D1O A;  1ML8 A;  3KIF A;  4ONW A;  3M3Y I;  3KHX A;  3VTN A;  2V8J A;  2NYQ A;  1K8A 1;  4E32 A;  2R93 I;  2M6N A;  4A3I I;  2C6P A;  2PJ9 A;  1SFO I;  1VQ7 1;  1YUA A;  2XEF A;  4UEZ A;  1VHE A;  2V8I A;  2E2I I;  1ZB8 A;  2I3C A;  1Z8L A;  1JWH C;  3MN8 A;  4TWE A;  1NJI 1;  1VQO 1;  1XFO A;  3BI1 A;  3MRU A;  5K8N A;  3I4M I;  3Q87 A;  2BJO A;  4NGP A;  3CME 1;  4OC3 A;  3PO2 I;  4BD9 A;  4HGY A;  3CCJ 1;  3CCR 1;  3I55 Z;  3G4S Z;  4A3L I;  1TWG I;  2OTL Z;  4NJR A;  2KI7 B;  1QVF Z;  3RAM A;  3HOU I;  2QRC B;  4DJL A;  5J1Q A;  3SJG A;  4DK1 A;  2JNY A;  1VQ8 1;  5LYF A;  2EGT A;  2V8D A;  3RZA A;  3MZL B;  3NDI A;  4A3M I;  1H8L A;  4E2X A;  4MCP A;  2HU9 A;  4QTU A;  2DE5 A;  2G2K A;  5D1P A;  1USP B;  4E30 A;  1N2F A;  3GB0 A;  4OC2 A;  2J9A A;  3KI9 A;  2RT9 A;  4NGN A;  1R3N A;  2PCU A;  4UIB A;  5IB9 A;  5D8N A;  3D9X A;  2NVT I;  2JUB A;  4AXV A;  3J80 f;  4RVG A;  1YLO A;  3IWW A;  3KQX A;  2JEW A;  3FF3 A;  3P5J B;  3RZD I;  5F09 A;  4PPZ A;  3TDH B;  1VQK Z;  3L2N A;  1Z5R A;  1S7M A;  1PCA A;  2G9D A;  2PMZ A;  2OOX B;  2OZK A;  4NBC A;  4CL1 A;  5A2Q b;  2ZED A;  4P44 A;  4ZX9 A;  3S9M A;  4EME A;  3B3T A;  3CC7 Z;  3CPA A;  1YJ9 1;  4B6Z A;  2JA5 I;  3GTJ I;  3S1M I;  2PRQ A;  4UEF A;  2AFM A;  3JRU A;  3CC2 Z;  1RO2 A;  2YAD A;  4R76 A;  4A3D I;  3LWU A;  2W04 A;  1Z01 A;  3LUS A;  3H3V J;  4NBF A;  3D7D A;  4YWY A;  4WJB A;  3G6E Z;  3VMG A;  2PE3 A;  4H2K A;  4F9V A;  5HVH A;  2Q4Z A;  2F4O A;  4S1T A;  3GLJ A;  2K3R A;  3IX0 A;  2DEA A;  1JJ2 Y;  3ESW A;  2IJZ A;  3FMC A;  4P4J A;  4NH1 C;  3TC8 A;  3G71 Z;  4ZY0 A;  4ZI6 A;  1Q7Y 2;  1YIT Z;  4NFR A;  1YJN Z;  3B3V A;  3GTM S;  1KQS Y;  4MRI A;  2AFU A;  1YI2 1;  3BXM A;  3FJU A;  3FEC A;  2VL1 A;  3PFE A;  2PVV A;  1YJW 1;  3HOW I;  3K9T A;  1QF8 A;  4A3E I;  1Y0R A;  3WC6 A;  5I4M A;  1BAV A;  4UF4 A;  4R7M A;  3GCF A;  3FX6 A;  1Q7Y 1;  3PB9 X;  4OME A;  4HH4 A;  3CD6 Z;  2JBJ A;  2CF4 A;  2DE6 A;  3N5F A;  1TXR