2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspa protein
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
2O4HA 1TKHA 1F57A 2ZEOA 1R43A 4R8FA 3KHXA 2XEJA 4B6ZA 2AFUA 1KWMA 4OMEA 4Q7AA 2POKA 3FH4A 4NJRA 1YMEA 2I3CA 2PJ1A 1IGBA 4X2TA 3B35A 3MN8A 2EWBA 2PJCA 2FVGA 1XBUA 3B2YA 4F9UA 5F09A 5JM6A 2Q4ZA 1ZLHA 3PBEA 1TF9A 4DYOA 3B3VA 3WC7A 2PJ5A 2WZNA 1ELMP 3TC8A 4RUHA 3GUXA 3BI0A 4JZ0A 1Z8LA 2ZOGA 2BO9A 3CDXA 4NGQA 2QVPA 4PPZA 2CTCA 3PFOA 3VARA 2ZEMA 2PJ7A 3V7ZA 4P4JA 3BXMA 3IWWA 4OC4A 4EMEA 1LOKA 4P10A 1HDUA 3CPAA 4MCSA 1IY7A 4P6YA 3PB8X 2IQ6A 1VHEA 3KQXA 3WC5A 5DS0A 3MRUA 4NFRA 1CBXA 2JEWA 3PBBA 4Z65A 4P44A 3KR4A 1BPNA 3NA6A 3NH4A 3BHXA 4R76A 4MHNA 2ZENA 3KI9A 2AFWA 3FF3A 4OKOA 3IJ3A 4NGTA 3KZWA 3D7FA 4P4BA 4NJQA 1UWYA 5HVGA 2WYRA 3B3WA 8CPAA 1LCPA 4MHPA 2F7VA 2ZELA 4PXEA 3SI2A 3FVLA 4AXVA 2JBJA 3BI1A 3K9TA 2PJ9A 4OC5A 3D66A 2AFOA 1H8LA 5LYLA 4OP4A 1Y0YA 1ZG9A 1CP6A 4MXUA 3GB0A 2PJ6A 4K3NA 1LANA 5LYDA 1Z2LA 1DE4C 1XMBA 3FEEA 3WABA 1ZG8A 2AFMA 1GYTA 2G9DA 4DJLA 1YSJA 3I1UA 3TX8A 4FBEA 4PQAA 3HUVA 5LRGA 1RTQA 4EFDA 4OC3A 2PJ8A 1CPSA 1XRYA 1ARMA 1XFOA 2XEGA 2ANPA 2OR4A 1Q7LA 2DEAA 4W9YA 4JYWA 3PB7X 1YW4A 3DLJA 2RFHA 4A94A 2EK8A 2J9AA 1EE3P 1BAVA 1TXRA 4ZI6A 2CIJA 4IK2A 4CPAA 2BCOA 2GREA 3CPXA 2EK9A 1AYEA 5I4MA 5HVHA 1QQ9A 2PJ2A 5K8NA 5K8PA 1HEEA 4MCQA 1VHOA 4X8IA 3RAMA 3H8EA 1ZG7A 4UF4A 1LAMA 4ZY0A 3VATA 3QNVA 2IJZA 2ZEEA 3D7DA 1TF8A 2C6PA 4A37A 3B3SA 2QJ8A 3RBUA 2F8HA 1FT7A 2AFSA 3V38A 4UIBA 5K8OA 4G1PA 3WT4A 4F8ZA 2V8GA 3LWUA 4OC1A 3B3CA 3D4UA 4OIDA 3FEDA 3T8WA 4KSIA 4TNUA 1YLOA 2ZEFA 2PJBA 3NH8A 4P45A 5J1QA 2O53A 3NFZA 1CP7A 2V77A 4MRIA 2PJ4A 4FUUA 4UEZA 4A39A 5JGFA 2ZEPA 4R7MA 2Q51A 4P4DA 3FX6A 4FWUA 3SI0A 2VL1A 6CPAA 4F9VA 3HLPA 4OC2A 3ISXA 1PCAA 3B3TA 4NGPA 2GLJA 4NGSA 3SJEA 2ABZA 3GLJA 3KGQA 2JBKA 2ZEDA 2AFZA 4ZYQA 3S9LA 4WWVA 1CX8A 3ISZA 1OBRA 2AFXA 2Q43A 2PVVA 3KL9A 1FNOA 1TKJA 5HXDA 4NGMA 4IHMA 1LFWA 2RB7A 4ZX9A 1BLLE 3LMSA 2OOTA 3PB9X 5D29A 1R3NA 2ZEHA 3PRTA 4UIAA 2V8DA 4TWEA 1YW6A 3S9MA 5LRKA 1M4LA 1TKFA 3RZAA 1NSAA 2PIYA 3SI1A 2PJ3A 5IB9A 3CT9A 4YU9A 4UEFA 2PJAA 4MCRA 4OC0A 3KHZA 1F2OA 4A38A 4R6TA 2C6GA 5CBMA 3DGVA 3FJUA 2HC9A 3L2NA 3K2KA 5K8MA 1JQGA 1LAPA 2ZOFA 3FMCA 3PFEA 3WC6A 1HDQA 1Z5RA 3IFEA 5ELYA 2NYQA 3FECA 1VGYA 4H2KA 3B7IA 3SJXA 5CPAA 3KQZA 4YWYA 2CF4A 2PIZA 2C1CA 4EWTA 3NH5A 3H8FA 4MHYA 1QMUA 2XEFA 3D67A 7CPAA 3JRUA 5HVFA 4MHZA 5LYFA 1DTDA 2PVWA 2V8HA 2C6CA 1CPXA 5LYIA 2CTBA 2PRQA 2PCUA 3PB4X 1Y0RA 2XEIA 4OIWA 3IO1A 3N5FA 1F2PA 1Y7EA 2PE3A 1ZLIA 4O23A 1CG2A 4BD9A 4ONWA 4PXDA 3SJFA 4ZY1A 3KR5A 2NSMA 4PXBA 3VH9A 2V8VA 3D7HA 4MMOA 5LRJA 4X3RA 3S9NA 1BPMA 3PB6X 4P4IA 3H8GA 2GU2A 4IAVA 2PJ0A 2ZEGA 4P4FA 1ELLP 1AMPA 3SJGA 4MCPA 3D7GA 4GM5A 1VIXA 1PYTB 2BOAA 5THWA 4P4EA 1ARLA 4PXCA 3D68A 5D8NA 4ZY2A 1XJOA 4NGNA 4ZX8A 2GLFA 2QYVA 3PEIA 3IIBA 3KASA 4FAIA 4UEEA 4DUKA 3IC1A 4WJBA 3IEHA 2HB6A 4NGRA 4LQGA 2IMOA 5JH9A
chains in the Genus database with same CATH superfamily
5H86A 2ZEOA 2XEJA 5GCNA 4Q7AA 4MJ8A 3G6E1 1YMEA 3MZLB 3H4QA 4UWJA 4Y7NI 2FSRA 2PJCA 3B8GA 3UY5A 4PV6A 3R9GA 3BG1B 4Q38A 4C2YA 3RZDI 2FIWA 4KZTA 4UFVA 2WUUA 2WZNA 1TWFI 1Q811 4RUHA 2QIRA 2E2II 2Z0ZA 3G6EZ 4NGQA 4M85A 2QVPA 3CD6Z 2E7ZA 4QVTA 3V7ZA 4KOXA 2QECA 3PO2I 4P10A 5HMNA 3IX0A 2RIQA 4MCSA 3CXQA 1CJWA 2Q4VA 1N71A 2ZAEB 3MRUA 4NFRA 4P44A 1Q16A 1BPNA 3TE5B 1QVGY 2P0WA 3KI9A 2AFWA 3J81f 2R8VA 3VTNA 3CCVZ 1S7LA 4KOTA 4C7HA 1UWYA 3TCVA 2WYRA 3EO4A 1YHQ1 4AXVA 3K9TA 1Z03A 2AFOA 4UCMA 1ZG9A 1VQM1 2QEX1 3GB0A 5KTAA 4K3NA 1KD11 2JA5I 3NDJA 1XMBA 3FEEA 1YHQZ 1X12A 2G9DA 2YNCA 2R7HA 3TX8A 3KIFA 2WPXA 4QBJA 4NXYA 4RVHA 1Q862 1VQMZ 2PJ8A 4KOYA 2QEXZ 3CCL1 2P6FA 1S721 1M902 4M6GA 3G8WA 1Q7LA 4Y49B 3GTJI 2K5RA 4RS2A 4F0XA 2J8MA 2Z3PA 3CPWZ 4JYWA 1N8R1 2V8JA 3JAMf 1L1OC 1NJI1 4KS9A 2EK8A 3CCLZ 2J9AA 1S72Z 2CIJA 3CCQ1 4CPAA 3FKII 2BCOA 2G0BA 1QQ9A 2PJ2A 3RAMA 4FD6A 1ZG7A 1TWHI 4XPKA 4MFPA 3I9SA 2IJZA 3S14I 1NUIA 1TF8A 2Q04A 4C7IA 3RBUA 1XIXA 3CCQZ 3IWEA 3EY5A 1FT7A 3T9YA 4CYNA 2HU9A 5KTCA 3GTGI 3I4NI 3B3CA 5FLMI 4OIDA 3FEDA 3DDDA 1R9TI 1VQ71 4KLWA 5C4XI 2OTJ1 5C82A 1WJ2A 1Y7RA 1YUAA 3P2FA 2ZEPA 3JUWA 1BOBA 1RNIA 3J80b 3SI0A 1VQ7Z 3TFYA 2VL1A 3TE4A 3FIXA 4F9VA 1YLEA 3VWEA 3IF8A 3GLJA 3A9LA 4L8AA 2H85A 1XOVA 3K7AI 3S15I 4WWVA 4MFKA 1CX8A 3ISZA 2Q43A 3BLNA 3P5JB 1VQKZ 4ZX9A 2Q7SA 2JDDA 4CGLA 3CCM1 5F48A 1R3NA 2BJOA 1S3ZA 4AG7A 2VZYA 1YW6A 3S9MA 1TKFA 3RZAA 4OAEA 1IYKA 2PJ3A 3CZXA 4UEFA 5C3EI 2F4OA 1Z8TA 3DR8A 3GCFA 1F2OA 1Q2YA 3CCMZ 5CBMA 3N7ZA 4A3DI 2LFUA 2HC9A 1N2FA 4B10A 5K8MA 1JQGA 1M4IA 3FMCA 3HKZA 4UCPA 3R95A 1KUVA 5ELYA 4BINA 3FECA 1VQ61 4H2KA 3SJXA 3KQZA 2JLMA 4YWYA 2DPTA 2PIZA 5F46A 2QMLA 3SXNA 4C68A 2IV2X 3LUSA 2YGWA 7CPAA 1Y9KA 2J6AA 1DTDA 4A93I 2PVWA 5LYIA 2PRQA 3PB4X 1VQ6Z 3M4OI 3IO1A 5T6BA 3G4S1 1XF8A 1VQ51 2NSMA 2JR6A 1LRZA 3S1NI 3CME1 4MMOA 1PU9A 5I0CA 3I4MI 3S9NA 4DQYB 2B58A 3EC4A 4MFZA 2GU2A 3ESWA 1VQ5Z 2IZ4A 3F3PC 2VXKA 4CGOA 3I3GA 2VUGA 2B3UA 3U50C 1VIXA 2J8RA 2BOAA 1ARLA 4PXCA 3D68A 5D8NA 4NGNA 2NVTI 3DSBA 3PEIA 4AYBA 2B4DA 1FDIA 4FAIA 2KI7B 4ZGYB 3E0KA 4NJRA 2GTIA 4LQGA 2IMOA 2OB0A 5JH9A 2O4HA 2FS5A 3KHXA 2AFUA 4OMEA 4RVFA 3TDHB 2POKA 3FH4A 1WK4A 4B13A 3MN8A 2EWBA 3RNZA 4RV9A 1Z4RA 5JM6A 4B5OA 1B87A 4L89A 4DYOA 1Q812 2PJ5A 1ELMP 1RO2A 3BI0A 2R6MA 3RZOI 4RVDA 1PFTA 4JXQA 2RHBA 2B3VA 1Z01A 2ARHA 2Q0YA 1I12A 3I551 2AJ6A 3S6GA 4A32A 4P4JA 1SIWA 4OC4A 3T90A 4EMEA 1QXFA 3ZZIA 5BWAB 1HDUA 5D1OA 4I49A 1VHEA 3KQXA 3WC5A 3PBBA 4Z65A 4XPDB 1JJ2Y 3I55Z 3NA6A 3NH4A 4R76A 5A2Qf 4DGLA 1SQHA 3H5ZA 3D7FA 1R57A 5JPHA 2DE6A 1J4JA 3B3WA 4LQ6A 3GTKI 8CPAA 2F7VA 4PXEA 2X7BA 3I561 4S1TA 3FNCA 4E8OA 1IB1E 4NBHA 2JDCA 5LYLA 4OP4A 1Y0YA 1KD12 4H6ZA 3C26A 1VQO1 3OWCA 2WPWA 5LYDA 2RPRA 1DE4C 3R9FA 1TWCI 3CCJZ 1ZG8A 3I56Z 5IB0A 2AFMA 4DJLA 2NVQI 3D8PA 1XEBA 4FBEA 4R9MA 3CCUZ 2P28A 4OC3A 4AVBA 4U9YA 4XNHB 1VQOZ 4B12A 2OR4A 2NAPA 3HOWI 3CD61 2YNDA 1GHEA 1N8R2 4HKFA 1K9M1 1NJI2 1X0TA 4HH4A 1YW4A 3DLJA 2R7ZI 3KKWA 2OZKA 4B5PA 2AYDA 2F5IA 4IUSA 1BAVA 2VEZA 4CAXA 1TXRA 4ZI6A 4A3FI 2GREA 1IOIA 1AYEA 2EK9A 5CNPA 5HVHA 4EWCA 2ZW6A 1HEEA 4MCQA 4OADA 4E2ZA 3H8EA 4UF4A 1ML8A 1ZB8A 2FCKA 1ZB9A 3CCV1 2IL4A 4A3KI 2ZEEA 4CGPA 1YGHA 3B3SA 2F8HA 2AFSA 4LUAA 4UIBA 4F8ZA 5AG7A 1VQ41 2Z3MA 4CRZB 2KCWA 1I3QI 4NBFA 1NE9A 2K5TA 5FLXf 4R87A 2PJBA 3NH8A 4P45A 2O53A 4MY0A 4UFWA 1CP7A 3MONA 2QA41 1Y1WI 1W2BZ 1NMTA 2Z3KA 4BXXI 4C2XA 3HOZI 5JGFA 1VQ4Z 2OZGA 2JIRA 4NBEA 3S6FA 2GANA 4P4DA 4A31A 3IR7A 2OOXB 4E2XA 2P3YA 1IICA 1PCAA 4J3GA 4NGPA 2QA4Z 2CNMA 3S1MI 2PQ8A 4NBDA 2E2JI 4ZYQA 5IX3A 4MHDA 4KOUA 4HGZA 5J8CA 2AFXA 4QTTA 2PVVA 1FNOA 5HXDA 1FY7A 3H3VJ 5CM2M 2D4PA 3TTHA 3W6SA 2RB7A 2V45A 2VBQA 4MFJA 2Z3OA 2OOTA 1CM0A 4E0AA 4YFJA 4PK2A 2ZEHA 1WZNA 4RS4A 4UIAA 4KOWA 4E2WA 1YI21 4UA3A 4GXHA 3PGPA 3SI1A 5IV0A 4E31A 3EXNA 2PJAA 3HOYI 1MJ9A 3KHZA 4AVCA 4U9ZA 2C6GA 3JVNA 2PM9A 1K8A1 2BEIA 4NBCA 4LX9A 3G711 1YI2Z 1Q7Y1 1LAPA 4CL1A 4KVOE 3PFEA 1HDQA 1WWZA 1VGYA 1M4GA 2B5GB 3FBUA 4E2YA 1RQFA 2OTL1 1S7NA 1QMUA 3H0GI 2XEFA 3D67A 1YX0A 4HNYB 5G1ZA 2PMZA 4DK1A 3JRUA 3G71Z 4MHZA 5LYFA 3R1KA 2B4BA 2V8HA 1CPXA 2CTBA 3NE7A 2PCUA 2XEIA 4C2ZA 5IP9I 4NH1C 2PR8A 2OTLZ 1F2PA 1YR0A 3Q87A 4BD9A 2Z3LA 4ONWA 3TOBA 3SJFA 4ZY1A 4BY7I 3KR5A 2JS4A 2Q4YA 4PXBA 3VH9A 5D1OB 1I1DA 2R93I 3D7HA 3CXCY 1VQK1 4RI1A 2ATRA 5ISVA 1BPMA 3PB6X 3S6KA 4CAEA 4CGNA 3OW2Y 1KQSY 1QVGZ 4A3BI 5DWNA 1S60A 2BL1A 1QF8A 4E2AA 3CC71 4GM5A 4YGOA 2F4MA 3TT2A 3FYNA 3IFUA 2QREB 3KASA 3D2LA 4MFLA 4KVXA 2Z3NA 3IC1A 4WJBA 3IEHA 2Y0MA 1TWAI 2EO8A 4NGRA 1K731 1RTQA 1TKHA 1F57A 1R43A 4R8FA 3CC7Z 3D3SA 4B6ZA 4U5YA 3FRMA 1NSLA 5IT9b 3BG0B 1U6MA 2YNCC 3B2YA 4MONA 5F09A 1ZLHA 1YQEA 4KUAA 3B3VA 2EBJA 3WC7A 3GUXA 2OZHA 4MD9A 4F6AA 1Z8LA 5T64A 3FQQA 2LEXA 3CDXA 4K30A 4E32A 4PPZA 3PFOA 3VARA 3J80f 4GS4A 3R9EA 3BXMA 3IWWA 2JMOA 3KIHA 4H6UA 5A28A 1LOKA 2OOYB 1IY7A 2I00A 2IQ6A 3GTLI 5AG5A 2V8KA 4FD4A 4CYQA 4ORFA 5DS0A 1CBXA 3KR4A 4XPDC 4MHNA 2ZENA 4NB8A 3FF3A 1XMTA 2JIMA 4KOVA 3KZWA 1QVFY 4P4BA 3F8KA 4NJQA 3D2MA 3F3FC 1NP6A 1Q2CA 4X5KA 1LCPA 2ZELA 4A33A 2DXQA 2JIPA 3SI2A 2VI7A 2G3TA 3GIUA 3LD2A 1VHSA 3R96A 3CCS1 4OC5A 2VPZA 1RLYA 1H8LA 4AVAA 3S1QI 1CP6A 4MXUA 4PSWA 2PJ6A 1YITZ 1S5KA 1LANA 4IF5A 4A3LI 1Z2LA 4Y52I 3PO3I 2VPYA 2G2KA 2GE3A 4JWPA 4NF1A 5EBVA 2GIVA 1YJWZ 2RBLA 4PQAA 3CCSZ 3HUVA 5LRGA 3SXOA 4QTUA 1XRYA 2H5MA 1RO4A 1XFOA 4XNHC 2CNSA 1ZO0A 3P2HA 4CAFA 3MGDA 2VZZA 1K9M2 1AUGA 4W9YA 2V3VA 4A30A 3T4NB 1DL6A 2DF5A 4A94A 4UWIA 1YJN1 3GKRA 1Q821 4HGYA 1YJ91 5I4MA 1Q2DA 3SHPA 5H84A 5K8PA 3S16I 1VHOA 4X8IA 2C27A 4JD6A 1X10A 4ZY0A 4BBHA 4E33A 3VATA 1I6HI 3QNVA 1JWHC 3D7DA 1YJNZ 4B14A 5AG6A 1S7KA 2C6PA 2Q44A 2V8IA 1YJ9Z 1KC81 3V38A 5K8OA 1VQ81 2V8GA 3LWUA 4OC1A 1YVOA 2G3AA 3CXPA 3D4UA 3M3YI 1YIJ1 4M6IA 4AB7A 5F47A 4KLVA 4XPLA 2OZUA 5J1QA 2V77A 3CCJ1 5DWMA 1VQ8Z 4FUUA 3CQZI 5D1PA 4UEZA 4R7MA 2NMTA 3CCU1 2Q51A 3S2HI 3FX6A 4FWUA 1VKCA 1YIJZ 4A3GI 3RYOA 2A4NA 2WSAA 4OC2A 1WW9A 2CNTA 2DPSA 3CC21 2JUBA 2GLJA 4NGSA 5AG4A 2ABZA 2ZEDA 3QAHA 2AFZA 1IIDA 5EMIA 3CPWY 1KUYA 4MH4A 4II9A 1Z8WA 4NGMA 1RO0A 3J81b 2W03A 2W04A 1MJBA 1K83I 1BLLE 3LMSA 4BY1I 5G21A 4KVME 3CC2Z 3PB9X 5AN9F 3PRTA 4Y49C 2V8DA 5LRKA 5T67A 2EUIA 4A3CI 1UFHA 4BMHA 3RO0A 3ZJ0A 3MZKB 2EGTA 2RT9A 3CT9A 4YU9A 3PZJA 2BUEA 2QKDA 4OC0A 4MCRA 5AGEA 2Y0SA 1USPA 1K8A2 3J7A4 1KRLA 4A38A 4PSXA 1Q7Y2 4M6HA 3F0AA 3L2NA 2NVYI 1VLAA 1VQP1 4MI4A 4DNCA 5C44I 3WC6A 3IFEA 1FDOA 3IU1A 4MBUA 2C1CA 1M1DA 2P6EA 4MHYA 1M44A 2FIAA 3EFAA 3D2PA 5G20A 2AE6A 1VQPZ 3JAMb 1Y8CA 3GTMS 4OIWA 5JQ4A 4A3II 2FXFA 3GTMI 2M48A 3CCR1 1Y7EA 3GTQI 4PXDA 2JA6I 4UFXA 2WAQA 1TWGI 1YREA 3TO9A 1IU8A 3TOAA 4KUBA 1M1K1 1Y9WA 4KSFA 3S17I 4X3RA 3CCRZ 4P4IA 1JJ2Z 3FQMA 2JNYA 4HNWB 4XX2A 3H8GA 2Q7BA 4RN7A 2D4OA 4X6AI 2PJ0A 2ZEGA 1K4JA 1ELLP 1AMPA 4HNXB 3SJGA 4MCPA 4CAWA 2PK7A 4MD8A 2CXAA 1XJOA 4ZX8A 2WB1A 3W91A 1P0HA 4CYPA 4UEEA 4DUKA 1K732 2HB6A 2O28A 2ODFA 1QSTA 3VMHA 1KWMA 1OZPA 2VPWA 2I3CA 3D6WA 2FL4A 1IGBA 2PJ1A 3B35A 3PP9A 1RO5A 4JXRA 4X2TA 2B4DB 2PR1A 2FVGA 4A3MI 1XBUA 4F9UA 1IOFA 4JJXA 2Q4ZA 3PBEA 1TF9A 4E30A 3GTOI 2P6GA 2GTHA 3V8IA 3TC8A 1P9NA 4JZ0A 3DNSA 2ZOGA 2BO9A 2REEA 5F49A 5C88A 2CTCA 2REFA 2ZEMA 1L0CA 4YRHA 2PJ7A 1S7FA 1X3ZA 5KTDA 2ZW4A 5J8FA 3CPAA 4P6YA 3PB8X 2QRCB 5C4JI 2JEWA 1QSOA 1S7MA 4CAVA 3CC41 3BHXA 4QB9A 2ZXVA 4OKOA 1XE4A 3IJ3A 4NGTA 1Z4EA 2JIQA 3GTPI 2AKLA 5HVGA 2J8NA 4NOZA 1A2ZA 3BJ8A 4MHPA 2QRDB 3LODA 3FVLA 4OLLA 2JBJA 3BI1A 3CC4Z 2PJ9A 4UBRA 3D66A 3NDIA 3WR7A 2VQYA 3S2DI 3S1RI 1RXTA 1P4NA 2HF1A 2JA7I 2VPXA 4FD7A 2DE7A 1KUXA 1VQN1 2JA8I 2OTJZ 2FT0A 1Z9UA 3WABA 1Z8XA 2VF1A 2BSWA 1TIQA 1GYTA 1QSRA 2LIYA 1YSJA 1M4DA 4R57A 3I1UA 2IZ3A 2EVNA 3NE8A 4EFDA 2KPIA 4BBRI 1CPSA 3VMGA 1ARMA 1Q861 2XEGA 2ANPA 4QUSA 1VQNZ 2DEAA 4KSAA 3I07A 4ZBGA 2PDOA 1M901 2B63I 3CXSA 2PSWA 2ZW5A 3PB7X 4UCNA 4RVGA 2GFQA 2RFHA 1Q822 1VQ91 2M6NA 4R3LA 1EE3P 2ZW7A 2I79A 2QR1B 4IK2A 2E9HA 3CPXA 4A95A 4CGMA 1WCMI 2OH1A 5K8NA 2PC1A 3GY9A 1LAMA 3BJ7A 4B5PB 1MJAA 3CCE1 3TO7A 1VQ9Z 3GYAA 4F0YA 2R98A 1USPB 4NCZA 4A37A 1KC82 3EEDA 2QJ8A 5HH1A 3VB9A 