A;  4OC0 A;  2PJB A;  3KL9 A;  4MHN A;  1I3Q I;  4P10 A;  2VUM I;  3QNV A;  3IF8 A;  4A93 I;  3CCQ 1;  3PBB A;  4ZY1 A;  1YIJ Z;  1ZLH A;  4PQA A;  2ZEF A;  3D7G A;  1TWF I;  3CCS Z;  2QLV B;  1UWY A;  3HUV A;  1KWM A;  1LCP A;  3CCM Z;  3D7H A;  2IZ3 A;  2R6M A;  1VHO A;  4MMO A;  4BBR I;  3CCL Z;  2E2H I;  3CCV Z;  2EK8 A;  5AN9 F;  1YW4 A;  2HF1 A;  2XEJ A;  3PB4 X;  3VH9 A;  4WWV A;  2HC9 A;  5DS0 A;  4OC1 A;  5CM2 M;  1VGY A;  3IFU A;  1BLL E;  3GKQ A;  1AYE A;  3VB9 A;  5A2Q f;  3PEI A;  4A94 A;  1CPS A;  1CBX A;  2POK A;  3VMH A;  1L1O C;  1F2O A;  1QQ9 A;  3S15 I;  2ZOF A;  1VQ4 1;  4NGR A;  4RUH A;  3TE5 B;  1RNI A;  4OC4 A;  4EWT A;  2OTJ 1;  3S9L A;  1JQG A;  2VF1 A;  2O4H A;  1VQN Z;  3T4N B;  1DL6 A;  2GTH A;  3CT9 A;  2RBL A;  4Y52 I;  4NGS A;  4MD9 A;  2NVY I;  1DTD A;  3S9N A;  2QA4 Z;  4MD7 A;  4UEE A;  1Q81 2;  1VQ9 1;  1FT7 A;  3GTM I;  1CP7 A;  1QVG Z;  1YW6 A;  2V8V A;  1USP A;  3VMI A;  3V38 A;  2V77 A;  3B3S A;  5JGF A;  4Y7N I;  2QRD B;  2ANP A;  3V7Z A;  3KZW A;  3KIH A;  1W2B Y;  1HDU A;  1EE3 P;  4YU9 A;  2PJ5 A;  2FVG A;  1Q81 1;  2CTC A;  2RFH A;  5T6B A;  1M90 2;  3S14 I;  3CMA Z;  2V8G A;  4DGL A;  2C6G A;  2CIJ A;  2NSM A;  4A3G I;  4RVF A;  4P4F A;  2ZEG A;  2K5R A;  1VQ5 1;  1ZG7 A;  1YUK A;  3B7I A;  4P45 A;  2ZEN A;  1FNO A;  2GLJ A;  3U50 C;  2CTB A;  3I55 1;  3G4S 1;  4DQY B;  1M1K 2;  3T8W A;  3NH8 A;  1M90 1;  4NB8 A;  2XEI A;  1YHQ Z;  1Q86 2;  2JA6 I;  3GTQ I;  4PXE A;  4AYB A;  3JAM b;  1R43 A;  2O53 A;  3WT4 A;  2PJ7 A;  1I6H I;  4IAV A;  2V8K A;  4E2Y A;  3I56 Z;  1VQP Z;  2XEG A;  1ARM A;  2ZEP A;  3WAB A;  4PXB A;  4Q7A A;  1M1K 1;  3PBE A;  1Q86 1;  2WYR A;  5LRK A;  2C1C A;  2GTI A;  2EK9 A;  4OKO A;  4A3F I;  3KQZ A;  3CDX A;  3BHX A;  3LMS A;  2GLF A;  5K8M A;  3D66 A;  2JA7 I;  2IQ6 A;  5LYL A;  1CP6 A;  2QKD A;  2QJ8 A;  4P4B A;  2PJ3 A;  4NGQ A;  4R8F A;  3KHZ A;  5HXD A;  2GU2 A;  1RO4 A;  3J7A 4;  4QTT A;  3D67 A;  3IC1 A;  4OID A;  1X3Z