4G1PA 3WT4A 3CMA1 3IU2A 1JWQA 4H89A 3T8WA 4KSIA 2RC4A 4CS0B 1Z02A 4TNUA 1YLOA 3CCEZ 3FXTA 1YIT1 2ZEFA 1KZFA 2QLVB 3W6XA 2ZPAA 3NFZA 4MRIA 4NB9A 4NEXA 1ZH1A 2PJ4A 4A39A 3CMAZ 4HPSA 3QWUA 1MK4A 1I21A 1YJW1 1YK3A 4NBGA 3S6HA 3DR6A 5EC4A 1I50I 3IGRA 1LQLA 4PK3A 6CPAA 5IT9f 3HLPA 4BBSI 3ISXA 3B3TA 3PO3S 3SJEA 3KGQA 2JBKA 1QSMA 4EVYA 1VQL1 3G4SZ 3HOVI 3S9LA 3TO6A 1OBRA 4M3SA 3KL9A 1TKJA 2HUZA 5A2Qb 3CMEZ 1BO4A 3CXCZ 4IHMA 2K3RA 1LFWA 1X3WA 5D29A 2JIOA 2PRBA 3OW2Z 1KQSZ 4CYOA 1VQLZ 4QC6A 4TWEA 1M4LA 4JLYA 1NSAA 2PIYA 4MY3A 5IB9A 2B5GA 2JEVA 4R3KA 4ONUA 1B6BA 4R6TA 3DGVA 3FJUA 2HV2A 1PUAA 4MD7A 3K2KA 2ZOFA 1Z5RA 1Y1VS 4A3JI 1YVKA 3G3SA 2NYQA 3IWGA 4A3EI 4FD5A 1Y1VI 3B7IA 5CPAA 2CF4A 2CY2A 4EWTA 3NH5A 3H8FA 1W2BY 5G22A 5A27A 1SFOI 5HVFA 4MFQA 1IYLA 2C6CA 2Z11A 2Z10A 4AG9A 2VUMI 2HQYA 4B11A 1Y0RA 4NBAA 3N5FA 3QB8A 5IP7I 2PE3A 2NVXI 1AA6A 1ZLIA 4O23A 1CG2A 4KORA 5FVJA 4NSQA 1V0CA 4KOSA 4CRYB 2OU2A 3D9XA 2V8VA 1M1K2 3GKQA 5LRJA 1TFIA 3VWDA 3EERA 2E2HI 2YU9I 2R92I 4A2ZA 3JTKA 3FB3A 3QAYA 3HOXI 4NBBA 4IAVA 4P4FA 5LL6f 5E96A 1QVFZ 3K9UA 3HOUI 1WIIA 2FE7A 3D7GA 1YUKA 1PYTB 5THWA 4P4EA 2R1IA 2YNEA 4ZY2A 5FLXb 3F5BA 2GLFA 3VMIA 2QYVA 3IIBA 1QYPA 1QSNA 1ON0A 2DE5A 3LACA 2YADA 4Q36A
chains in the Genus database with same CATH topology
2O4HA 1TKHA 1F57A 2ZEOA 1R43A 4R8FA 3CC7Z 3KHXA 2XEJA 4B6ZA 3VMHA 2AFUA 1KWMA 4OMEA 4RVFA 3TDHB 4Q7AA 2POKA 3FH4A 3G6E1 4NJRA 1YMEA 2I3CA 3MZLB 3D6WA 5IT9b 1IGBA 2PJ1A 3B35A 4X2TA 3MN8A 2EWBA 4Y7NI 3BG0B 2PJCA 2FVGA 4A3MI 1XBUA 3B2YA 4F9UA 4MONA 4RV9A 5F09A 5JM6A 3BG1B 2Q4ZA 1ZLHA 3PBEA 1TF9A 4DYOA 4E30A 1Q812 3GTOI 3RZDI 2GTHA 3B3VA 3WC7A 2PJ5A 2WZNA 1TWFI 1ELMP 1Q811 1RO2A 3TC8A 4RUHA 3GUXA 3BI0A 2R6MA 3RZOI 4MD9A 1P9NA 4RVDA 4JZ0A 1Z8LA 2E2II 5T64A 3FQQA 2BO9A 2ZOGA 1PFTA 3CDXA 3G6EZ 4NGQA 2QVPA 2RHBA 1Z01A 4E32A 3CD6Z 4PPZA 2CTCA 3PFOA 3I551 3VARA 2ZEMA 3J80f 2PJ7A 3V7ZA 4P4JA 1X3ZA 3BXMA 3IWWA 2JMOA 4OC4A 3KIHA 4EMEA 3PO2I 1LOKA 4P10A 3IX0A 2RIQA 2OOYB 5D1OA 1HDUA 3CPAA 4MCSA 1IY7A 4P6YA 3PB8X 2IQ6A 3GTLI 1VHEA 2V8KA 3KQXA 2ZAEB 3WC5A 5DS0A 3MRUA 4NFRA 1CBXA 2QRCB 5C4JI 2JEWA 3PBBA 4Z65A 4P44A 3KR4A 1S7MA 1JJ2Y 3I55Z 1BPNA 3TE5B 3CC41 3NA6A 3NH4A 3BHXA 4R76A 5A2Qf 4MHNA 2ZENA 1QVGY 3KI9A 4NB8A 2AFWA 3FF3A 4OKOA 3J81f 3IJ3A 4NGTA 3KZWA 3VTNA 4DGLA 1QVFY 3CCVZ 3D7FA 4P4BA 3GTPI 4NJQA 1UWYA 2AKLA 5HVGA 2WYRA 3F3FC 4NOZA 2DE6A 3B3WA 1NP6A 3GTKI 8CPAA 1LCPA 1YHQ1 4MHPA 2F7VA 2ZELA 4PXEA 3I561 2QRDB 3SI2A 4S1TA 3FVLA 4AXVA 2JBJA 3BI1A 3CC4Z 3K9TA 2PJ9A 3CCS1 4OC5A 3D66A 4NBHA 1RLYA 1Z03A 3NDIA 2AFOA 1H8LA 5LYLA 4OP4A 1Y0YA 3S1QI 1VQM1 1KD12 4MXUA 1CP6A 1ZG9A 2QEX1 3GB0A 3S2DI 3S1RI 2PJ6A 1YITZ 4K3NA 2HF1A 1KD11 1VQO1 2JA7I 2DE7A 1LANA 4A3LI 2JA5I 1VQN1 5LYDA 1Z2LA 2JA8I 2OTJZ 2RPRA 1DE4C 3NDJA 1XMBA 3FEEA 3WABA 1TWCI 3CCJZ 4Y52I 2VF1A 1YHQZ 1ZG8A 3I56Z 3PO3I 2AFMA 1GYTA 2G2KA 2LIYA 2G9DA 4DJLA 1YSJA 2NVQI 3I1UA 2IZ3A 3KIFA 3TX8A 4FBEA 4NGRA 1YJWZ 2RBLA 3CCUZ 4PQAA 3CCSZ 3HUVA 5LRGA 2P28A 4EFDA 2KPIA 4BBRI 4RVHA 1Q862 4OC3A 4QTUA 1VQMZ 2PJ8A 1CPSA 2QEXZ 1XRYA 3CCL1 3VMGA 1RO4A 1ARMA 1Q861 1XFOA 1VQOZ 2XEGA 2ANPA 2OR4A 1S721 1M902 1VQNZ 1Q7LA 3HOWI 2DEAA 3GTJI 3CD61 3I07A 2K5RA 1M901 1K9M2 4W9YA 2B63I 1N8R2 3T4NB 3CPWZ 1K9M1 3PB7X 4JYWA 1NJI2 1N8R1 1X0TA 2V8JA 4HH4A 1DL6A 4RVGA 1YW4A 3JAMf 3DLJA 2R7ZI 1L1OC 1NJI1 2OZKA 2RFHA 4A94A 1Q822 2EK8A 1VQ91 2M6NA 1YJN1 3CCLZ 2J9AA 1EE3P 1Q821 1BAVA 4HGYA 1TXRA 4ZI6A 1S72Z 2CIJA 2QR1B 4A3FI 3CCQ1 4IK2A 3FKII 4CPAA 2BCOA 2E9HA 1YJ91 2GREA 3CPXA 1WCMI 1AYEA 2EK9A 5I4MA 5HVHA 1QQ9A 2PJ2A 5K8NA 4EWCA 5K8PA 1HEEA 3S16I 4MCQA 1VHOA 4X8IA 4E2ZA 3RAMA 3H8EA 1ZG7A 4UF4A 1ML8A 1ZB8A 1TWHI 1LAMA 1ZB9A 4ZY0A 3CCE1 3CCV1 4E33A 3VATA 1I6HI 3QNVA 1JWHC 4A3KI 1VQ9Z 2IJZA 2ZEEA 3S14I 1YJNZ 3D7DA 1USPB 1NUIA 1TF8A 2C6PA 4A37A 3B3SA 1KC82 3EEDA 2QJ8A 3RBUA 2F8HA 3CCQZ 2V8IA 1YJ9Z 1KC81 1FT7A 2AFSA 3VB9A 4UIBA 3V38A 1VQ81 2HU9A 4G1PA 5K8OA 3WT4A 4F8ZA 3CMA1 2V8GA 1VQ41 3GTGI 3LWUA 4OC1A 3I4NI 3B3CA 5FLMI 3D4UA 3M3YI 4OIDA 3FEDA 3T8WA 4KSIA 1YIJ1 1R9TI 1I3QI 1VQ71 1Z02A 4TNUA 1YLOA 3CCEZ 1YIT1 4NBFA 2ZEFA 2QLVB 5FLXf 2PJBA 3NH8A 4P45A 5J1QA 2O53A 5C4XI 3NFZA 2OTJ1 1CP7A 3MONA 2QA41 2V77A 1Y1WI 1W2BZ 3CCJ1 4MRIA 4NB9A 1ZH1A 2PJ4A 4BXXI 1VQ8Z 4FUUA 3CQZI 5D1PA 4UEZA 4A39A 3CMAZ 3QWUA 3HOZI 5JGFA 1VQ4Z 1YUAA 2ZEPA 4NBEA 1YJW1 4R7MA 1RNIA 3CCU1 2Q51A 4NBGA 3S2HI 3FX6A 4FWUA 4P4DA 3J80b 1YIJZ 3SI0A 1I50I 1LQLA 1VQ7Z 4A3GI 4E2XA 2OOXB 2VL1A 6CPAA 2P3YA 4F9VA 5IT9f 3HLPA 4BBSI 4OC2A 3ISXA 1WW9A 1PCAA 3B3TA 4NGPA 3CC21 2JUBA 2GLJA 2QA4Z 3PO3S 4NGSA 3IF8A 3SJEA 2ABZA 3GLJA 3S1MI 2JBKA 2ZEDA 3KGQA 4NBDA 1VQL1 2H85A 3G4SZ 2AFZA 3HOVI 2E2JI 4ZYQA 3K7AI 3S9LA 3CPWY 4HGZA 3S15I 4WWVA 4MH4A 1CX8A 1OBRA 2AFXA 4QTTA 2Q43A 2PVVA 3ISZA 1FNOA 1TKJA 3KL9A 5HXDA 4NGMA 5A2Qb 3H3VJ 3CMEZ 1RO0A 5CM2M 3CXCZ 3J81b 4IHMA 3P5JB 1VQKZ 2W03A 2K3RA 1LFWA 2W04A 2RB7A 1K83I 4ZX9A 1BLLE 3LMSA 2OOTA 4BY1I 1X3WA 3CC2Z 3PB9X 5D29A 5AN9F 3CCM1 1R3NA 2BJOA 2ZEHA 3OW2Z 1KQSZ 3PRTA 4RS4A 1VQLZ 4UIAA 2V8DA 4TWEA 4E2WA 1YI21 1YW6A 3S9MA 5LRKA 5T67A 1M4LA 1TKFA 4A3CI 3RZAA 1NSAA 2PIYA 3MZKB 3SI1A 2EGTA 2PJ3A 2RT9A 4E31A 5IB9A 3CT9A 4YU9A 4UEFA 5C3EI 2PJAA 2F4OA 2QKDA 3HOYI 4MCRA 4OC0A 3KHZA 2Y0SA 3GCFA 1USPA 1F2OA 1K8A2 3J7A4 1KRLA 4A38A 4R6TA 3CCMZ 2C6GA 5CBMA 3DGVA 4A3DI 3FJUA 2LFUA 2PM9A 1Q7Y2 1K8A1 2HC9A 1N2FA 3L2NA 2NVYI 4NBCA 1VLAA 1VQP1 4MD7A 3K2KA 3G711 1YI2Z 1Q7Y1 1JQGA 1LAPA 5C44I 4CL1A 2ZOFA 3FMCA 5K8MA 3HKZA 3PFEA 3WC6A 1HDQA 1Z5RA 1Y1VS 4A3JI 3IFEA 5ELYA 2NYQA 4A3EI 3FECA 1VGYA 1VQ61 4H2KA 1Y1VI 3B7IA 3SJXA 5CPAA 3KQZA 4YWYA 4E2YA 1RQFA 2CF4A 2PIZA 2OTL1 2C1CA 4EWTA 2IMOA 3NH5A 3H8FA 4MHYA 1QMUA 1W2BY 3H0GI 2XEFA 3LUSA 3D67A 1SFOI 7CPAA 2PMZA 4DK1A 1VQPZ 2J6AA 3JRUA 5HVFA 3G71Z 4MHZA 5LYFA 1DTDA 4A93I 2PVWA 2V8HA 2C6CA 1CPXA 5LYIA 2CTBA 2PRQA 2PCUA 3JAMb 2VUMI 3PB4X 1VQ6Z 3GTMS 1Y0RA 3M4OI 2XEIA 4OIWA 4A3II 3IO1A 4NBAA 5IP9I 3N5FA 4NH1C 3GTMI 2OTLZ 2M48A 5IP7I 3CCR1 1F2PA 1Y7EA 2PE3A 2NVXI 1ZLIA 3Q87A 4O23A 1CG2A 4BD9A 5T6BA 4ONWA 3G4S1 3GTQI 4PXDA 3SJFA 1VQ51 4ZY1A 2JA6I 4BY7I 2JS4A 3D9XA 2NSMA 3KR5A 2JR6A 4PXBA 3VH9A 5D1OB 2WAQA 2V8VA 1M1K2 2R93I 3D7HA 1TWGI 3GKQA 3CME1 3S1NI 4MMOA 5LRJA 1TFIA 3CXCY 1M1K1 1VQK1 3I4MI 3S17I 4X3RA 3S9NA 3EERA 2E2HI 4DQYB 2YU9I 3CCRZ 2R92I 1BPMA 3PB6X 1JJ2Z 3FQMA 4P4IA 2JNYA 4XX2A 3H8GA 3HOXI 4X6AI 3OW2Y 1KQSY 2GU2A 1QVGZ 4NBBA 4A3BI 3ESWA 4IAVA 2PJ0A 2ZEGA 1VQ5Z 5LL6f 4P4FA 2IZ4A 3F3PC 1ELLP 1QVFZ 1QF8A 1AMPA 2VUGA 3HOUI 1WIIA 3CC71 3SJGA 4MCPA 3U50C 3D7GA 4GM5A 1VIXA 2F4MA 2PK7A 1YUKA 1PYTB 2BOAA 5THWA 4P4EA 1ARLA 4MD8A 4PXCA 3D68A 5D8NA 4ZY2A 5FLXb 1XJOA 4NGNA 2NVTI 4ZX8A 2GLFA 3VMIA 2QYVA 3PEIA 3IIBA 1QYPA 2WB1A 2QREB 3IFUA 3KASA 4AYBA 4FAIA 2KI7B 2DE5A 4UEEA 4DUKA 3IC1A 4WJBA 1K732 3IEHA 2HB6A 2YADA 1TWAI 2GTIA 4LQGA 1K731 1RTQA 5JH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4H A;  1TKH A;  1F57 A;  2ZEO A;  1R43 A;  4R8F A;  3KHX A;  2XEJ A;  4B6Z A;  2AFU A;  1KWM A;  4OME A;  4Q7A A;  2POK A;  3FH4 A;  4NJR A;  1YME A;  2I3C A;  2PJ1 A;  1IGB A;  4X2T A;  3B35 A;  3MN8 A;  2EWB A;  2PJC A;  2FVG A;  1XBU A;  3B2Y A;  4F9U A;  5F09 A;  5JM6 A;  2Q4Z A;  1ZLH A;  3PBE A;  1TF9 A;  4DYO A;  3B3V A;  3WC7 A;  2PJ5 A;  2WZN A;  1ELM P;  3TC8 A;  4RUH A;  3GUX A;  3BI0 A;  4JZ0 A;  1Z8L A;  2ZOG A;  2BO9 A;  3CDX A;  4NGQ A;  2QVP A;  4PPZ A;  2CTC A;  3PFO A;  3VAR A;  2ZEM A;  2PJ7 A;  3V7Z A;  4P4J A;  3BXM A;  3IWW A;  4OC4 A;  4EME A;  1LOK A;  4P10 A;  1HDU A;  3CPA A;  4MCS A;  1IY7 A;  4P6Y A;  3PB8 X;  2IQ6 A;  1VHE A;  3KQX A;  3WC5 A;  5DS0 A;  3MRU A;  4NFR A;  1CBX A;  2JEW A;  3PBB A;  4Z65 A;  4P44 A;  3KR4 A;  1BPN A;  3NA6 A;  3NH4 A;  3BHX A;  4R76 A;  4MHN A;  2ZEN A;  3KI9 A;  2AFW A;  3FF3 A;  4OKO A;  3IJ3 A;  4NGT A;  3KZW A;  3D7F A;  4P4B A;  4NJQ A;  1UWY A;  5HVG A;  2WYR A;  3B3W A;  8CPA A;  1LCP A;  4MHP A;  2F7V A;  2ZEL A;  4PXE A;  3SI2 A;  3FVL A;  4AXV A;  2JBJ A;  3BI1 A;  3K9T A;  2PJ9 A;  4OC5 A;  3D66 A;  2AFO A;  1H8L A;  5LYL A;  4OP4 A;  1Y0Y A;  1ZG9 A;  1CP6 A;  4MXU A;  3GB0 A;  2PJ6 A;  4K3N A;  1LAN A;  5LYD A;  1Z2L A;  1DE4 C;  1XMB A;  3FEE A;  3WAB A;  1ZG8 A;  2AFM A;  1GYT A;  2G9D A;  4DJL A;  1YSJ A;  3I1U A;  3TX8 A;  4FBE A;  4PQA A;  3HUV A;  5LRG A;  1RTQ A;  4EFD A;  4OC3 A;  2PJ8 A;  1CPS A;  1XRY A;  1ARM A;  1XFO A;  2XEG A;  2ANP A;  2OR4 A;  1Q7L A;  2DEA A;  4W9Y A;  4JYW A;  3PB7 X;  1YW4 A;  3DLJ A;  2RFH A;  4A94 A;  2EK8 A;  2J9A A;  1EE3 P;  1BAV A;  1TXR A;  4ZI6 A;  2CIJ A;  4IK2 A;  4CPA A;  2BCO A;  2GRE A;  3CPX A;  2EK9 A;  1AYE A;  5I4M A;  5HVH A;  1QQ9 A;  2PJ2 A;  5K8N A;  5K8P A;  1HEE A;  4MCQ A;  1VHO A;  4X8I A;  3RAM A;  3H8E A;  1ZG7 A;  4UF4 A;  1LAM A;  4ZY0 A;  3VAT A;  3QNV A;  2IJZ A;  2ZEE A;  3D7D A;  1TF8 A;  2C6P A;  4A37 A;  3B3S A;  2QJ8 A;  3RBU A;  2F8H A;  1FT7 A;  2AFS A;  3V38 A;  4UIB A;  5K8O A;  4G1P A;  3WT4 A;  4F8Z A;  2V8G A;  3LWU A;  4OC1 A;  3B3C A;  3D4U A;  4OID A;  3FED A;  3T8W A;  4KSI A;  4TNU A;  1YLO A;  2ZEF A;  2PJB A;  3NH8 A;  4P45 A;  5J1Q A;  2O53 A;  3NFZ A;  1CP7 A;  2V77 A;  4MRI A;  2PJ4 A;  4FUU A;  4UEZ A;  4A39 A;  5JGF A;  2ZEP A;  4R7M A;  2Q51 A;  4P4D A;  3FX6 A;  4FWU A;  3SI0 A;  2VL1 A;  6CPA A;  4F9V A;  3HLP A;  4OC2 A;  3ISX A;  1PCA A;  3B3T A;  4NGP A;  2GLJ A;  4NGS A;  3SJE A;  2ABZ A;  3GLJ A;  3KGQ A;  2JBK A;  2ZED A;  2AFZ A;  4ZYQ A;  3S9L A;  4WWV A;  1CX8 A;  3ISZ A;  1OBR A;  2AFX A;  2Q43 A;  2PVV A;  3KL9 A;  1FNO A;  1TKJ A;  5HXD A;  4NGM A;  4IHM A;  1LFW A;  2RB7 A;  4ZX9 A;  1BLL E;  3LMS A;  2OOT A;  3PB9 X;  5D29 A;  1R3N A;  2ZEH A;  3PRT A;  4UIA A;  2V8D A;  4TWE A;  1YW6 A;  3S9M A;  5LRK A;  1M4L A;  1TKF A;  3RZA A;  1NSA A;  2PIY A;  3SI1 A;  2PJ3 A;  5IB9 A;  3CT9 A;  4YU9 A;  4UEF A;  2PJA A;  4MCR A;  4OC0 A;  3KHZ A;  1F2O A;  4A38 A;  4R6T A;  2C6G A;  5CBM A;  3DGV A;  3FJU A;  2HC9 A;  3L2N A;  3K2K A;  5K8M A;  1JQG A;  1LAP A;  2ZOF A;  3FMC A;  3PFE A;  3WC6 A;  1HDQ A;  1Z5R A;  3IFE A;  5ELY A;  2NYQ A;  3FEC A;  1VGY A;  4H2K A;  3B7I A;  3SJX A;  5CPA A;  3KQZ A;  4YWY A;  2CF4 A;  2PIZ A;  2C1C A;  4EWT A;  3NH5 A;  3H8F A;  4MHY A;  1QMU A;  2XEF A;  3D67 A;  7CPA A;  3JRU A;  5HVF A;  4MHZ A;  5LYF A;  1DTD A;  2PVW A;  2V8H A;  2C6C A;  1CPX A;  5LYI A;  2CTB A;  2PRQ A;  2PCU A;  3PB4 X;  1Y0R A;  2XEI A;  4OIW A;  3IO1 A;  3N5F A;  1F2P A;  1Y7E A;  2PE3 A;  1ZLI A;  4O23 A;  1CG2 A;  4BD9 A;  4ONW A;  4PXD A;  3SJF A;  4ZY1 A;  3KR5 A;  2NSM A;  4PXB A;  3VH9 A;  2V8V A;  3D7H A;  4MMO A;  5LRJ A;  4X3R A;  3S9N A;  1BPM A;  3PB6 X;  4P4I A;  3H8G A;  2GU2 A;  4IAV A;  2PJ0 A;  2ZEG A;  4P4F A;  1ELL P;  1AMP A;  3SJG A;  4MCP A;  3D7G A;  4GM5 A;  1VIX A;  1PYT B;  2BOA A;  5THW A;  4P4E A;  1ARL A;  4PXC A;  3D68 A;  5D8N A;  4ZY2 A;  1XJO A;  4NGN A;  4ZX8 A;  2GLF A;  2QYV A;  3PEI A;  3IIB A;  3KAS A;  4FAI A;  4UEE A;  4DUK A;  3IC1 A;  4WJB A;  3IEH A;  2HB6 A;  4NGR A;  4LQG A;  2IMO A;  5JH9 A; 