A;  3F3F C;  2WZN A;  1QMU A;  1WII A;  4OIW A;  3FQQ A;  3CCE 1;  1RQF A;  1LAN A;  3PRT A;  1VQK 1;  2WB1 A;  3FED A;  2JA8 I;  4A3K I;  2BOA A;  3SJF A;  3GTO I;  5ELY A;  5JM6 A;  3F3P C;  5C44 I;  3NH4 A;  4ZX8 A;  5JH9 A;  1ZG8 A;  3FVL A;  2M48 A;  5FLX b;  1VQM Z;  3H0G I;  1RO0 A;  4FBE A;  3D6W A;  3HOX I;  3CC7 1;  4FAI A;  1Y1V S;  3EED A;  1K73 1;  4DUK A;  3CPW Y;  3K7A I;  4LQG A;  3RBU A;  8CPA A;  4IK2 A;  3H8E A;  1M4L A;  3NH5 A;  3HOV I;  4NBA A;  1ZB9 A;  4MCR A;  4DYO A;  1I50 I;  1X3W A;  3HOZ I;  1VQL Z;  2QEX Z;  4NBG A;  2PIZ A;  1W2B Z;  2RIQ A;  4G1P A;  1VLA A;  2EWB A;  4MCQ A;  2PJ0 A;  3PFO A;  4X6A I;  3G71 1;  2RHB A;  4PXD A;  4MXU A;  1YIT 1;  3SI2 A;  1K83 I;  3JAM f;  4BY7 I;  3KR5 A;  4E2Z A;  1TF9 A;  4A38 A;  4PXC A;  2LIY A;  3OW2 Y;  3ISZ A;  1ELL P;  4GM5 A;  4MHP A;  2AFW A;  4CPA A;  3B3W A;  5K8O A;  3CCU Z;  2PIY A;  2PJ4 A;  3PO3 S;  3MZK B;  2AFS A;  2AFO A;  3M4O I;  1VQ6 1;  2AKL A;  3FKI I;  4EFD A;  2QYV A;  3IFE A;  3CD6 1;  5LRJ A;  2E9H A;  2E2J I;  1WCM I;  1ZLI A;  5HVF A;  4K3N A;  3D4U A;  3H8F A;  3IJ3 A;  3ISX A;  3IIB A;  1ZH1 A;  1XRY A;  5IT9 f;  1YIJ 1;  1AMP A;  3CC4 Z;  1K9M 2;  4FUU A;  4NBD A;  1HEE A;  1S72 Z;  3SI0 A;  1VQ4 Z;  2Q43 A;  4NBE A;  3PB7 X;  3EER A;  1Z03 A;  1VQ7 Z;  4NBB A;  3B2Y A;  2LFU A;  2JMO A;  1VQO Z;  2PM9 A;  1K9M 1;  3GTK I;  1TKJ A;  4NB9 A;  4ZYQ A;  5FLX f;  5LYD A;  3CME Z;  2RB7 A;  3WC7 A;  3S2H I;  3BG1 B;  3CCJ Z;  3MON A;  3CCR Z;  1OBR A;  4ZY2 A;  3WC5 A;  2YU9 I;  3IEH A;  3FEE A;  1TWH I;  4BY1 I;  4E2W A;  2BO9 A;  4BXX I;  1VQ8 Z;  2OR4 A;  4X2T A;  4MHZ A;  2ABZ A;  2ZOG A;  2F4M A;  1VQN 1;  2ZEE A;  2ZEH A;  1X0T A;  1JJ2 Z;  1Y0Y A;  4X3R A;  4NJQ A;  3TX8 A;  5IP9 I;  3S16 I;  1DE4 C;  5D1O B;  4RV9 A;  3CPW Z;  1NUI A;  4E33 A;  2QA4 1;  1KQS Z;  1VQ5 Z;  2GRE A;  2ZEM A;  1ARL A;  3J81 f;  2H85 A;  2OTL 1;  5K8P A;  4P4I A;  1PYT B;  1HDQ A;  2C6C A;  1NSA A;  4A37 A;  