#chains in the Genus database with same CATH topology
 5H86 A;  2ZEO A;  2XEJ A;  5GCN A;  4Q7A A;  4MJ8 A;  3G6E 1;  1YME A;  3MZL B;  3H4Q A;  4UWJ A;  4Y7N I;  2FSR A;  2PJC A;  3B8G A;  3UY5 A;  4PV6 A;  3R9G A;  3BG1 B;  4Q38 A;  4C2Y A;  3RZD I;  2FIW A;  4KZT A;  4UFV A;  2WUU A;  2WZN A;  1TWF I;  1Q81 1;  4RUH A;  2QIR A;  2E2I I;  2Z0Z A;  3G6E Z;  4NGQ A;  4M85 A;  2QVP A;  3CD6 Z;  2E7Z A;  4QVT A;  3V7Z A;  4KOX A;  2QEC A;  3PO2 I;  4P10 A;  5HMN A;  3IX0 A;  2RIQ A;  4MCS A;  3CXQ A;  1CJW A;  2Q4V A;  1N71 A;  2ZAE B;  3MRU A;  4NFR A;  4P44 A;  1Q16 A;  1BPN A;  3TE5 B;  1QVG Y;  2P0W A;  3KI9 A;  2AFW A;  3J81 f;  2R8V A;  3VTN A;  3CCV Z;  1S7L A;  4KOT A;  4C7H A;  1UWY A;  3TCV A;  2WYR A;  3EO4 A;  1YHQ 1;  4AXV A;  3K9T A;  1Z03 A;  2AFO A;  4UCM A;  1ZG9 A;  1VQM 1;  2QEX 1;  3GB0 A;  5KTA A;  4K3N A;  1KD1 1;  2JA5 I;  3NDJ A;  1XMB A;  3FEE A;  1YHQ Z;  1X12 A;  2G9D A;  2YNC A;  2R7H A;  3TX8 A;  3KIF A;  2WPX A;  4QBJ A;  4NXY A;  4RVH A;  1Q86 2;  1VQM Z;  2PJ8 A;  4KOY A;  2QEX Z;  3CCL 1;  2P6F A;  1S72 1;  1M90 2;  4M6G A;  3G8W A;  1Q7L A;  4Y49 B;  3GTJ I;  2K5R A;  4RS2 A;  4F0X A;  2J8M A;  2Z3P A;  3CPW Z;  4JYW A;  1N8R 1;  2V8J A;  3JAM f;  1L1O C;  1NJI 1;  4KS9 A;  2EK8 A;  3CCL Z;  2J9A A;  1S72 Z;  2CIJ A;  3CCQ 1;  4CPA A;  3FKI I;  2BCO A;  2G0B A;  1QQ9 A;  2PJ2 A;  3RAM A;  4FD6 A;  1ZG7 A;  1TWH I;  4XPK A;  4MFP A;  3I9S A;  2IJZ A;  3S14 I;  1NUI A;  1TF8 A;  2Q04 A;  4C7I A;  3RBU A;  1XIX A;  3CCQ Z;  3IWE A;  3EY5 A;  1FT7 A;  3T9Y A;  4CYN A;  2HU9 A;  5KTC A;  3GTG I;  3I4N I;  3B3C A;  5FLM I;  4OID A;  3FED A;  3DDD A;  1R9T I;  1VQ7 1;  4KLW A;  5C4X I;  2OTJ 1;  5C82 A;  1WJ2 A;  1Y7R A;  1YUA A;  3P2F A;  2ZEP A;  3JUW A;  1BOB A;  1RNI A;  3J80 b;  3SI0 A;  1VQ7 Z;  3TFY A;  2VL1 A;  3TE4 A;  3FIX A;  4F9V A;  1YLE A;  3VWE A;  3IF8 A;  3GLJ A;  3A9L A;  4L8A A;  2H85 A;  1XOV A;  3K7A I;  3S15 I;  4WWV A;  4MFK A;  1CX8 A;  3ISZ A;  2Q43 A;  3BLN A;  3P5J B;  1VQK Z;  4ZX9 A;  2Q7S A;  2JDD A;  4CGL A;  3CCM 1;  5F48 A;  1R3N A;  2BJO A;  1S3Z A;  4AG7 A;  2VZY A;  1YW6 A;  3S9M A;  1TKF A;  3RZA A;  4OAE A;  1IYK A;  2PJ3 A;  3CZX A;  4UEF A;  5C3E I;  2F4O A;  1Z8T A;  3DR8 A;  3GCF A;  1F2O A;  1Q2Y A;  3CCM Z;  5CBM A;  3N7Z A;  4A3D I;  2LFU A;  2HC9 A;  1N2F A;  4B10 A;  5K8M A;  1JQG A;  1M4I A;  3FMC A;  3HKZ A;  4UCP A;  3R95 A;  1KUV A;  5ELY A;  4BIN A;  3FEC A;  1VQ6 1;  4H2K A;  3SJX A;  3KQZ A;  2JLM A;  4YWY A;  2DPT A;  2PIZ A;  5F46 A;  2QML A;  3SXN A;  4C68 A;  2IV2 X;  3LUS A;  2YGW A;  7CPA A;  1Y9K A;  2J6A A;  1DTD A;  4A93 I;  2PVW A;  5LYI A;  2PRQ A;  3PB4 X;  1VQ6 Z;  3M4O I;  3IO1 A;  5T6B A;  3G4S 1;  1XF8 A;  1VQ5 1;  2NSM A;  2JR6 A;  1LRZ A;  3S1N I;  3CME 1;  4MMO A;  1PU9 A;  5I0C A;  3I4M I;  3S9N A;  4DQY B;  2B58 A;  3EC4 A;  4MFZ A;  2GU2 A;  3ESW A;  1VQ5 Z;  2IZ4 A;  3F3P C;  2VXK A;  4CGO A;  3I3G A;  2VUG A;  2B3U A;  3U50 C;  1VIX A;  2J8R A;  2BOA A;  1ARL A;  4PXC A;  3D68 A;  5D8N A;  4NGN A;  2NVT I;  3DSB A;  3PEI A;  4AYB A;  2B4D A;  1FDI A;  4FAI A;  2KI7 B;  4ZGY B;  3E0K A;  4NJR A;  2GTI A;  4LQG A;  2IMO A;  2OB0 A;  5JH9 A;  2O4H A;  2FS5 A;  3KHX A;  2AFU A;  4OME A;  4RVF A;  3TDH B;  2POK A;  3FH4 A;  1WK4 A;  4B13 A;  3MN8 A;  2EWB A;  3RNZ A;  4RV9 A;  1Z4R A;  5JM6 A;  4B5O A;  1B87 A;  4L89 A;  4DYO A;  1Q81 2;  2PJ5 A;  1ELM P;  1RO2 A;  3BI0 A;  2R6M A;  3RZO I;  4RVD A;  1PFT A;  4JXQ A;  2RHB A;  2B3V A;  1Z01 A;  2ARH A;  2Q0Y A;  1I12 A;  3I55 1;  2AJ6 A;  3S6G A;  4A32 A;  4P4J A;  1SIW A;  4OC4 A;  3T90 A;  4EME A;  1QXF A;  3ZZI A;  5BWA B;  1HDU A;  5D1O A;  4I49 A;  1VHE A;  3KQX A;  3WC5 A;  3PBB A;  4Z65 A;  4XPD B;  1JJ2 Y;  3I55 Z;  3NA6 A;  3NH4 A;  4R76 A;  5A2Q f;  4DGL A;  1SQH A;  3H5Z A;  3D7F A;  1R57 A;  5JPH A;  2DE6 A;  1J4J A;  3B3W A;  4LQ6 A;  3GTK I;  8CPA A;  2F7V A;  4PXE A;  2X7B A;  3I56 1;  4S1T A;  3FNC A;  4E8O A;  1IB1 E;  4NBH A;  2JDC A;  5LYL A;  4OP4 A;  1Y0Y A;  1KD1 2;  4H6Z A;  3C26 A;  1VQO 1;  3OWC A;  2WPW A;  5LYD A;  2RPR A;  1DE4 C;  3R9F A;  1TWC I;  3CCJ Z;  1ZG8 A;  3I56 Z;  5IB0 A;  2AFM A;  4DJL A;  2NVQ I;  3D8P A;  1XEB A;  4FBE A;  4R9M A;  3CCU Z;  2P28 A;  4OC3 A;  4AVB A;  4U9Y A;  4XNH B;  1VQO Z;  4B12 A;  2OR4 A;  2NAP A;  3HOW I;  3CD6 1;  2YND A;  1GHE A;  1N8R 2;  4HKF A;  1K9M 1;  1NJI 2;  1X0T A;  4HH4 A;  1YW4 A;  3DLJ A;  2R7Z I;  3KKW A;  2OZK A;  4B5P A;  2AYD A;  2F5I A;  4IUS A;  1BAV A;  2VEZ A;  4CAX A;  1TXR A;  4ZI6 A;  4A3F I;  2GRE A;  1IOI A;  1AYE A;  2EK9 A;  5CNP A;  5HVH A;  4EWC A;  2ZW6 A;  1HEE A;  4MCQ A;  4OAD A;  4E2Z A;  3H8E A;  4UF4 A;  1ML8 A;  1ZB8 A;  2FCK A;  1ZB9 A;  3CCV 1;  2IL4 A;  4A3K I;  2ZEE A;  4CGP A;  1YGH A;  3B3S A;  2F8H A;  2AFS A;  4LUA A;  4UIB A;  4F8Z A;  5AG7 A;  1VQ4 1;  2Z3M A;  4CRZ B;  2KCW A;  1I3Q I;  4NBF A;  1NE9 A;  2K5T A;  5FLX f;  4R87 A;  2PJB A;  3NH8 A;  4P45 A;  2O53 A;  4MY0 A;  4UFW A;  1CP7 A;  3MON A;  2QA4 1;  1Y1W I;  1W2B Z;  1NMT A;  2Z3K A;  4BXX I;  4C2X A;  3HOZ I;  5JGF A;  1VQ4 Z;  2OZG A;  2JIR A;  4NBE A;  3S6F A;  2GAN A;  4P4D A;  4A31 A;  3IR7 A;  2OOX B;  4E2X A;  2P3Y A;  1IIC A;  1PCA A;  4J3G A;  4NGP A;  2QA4 Z;  2CNM A;  3S1M I;  2PQ8 A;  4NBD A;  2E2J I;  4ZYQ A;  5IX3 A;  4MHD A;  4KOU A;  4HGZ A;  5J8C A;  2AFX A;  4QTT A;  2PVV A;  1FNO A;  5HXD A;  1FY7 A;  3H3V J;  5CM2 M;  2D4P A;  3TTH A;  3W6S A;  2RB7 A;  2V45 A;  2VBQ A;  4MFJ A;  2Z3O A;  2OOT A;  1CM0 A;  4E0A A;  4YFJ A;  4PK2 A;  2ZEH A;  1WZN A;  4RS4 A;  4UIA A;  4KOW A;  4E2W A;  1YI2 1;  4UA3 A;  4GXH A;  3PGP A;  3SI1 A;  5IV0 A;  4E31 A;  3EXN A;  2PJA A;  3HOY I;  1MJ9 A;  3KHZ A;  4AVC A;  4U9Z A;  2C6G A;  3JVN A;  2PM9 A;  1K8A 1;  2BEI A;  4NBC A;  4LX9 A;  3G71 1;  1YI2 Z;  1Q7Y 1;  1LAP A;  4CL1 A;  4KVO E;  3PFE A;  1HDQ A;  1WWZ A;  1VGY A;  1M4G A;  2B5G B;  3FBU A;  4E2Y A;  1RQF A;  2OTL 1;  1S7N A;  1QMU A;  3H0G I;  2XEF A;  3D67 A;  1YX0 A;  4HNY B;  5G1Z A;  2PMZ A;  4DK1 A;  3JRU A;  3G71 Z;  4MHZ A;  5LYF A;  3R1K A;  2B4B A;  2V8H A;  1CPX A;  2CTB A;  3NE7 A;  2PCU A;  2XEI A;  4C2Z A;  5IP9 I;  4NH1 C;  2PR8 A;  2OTL Z;  1F2P A;  1YR0 A;  3Q87 A;  4BD9 A;  2Z3L A;  4ONW A;  3TOB A;  3SJF A;  4ZY1 A;  4BY7 I;  3KR5 A;  2JS4 A;  2Q4Y A;  4PXB A;  3VH9 A;  5D1O B;  1I1D A;  2R93 I;  3D7H A;  3CXC Y;  1VQK 1;  4RI1 A;  2ATR A;  5ISV A;  1BPM A;  3PB6 X;  3S6K A;  4CAE A;  4CGN A;  3OW2 Y;  1KQS Y;  1QVG Z;  4A3B I;  5DWN A;  1S60 A;  2BL1 A;  1QF8 A;  4E2A A;  3CC7 1;  4GM5 A;  4YGO A;  2F4M A;  3TT2 A;  3FYN A;  3IFU A;  2QRE B;  3KAS A;  3D2L A;  4MFL A;  4KVX A;  2Z3N A;  3IC1 A;  4WJB A;  3IEH A;  2Y0M A;  1TWA I;  2EO8 A;  4NGR A;  1K73 1;  1RTQ A;  1TKH A;  1F57 A;  1R43 A;  4R8F A;  3CC7 Z;  3D3S A;  4B6Z A;  4U5Y A;  3FRM A;  1NSL A;  5IT9 b;  3BG0 B;  1U6M A;  2YNC C;  3B2Y A;  4MON A;  5F09 A;  1ZLH A;  1YQE A;  4KUA A;  3B3V A;  2EBJ A;  3WC7 A;  3GUX A;  2OZH A;  4MD9 A;  4F6A A;  1Z8L A;  5T64 A;  3FQQ A;  2LEX A;  3CDX A;  4K30 A;  4E32 A;  4PPZ A;  3PFO A;  3VAR A;  3J80 f;  4GS4 A;  3R9E A;  3BXM A;  3IWW A;  2JMO A;  3KIH A;  4H6U A;  5A28 A;  1LOK A;  2OOY B;  1IY7 A;  2I00 A;  2IQ6 A;  3GTL I;  5AG5 A;  2V8K A;  4FD4 A;  4CYQ A;  4ORF A;  5DS0 A;  1CBX A;  3KR4 A;  4XPD C;  4MHN A;  2ZEN A;  4NB8 A;  3FF3 A;  1XMT A;  2JIM A;  4KOV A;  3KZW A;  1QVF Y;  4P4B A;  3F8K A;  4NJQ A;  3D2M A;  3F3F C;  1NP6 A;  1Q2C A;  4X5K A;  1LCP A;  2ZEL A;  4A33 A;  2DXQ A;  2JIP A;  3SI2 A;  2VI7 A;  2G3T A;  3GIU A;  3LD2 A;  1VHS A;  3R96 A;  3CCS 1;  4OC5 A;  2VPZ A;  1RLY A;  1H8L A;  4AVA A;  3S1Q I;  1CP6 A;  4MXU A;  4PSW A;  2PJ6 A;  1YIT Z;  1S5K A;  1LAN A;  4IF5 A;  4A3L I;  1Z2L A;  4Y52 I;  3PO3 I;  2VPY A;  2G2K A;  2GE3 A;  4JWP A;  4NF1 A;  5EBV A;  2GIV A;  1YJW Z;  2RBL A;  4PQA A;  3CCS Z;  3HUV A;  5LRG A;  3SXO A;  4QTU A;  1XRY A;  2H5M A;  1RO4 A;  1XFO A;  4XNH C;  2CNS A;  1ZO0 A;  3P2H A;  4CAF A;  3MGD A;  2VZZ A;  1K9M 2;  1AUG A;  4W9Y A;  2V3V A;  4A30 A;  3T4N B;  1DL6 A;  2DF5 A;  4A94 A;  4UWI A;  1YJN 1;  3GKR A;  1Q82 1;  4HGY A;  1YJ9 1;  5I4M A;  1Q2D A;  3SHP A;  5H84 A;  5K8P A;  3S16 I;  1VHO A;  4X8I A;  2C27 A;  4JD6 A;  1X10 A;  4ZY0 A;  4BBH A;  4E33 A;  3VAT A;  1I6H I;  3QNV A;  1JWH C;  3D7D A;  1YJN Z;  4B14 A;  5AG6 A;  1S7K A;  2C6P A;  2Q44 A;  2V8I A;  1YJ9 Z;  1KC8 1;  3V38 A;  5K8O A;  1VQ8 1;  2V8G A;  3LWU A;  4OC1 A;  1YVO A;  2G3A A;  3CXP A;  3D4U A;  3M3Y I;  1YIJ 1;  4M6I A;  4AB7 A;  5F47 A;  4KLV A;  4XPL A;  2OZU A;  5J1Q A;  2V77 A;  3CCJ 1;  5DWM A;  1VQ8 Z;  4FUU A;  3CQZ I;  5D1P A;  4UEZ A;  4R7M A;  2NMT A;  3CCU 1;  2Q51 A;  3S2H I;  3FX6 A;  4FWU A;  1VKC A;  1YIJ Z;  4A3G I;  3RYO A;  2A4N A;  2WSA A;  4OC2 A;  1WW9 A;  2CNT A;  2DPS A;  3CC2 1;  2JUB A;  2GLJ A;  4NGS A;  5AG4 A;  2ABZ A;  2ZED A;  3QAH A;  2AFZ A;  1IID A;  5EMI A;  3CPW Y;  1KUY A;  4MH4 A;  4II9 A;  1Z8W A;  4NGM A;  1RO0 A;  3J81 b;  2W03 A;  2W04 A;  1MJB A;  1K83 I;  1BLL E;  3LMS A;  4BY1 I;  5G21 A;  4KVM E;  3CC2 Z;  3PB9 X;  5AN9 F;  3PRT A;  4Y49 C;  2V8D A;  5LRK A;  5T67 A;  2EUI A;  4A3C I;  1UFH A;  4BMH A;  3RO0 A;  3ZJ0 A;  3MZK B;  2EGT A;  2RT9 A;  3CT9 A;  4YU9 A;  3PZJ A;  2BUE A;  2QKD A;  4OC0 A;  4MCR A;  5AGE A;  2Y0S A;  1USP A;  1K8A 2;  3J7A 4;  1KRL A;  4A38 A;  4PSX A;  1Q7Y 2;  4M6H A;  3F0A A;  3L2N A;  2NVY I;  1VLA A;  1VQP 1;  4MI4 A;  4DNC A;  5C44 I;  3WC6 A;  3IFE A;  1FDO A;  3IU1 A;  4MBU A;  2C1C A;  1M1D A;  2P6E A;  4MHY A;  1M44 A;  2FIA A;  3EFA A;  3D2P A;  5G20 A;  2AE6 A;  1VQP Z;  3JAM b;  1Y8C A;  3GTM S;  4OIW A;  5JQ4 A;  4A3I I;  2FXF A;  3GTM I;  2M48 A;  3CCR 1;  1Y7E A;  3GTQ I;  4PXD A;  2JA6 I;  4UFX A;  2WAQ A;  1TWG I;  1YRE A;  3TO9 A;  1IU8 A;  3TOA A;  4KUB A;  1M1K 1;  1Y9W A;  4KSF A;  3S17 I;  4X3R A;  3CCR Z;  4P4I A;  1JJ2 Z;  3FQM A;  2JNY A;  4HNW B;  4XX2 A;  3H8G A;  2Q7B A;  4RN7 A;  2D4O A;  4X6A I;  2PJ0 A;  2ZEG A;  1K4J A;  1ELL P;  1AMP A;  4HNX B;  3SJG A;  4MCP A;  4CAW A;  2PK7 A;  4MD8 A;  2CXA A;  1XJO A;  4ZX8 A;  2WB1 A;  3W91 A;  1P0H A;  4CYP A;  4UEE A;  4DUK A;  1K73 2;  2HB6 A;  2O28 A;  2ODF A;  1QST A;  3VMH A;  1KWM A;  1OZP A;  2VPW A;  2I3C A;  3D6W A;  2FL4 A;  1IGB A;  2PJ1 A;  3B35 A;  3PP9 A;  1RO5 A;  4JXR A;  4X2T A;  2B4D B;  2PR1 A;  2FVG A;  4A3M I;  1XBU A;  4F9U A;  1IOF A;  4JJX A;  2Q4Z A;  3PBE A;  1TF9 A;  4E30 A;  3GTO I;  2P6G A;  2GTH A;  3V8I A;  3TC8 A;  1P9N A;  4JZ0 A;  3DNS A;  2ZOG A;  2BO9 A;  2REE A;  5F49 A;  5C88 A;  2CTC A;  2REF A;  2ZEM A;  1L0C A;  4YRH A;  2PJ7 A;  1S7F A;  1X3Z A;  5KTD A;  2ZW4 A;  5J8F A;  3CPA A;  4P6Y A;  3PB8 X;  2QRC B;  5C4J I;  2JEW A;  1QSO A;  1S7M A;  4CAV A;  3CC4 1;  3BHX A;  