5D29 A;  3PO3 I;  3K2K A;  4IHM A;  1LFW A;  1IY7 A;  3FH4 A;  3NA6 A;  2WAQ A;  4RS4 A;  1F2P A;  1IGB A;  2P28 A;  2QRE B;  3CMA 1;  2F8H A;  1Q82 2;  2PJ1 A;  3BI0 A;  3IO1 A;  3PB6 X;  3B3C A;  5C4X I;  3QWU A;  2DE7 A;  4NOZ A;  3SJE A;  3CXC Y;  1R9T I;  3DGV A;  1BPM A;  4OC5 A;  4RVD A;  2ZEO A;  3S1Q I;  1LAP A;  3HKZ A;  3OW2 Z;  1Y7E A;  1QYP A;  5THW A;  5T64 A;  1Q82 1;  2QVP A;  1YHQ 1;  2Y0S A;  1KD1 2;  4HGZ A;  1CX8 A;  3GTL I;  3GTG I;  3RZO I;  1N8R 2;  1LQL A;  5IT9 b;  1YJ9 Z;  4UIA A;  1VQP 1;  4P4E A;  3I56 1;  2R92 I;  1PFT A;  4FWU A;  3GTP I;  1TF8 A;  2PJ2 A;  4RVH A;  2NVQ I;  3KR4 A;  5LYI A;  1KD1 1;  3CCE Z;  2JR6 A;  3S1R I;  1K73 2;  1N8R 1;  4KSI A;  4JYW A;  4MHY A;  5FLM I;  2JS4 A;  4OP4 A;  4F9U A;  4MD8 A;  4W9Y A;  4NGM A;  1XMB A;  4E31 A;  3HOY I;  1YME A;  3KAS A;  4A3C I;  2OOT A;  3SI1 A;  1CPX A;  1ELM P;  4P4D A;  1YI2 Z;  1BPN A;  1TWC I;  5C3E I;  2ZAE B;  3CC2 1;  1YJW Z;  1QVG Y;  1F57 A;  2IZ4 A;  2PJA A;  2ZEL A;  1QVF Y;  7CPA A;  4A3B I;  5IP7 I;  3NFZ A;  2V8H A;  3G6E 1;  3BG0 B;  5T67 A;  3S2D I;  1GYT A;  5LRG A;  1Y1W I;  1TKF A;  4JZ0 A;  1VQM 1;  1ZG9 A;  4BBS I;  1XJO A;  3J81 b;  3B35 A;  5LL6 f;  1RLY A;  2AFX A;  1YJN 1;  2PJ8 A;  3D68 A;  1KC8 2;  3CCQ Z;  2PK7 A;  4R6T A;  4MCS A;  3FQM A;  5HVG A;  4A3J I;  2RPR A;  3DLJ A;  4Z65 A;  3VAR A;  3S1N I;  1VIX A;  2QR1 B;  2KPI A;  3GUX A;  2P3Y A;  1Z2L A;  2F7V A;  2PJ6 A;  4F8Z A;  2NVX I;  3H8G A;  1KC8 1;  1P9N A;  2QEX 1;  1Z02 A;  1VQL 1;  1TWA I;  1VQ6 Z;  1Q7L A;  4MH4 A;  4X8I A;  1XBU A;  3NDJ A;  3S17 I;  2J6A A;  4A39 A;  1YSJ A;  1WW9 A;  4NBH A;  3CPX A;  3HLP A;  3CQZ I;  5C4J I;  1KRL A;  1TFI A;  6CPA A;  3I07 A;  3CXC Z;  3CCS 1;  5CPA A;  3D7F A;  1NP6 A;  3VAT A;  3CCU 1;  3J80 b;  3CCM 1;  2VUG A;  2OOY B;  4XX2 A;  2AFZ A;  2OTJ Z;  2BCO A;  2PJC A;  3CCL 1;  2Q51 A;  3CCV 1;  1LAM A;  1TKH A;  3PB8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...