4QB9 A;  2ZXV A;  4OKO A;  1XE4 A;  3IJ3 A;  4NGT A;  1Z4E A;  2JIQ A;  3GTP I;  2AKL A;  5HVG A;  2J8N A;  4NOZ A;  1A2Z A;  3BJ8 A;  4MHP A;  2QRD B;  3LOD A;  3FVL A;  4OLL A;  2JBJ A;  3BI1 A;  3CC4 Z;  2PJ9 A;  4UBR A;  3D66 A;  3NDI A;  3WR7 A;  2VQY A;  3S2D I;  3S1R I;  1RXT A;  1P4N A;  2HF1 A;  2JA7 I;  2VPX A;  4FD7 A;  2DE7 A;  1KUX A;  1VQN 1;  2JA8 I;  2OTJ Z;  2FT0 A;  1Z9U A;  3WAB A;  1Z8X A;  2VF1 A;  2BSW A;  1TIQ A;  1GYT A;  1QSR A;  2LIY A;  1YSJ A;  1M4D A;  4R57 A;  3I1U A;  2IZ3 A;  2EVN A;  3NE8 A;  4EFD A;  2KPI A;  4BBR I;  1CPS A;  3VMG A;  1ARM A;  1Q86 1;  2XEG A;  2ANP A;  4QUS A;  1VQN Z;  2DEA A;  4KSA A;  3I07 A;  4ZBG A;  2PDO A;  1M90 1;  2B63 I;  3CXS A;  2PSW A;  2ZW5 A;  3PB7 X;  4UCN A;  4RVG A;  2GFQ A;  2RFH A;  1Q82 2;  1VQ9 1;  2M6N A;  4R3L A;  1EE3 P;  2ZW7 A;  2I79 A;  2QR1 B;  4IK2 A;  2E9H A;  3CPX A;  4A95 A;  4CGM A;  1WCM I;  2OH1 A;  5K8N A;  2PC1 A;  3GY9 A;  1LAM A;  3BJ7 A;  4B5P B;  1MJA A;  3CCE 1;  3TO7 A;  1VQ9 Z;  3GYA A;  4F0Y A;  2R98 A;  1USP B;  4NCZ A;  4A37 A;  1KC8 2;  3EED A;  2QJ8 A;  5HH1 A;  3VB9 A;  4G1P A;  3WT4 A;  3CMA 1;  3IU2 A;  1JWQ A;  4H89 A;  3T8W A;  4KSI A;  2RC4 A;  4CS0 B;  1Z02 A;  4TNU A;  1YLO A;  3CCE Z;  3FXT A;  1YIT 1;  2ZEF A;  1KZF A;  2QLV B;  3W6X A;  2ZPA A;  3NFZ A;  4MRI A;  4NB9 A;  4NEX A;  1ZH1 A;  2PJ4 A;  4A39 A;  3CMA Z;  4HPS A;  3QWU A;  1MK4 A;  1I21 A;  1YJW 1;  1YK3 A;  4NBG A;  3S6H A;  3DR6 A;  5EC4 A;  1I50 I;  3IGR A;  1LQL A;  4PK3 A;  6CPA A;  5IT9 f;  3HLP A;  4BBS I;  3ISX A;  3B3T A;  3PO3 S;  3SJE A;  3KGQ A;  2JBK A;  1QSM A;  4EVY A;  1VQL 1;  3G4S Z;  3HOV I;  3S9L A;  3TO6 A;  1OBR A;  4M3S A;  3KL9 A;  1TKJ A;  2HUZ A;  5A2Q b;  3CME Z;  1BO4 A;  3CXC Z;  4IHM A;  2K3R A;  1LFW A;  1X3W A;  5D29 A;  2JIO A;  2PRB A;  3OW2 Z;  1KQS Z;  4CYO A;  1VQL Z;  4QC6 A;  4TWE A;  1M4L A;  4JLY A;  1NSA A;  2PIY A;  4MY3 A;  5IB9 A;  2B5G A;  2JEV A;  4R3K A;  4ONU A;  1B6B A;  4R6T A;  3DGV A;  3FJU A;  2HV2 A;  1PUA A;  4MD7 A;  3K2K A;  2ZOF A;  1Z5R A;  1Y1V S;  4A3J I;  1YVK A;  3G3S A;  2NYQ A;  3IWG A;  4A3E I;  4FD5 A;  1Y1V I;  3B7I A;  5CPA A;  2CF4 A;  2CY2 A;  4EWT A;  3NH5 A;  3H8F A;  1W2B Y;  5G22 A;  5A27 A;  1SFO I;  5HVF A;  4MFQ A;  1IYL A;  2C6C A;  2Z11 A;  2Z10 A;  4AG9 A;  2VUM I;  2HQY A;  4B11 A;  1Y0R A;  4NBA A;  3N5F A;  3QB8 A;  5IP7 I;  2PE3 A;  2NVX I;  1AA6 A;  1ZLI A;  4O23 A;  1CG2 A;  4KOR A;  5FVJ A;  4NSQ A;  1V0C A;  4KOS A;  4CRY B;  2OU2 A;  3D9X A;  2V8V A;  1M1K 2;  3GKQ A;  5LRJ A;  1TFI A;  3VWD A;  3EER A;  2E2H I;  2YU9 I;  2R92 I;  4A2Z A;  3JTK A;  3FB3 A;  3QAY A;  3HOX I;  4NBB A;  4IAV A;  4P4F A;  5LL6 f;  5E96 A;  1QVF Z;  3K9U A;  3HOU I;  1WII A;  2FE7 A;  3D7G A;  1YUK A;  1PYT B;  5THW A;  4P4E A;  2R1I A;  2YNE A;  4ZY2 A;  5FLX b;  3F5B A;  2GLF A;  3VMI A;  2QYV A;  3IIB A;  1QYP A;  1QSN A;  1ON0 A;  2DE5 A;  3LAC A;  2YAD A;  4Q36 A; 
#chains in the Genus database with same CATH homology
 2O4H A;  1TKH A;  1F57 A;  2ZEO A;  1R43 A;  4R8F A;  3CC7 Z;  3KHX A;  2XEJ A;  4B6Z A;  3VMH A;  2AFU A;  1KWM A;  4OME A;  4RVF A;  3TDH B;  4Q7A A;  2POK A;  3FH4 A;  3G6E 1;  4NJR A;  1YME A;  2I3C A;  3MZL B;  3D6W A;  5IT9 b;  1IGB A;  2PJ1 A;  3B35 A;  4X2T A;  3MN8 A;  2EWB A;  4Y7N I;  3BG0 B;  2PJC A;  2FVG A;  4A3M I;  1XBU A;  3B2Y A;  4F9U A;  4MON A;  4RV9 A;  5F09 A;  5JM6 A;  3BG1 B;  2Q4Z A;  1ZLH A;  3PBE A;  1TF9 A;  4DYO A;  4E30 A;  1Q81 2;  3GTO I;  3RZD I;  2GTH A;  3B3V A;  3WC7 A;  2PJ5 A;  2WZN A;  1TWF I;  1ELM P;  1Q81 1;  1RO2 A;  3TC8 A;  4RUH A;  3GUX A;  3BI0 A;  2R6M A;  3RZO I;  4MD9 A;  1P9N A;  4RVD A;  4JZ0 A;  1Z8L A;  2E2I I;  5T64 A;  3FQQ A;  2BO9 A;  2ZOG A;  1PFT A;  3CDX A;  3G6E Z;  4NGQ A;  2QVP A;  2RHB A;  1Z01 A;  4E32 A;  3CD6 Z;  4PPZ A;  2CTC A;  3PFO A;  3I55 1;  3VAR A;  2ZEM A;  3J80 f;  2PJ7 A;  3V7Z A;  4P4J A;  1X3Z A;  3BXM A;  3IWW A;  2JMO A;  4OC4 A;  3KIH A;  4EME A;  3PO2 I;  1LOK A;  4P10 A;  3IX0 A;  2RIQ A;  2OOY B;  5D1O A;  1HDU A;  3CPA A;  4MCS A;  1IY7 A;  4P6Y A;  3PB8 X;  2IQ6 A;  3GTL I;  1VHE A;  2V8K A;  3KQX A;  2ZAE B;  3WC5 A;  5DS0 A;  3MRU A;  4NFR A;  1CBX A;  2QRC B;  5C4J I;  2JEW A;  3PBB A;  4Z65 A;  4P44 A;  3KR4 A;  1S7M A;  1JJ2 Y;  3I55 Z;  1BPN A;  3TE5 B;  3CC4 1;  3NA6 A;  3NH4 A;  3BHX A;  4R76 A;  5A2Q f;  4MHN A;  2ZEN A;  1QVG Y;  3KI9 A;  4NB8 A;  2AFW A;  3FF3 A;  4OKO A;  3J81 f;  3IJ3 A;  4NGT A;  3KZW A;  3VTN A;  4DGL A;  1QVF Y;  3CCV Z;  3D7F A;  4P4B A;  3GTP I;  4NJQ A;  1UWY A;  2AKL A;  5HVG A;  2WYR A;  3F3F C;  4NOZ A;  2DE6 A;  3B3W A;  1NP6 A;  3GTK I;  8CPA A;  1LCP A;  1YHQ 1;  4MHP A;  2F7V A;  2ZEL A;  4PXE A;  3I56 1;  2QRD B;  3SI2 A;  4S1T A;  3FVL A;  4AXV A;  2JBJ A;  3BI1 A;  3CC4 Z;  3K9T A;  2PJ9 A;  3CCS 1;  4OC5 A;  3D66 A;  4NBH A;  1RLY A;  1Z03 A;  3NDI A;  2AFO A;  1H8L A;  5LYL A;  4OP4 A;  1Y0Y A;  3S1Q I;  1VQM 1;  1KD1 2;  4MXU A;  1CP6 A;  1ZG9 A;  2QEX 1;  3GB0 A;  3S2D I;  3S1R I;  2PJ6 A;  1YIT Z;  4K3N A;  2HF1 A;  1KD1 1;  1VQO 1;  2JA7 I;  2DE7 A;  1LAN A;  4A3L I;  2JA5 I;  1VQN 1;  5LYD A;  1Z2L A;  2JA8 I;  2OTJ Z;  2RPR A;  1DE4 C;  3NDJ A;  1XMB A;  3FEE A;  3WAB A;  1TWC I;  3CCJ Z;  4Y52 I;  2VF1 A;  1YHQ Z;  1ZG8 A;  3I56 Z;  3PO3 I;  2AFM A;  1GYT A;  2G2K A;  2LIY A;  2G9D A;  4DJL A;  1YSJ A;  2NVQ I;  3I1U A;  2IZ3 A;  3KIF A;  3TX8 A;  4FBE A;  4NGR A;  1YJW Z;  2RBL A;  3CCU Z;  4PQA A;  3CCS Z;  3HUV A;  5LRG A;  2P28 A;  4EFD A;  2KPI A;  4BBR I;  4RVH A;  1Q86 2;  4OC3 A;  4QTU A;  1VQM Z;  2PJ8 A;  1CPS A;  2QEX Z;  1XRY A;  3CCL 1;  3VMG A;  1RO4 A;  1ARM A;  1Q86 1;  1XFO A;  1VQO Z;  2XEG A;  2ANP A;  2OR4 A;  1S72 1;  1M90 2;  1VQN Z;  1Q7L A;  3HOW I;  2DEA A;  3GTJ I;  3CD6 1;  3I07 A;  2K5R A;  1M90 1;  1K9M 2;  4W9Y A;  2B63 I;  1N8R 2;  3T4N B;  3CPW Z;  1K9M 1;  3PB7 X;  4JYW A;  1NJI 2;  1N8R 1;  1X0T A;  2V8J A;  4HH4 A;  1DL6 A;  4RVG A;  1YW4 A;  3JAM f;  3DLJ A;  2R7Z I;  1L1O C;  1NJI 1;  2OZK A;  2RFH A;  4A94 A;  1Q82 2;  2EK8 A;  1VQ9 1;  2M6N A;  1YJN 1;  3CCL Z;  2J9A A;  1EE3 P;  1Q82 1;  1BAV A;  4HGY A;  1TXR A;  4ZI6 A;  1S72 Z;  2CIJ A;  2QR1 B;  4A3F I;  3CCQ 1;  4IK2 A;  3FKI I;  4CPA A;  2BCO A;  2E9H A;  1YJ9 1;  2GRE A;  3CPX A;  1WCM I;  1AYE A;  2EK9 A;  5I4M A;  5HVH A;  1QQ9 A;  2PJ2 A;  5K8N A;  4EWC A;  5K8P A;  1HEE A;  3S16 I;  4MCQ A;  1VHO A;  4X8I A;  4E2Z A;  3RAM A;  3H8E A;  1ZG7 A;  4UF4 A;  1ML8 A;  1ZB8 A;  1TWH I;  1LAM A;  1ZB9 A;  4ZY0 A;  3CCE 1;  3CCV 1;  4E33 A;  3VAT A;  1I6H I;  3QNV A;  1JWH C;  4A3K I;  1VQ9 Z;  2IJZ A;  2ZEE A;  3S14 I;  1YJN Z;  3D7D A;  1USP B;  1NUI A;  1TF8 A;  2C6P A;  4A37 A;  3B3S A;  1KC8 2;  3EED A;  2QJ8 A;  3RBU A;  2F8H A;  3CCQ Z;  2V8I A;  1YJ9 Z;  1KC8 1;  1FT7 A;  2AFS A;  3VB9 A;  4UIB A;  3V38 A;  1VQ8 1;  2HU9 A;  4G1P A;  5K8O A;  3WT4 A;  4F8Z A;  3CMA 1;  2V8G A;  1VQ4 1;  3GTG I;  3LWU A;  4OC1 A;  3I4N I;  3B3C A;  5FLM I;  3D4U A;  3M3Y I;  4OID A;  3FED A;  3T8W A;  4KSI A;  1YIJ 1;  1R9T I;  1I3Q I;  1VQ7 1;  1Z02 A;  4TNU A;  1YLO A;  3CCE Z;  1YIT 1;  4NBF A;  2ZEF A;  2QLV B;  5FLX f;  2PJB A;  3NH8 A;  4P45 A;  5J1Q A;  2O53 A;  5C4X I;  3NFZ A;  2OTJ 1;  1CP7 A;  3MON A;  2QA4 1;  2V77 A;  1Y1W I;  1W2B Z;  3CCJ 1;  4MRI A;  4NB9 A;  1ZH1 A;  2PJ4 A;  4BXX I;  1VQ8 Z;  4FUU A;  3CQZ I;  5D1P A;  4UEZ A;  4A39 A;  3CMA Z;  3QWU A;  3HOZ I;  5JGF A;  1VQ4 Z;  1YUA A;  2ZEP A;  4NBE A;  1YJW 1;  4R7M A;  1RNI A;  3CCU 1;  2Q51 A;  4NBG A;  3S2H I;  3FX6 A;  4FWU A;  4P4D A;  3J80 b;  1YIJ Z;  3SI0 A;  1I50 I;  1LQL A;  1VQ7 Z;  4A3G I;  4E2X A;  2OOX B;  2VL1 A;  6CPA A;  2P3Y A;  4F9V A;  5IT9 f;  3HLP A;  4BBS I;  4OC2 A;  3ISX A;  1WW9 A;  1PCA A;  3B3T A;  4NGP A;  3CC2 1;  2JUB A;  2GLJ A;  2QA4 Z;  3PO3 S;  4NGS A;  3IF8 A;  3SJE A;  2ABZ A;  3GLJ A;  3S1M I;  2JBK A;  2ZED A;  3KGQ A;  4NBD A;  1VQL 1;  2H85 A;  3G4S Z;  2AFZ A;  3HOV I;  2E2J I;  4ZYQ A;  3K7A I;  3S9L A;  3CPW Y;  4HGZ A;  3S15 I;  4WWV A;  4MH4 A;  1CX8 A;  1OBR A;  2AFX A;  4QTT A;  2Q43 A;  2PVV A;  3ISZ A;  1FNO A;  1TKJ A;  3KL9 A;  5HXD A;  4NGM A;  5A2Q b;  3H3V J;  3CME Z;  1RO0 A;  5CM2 M;  3CXC Z;  3J81 b;  4IHM A;  3P5J B;  1VQK Z;  2W03 A;  2K3R A;  1LFW A;  2W04 A;  2RB7 A;  1K83 I;  4ZX9 A;  1BLL E;  3LMS A;  2OOT A;  4BY1 I;  1X3W A;  3CC2 Z;  3PB9 X;  5D29 A;  5AN9 F;  3CCM 1;  1R3N A;  2BJO A;  2ZEH A;  3OW2 Z;  1KQS Z;  3PRT A;  4RS4 A;  1VQL Z;  4UIA A;  2V8D A;  4TWE A;  4E2W A;  1YI2 1;  1YW6 A;  3S9M A;  5LRK A;  5T67 A;  1M4L A;  1TKF A;  4A3C I;  3RZA A;  1NSA A;  2PIY A;  3MZK B;  3SI1 A;  2EGT A;  2PJ3 A;  2RT9 A;  4E31 A;  5IB9 A;  3CT9 A;  4YU9 A;  4UEF A;  5C3E I;  2PJA A;  2F4O A;  2QKD A;  3HOY I;  4MCR A;  4OC0 A;  3KHZ A;  2Y0S A;  3GCF A;  1USP A;  1F2O A;  1K8A 2;  3J7A 4;  1KRL A;  4A38 A;  4R6T A;  3CCM Z;  2C6G A;  5CBM A;  3DGV A;  4A3D I;  3FJU A;  2LFU A;  2PM9 A;  1Q7Y 2;  1K8A 1;  2HC9 A;  1N2F A;  3L2N A;  2NVY I;  4NBC A;  1VLA A;  1VQP 1;  4MD7 A;  3K2K A;  3G71 1;  1YI2 Z;  1Q7Y 1;  1JQG A;  1LAP A;  5C44 I;  4CL1 A;  2ZOF A;  3FMC A;  5K8M A;  3HKZ A;  3PFE A;  3WC6 A;  1HDQ A;  1Z5R A;  1Y1V S;  4A3J I;  3IFE A;  5ELY A;  2NYQ A;  4A3E I;  3FEC A;  1VGY A;  1VQ6 1;  4H2K A;  1Y1V I;  3B7I A;  3SJX A;  5CPA A;  3KQZ A;  4YWY A;  4E2Y A;  1RQF A;  2CF4 A;  2PIZ A;  2OTL 1;  2C1C A;  4EWT A;  2IMO A;  3NH5 A;  3H8F A;  4MHY A;  1QMU A;  1W2B Y;  3H0G I;  2XEF A;  3LUS A;  3D67 A;  1SFO I;  7CPA A;  2PMZ A;  4DK1 A;  1VQP Z;  2J6A A;  3JRU A;  5HVF A;  3G71 Z;  4MHZ A;  5LYF A;  1DTD A;  4A93 I;  2PVW A;  2V8H A;  2C6C A;  1CPX A;  5LYI A;  2CTB A;  2PRQ A;  2PCU A;  3JAM b;  2VUM I;  3PB4 X;  1VQ6 Z;  3GTM S;  1Y0R A;  3M4O I;  2XEI A;  4OIW A;  4A3I I;  3IO1 A;  4NBA A;  5IP9 I;  3N5F A;  4NH1 C;  3GTM I;  2OTL Z;  2M48 A;  5IP7 I;  3CCR 1;  1F2P A;  1Y7E A;  2PE3 A;  2NVX I;  1ZLI A;  3Q87 A;  4O23 A;  1CG2 A;  4BD9 A;  5T6B A;  4ONW A;  3G4S 1;  3GTQ I;  4PXD A;  3SJF A;  1VQ5 1;  4ZY1 A;  2JA6 I;  4BY7 I;  2JS4 A;  3D9X A;  2NSM A;  3KR5 A;  2JR6 A;  4PXB A;  3VH9 A;  5D1O B;  2WAQ A;  2V8V A;  1M1K 2;  2R93 I;  3D7H A;  1TWG I;  3GKQ A;  3CME 1;  3S1N I;  4MMO A;  5LRJ A;  1TFI A;  3CXC Y;  1M1K 1;  1VQK 1;  3I4M I;  3S17 I;  4X3R A;  3S9N A;  3EER A;  2E2H I;  4DQY B;  2YU9 I;  3CCR Z;  2R92 I;  1BPM A;  3PB6 X;  1JJ2 Z;  3FQM A;  4P4I A;  2JNY A;  4XX2 A;  3H8G A;  3HOX I;  4X6A I;  3OW2 Y;  1KQS Y;  2GU2 A;  1QVG Z;  4NBB A;  4A3B I;  3ESW A;  4IAV A;  2PJ0 A;  2ZEG A;  1VQ5 Z;  5LL6 f;  4P4F A;  2IZ4 A;  3F3P C;  1ELL P;  1QVF Z;  1QF8 A;  1AMP A;  2VUG A;  3HOU I;  1WII A;  3CC7 1;  3SJG A;  4MCP A;  3U50 C;  3D7G A;  4GM5 A;  1VIX A;  2F4M A;  2PK7 A;  1YUK A;  1PYT B;  2BOA A;  5THW A;  4P4E A;  1ARL A;  4MD8 A;  4PXC A;  3D68 A;  5D8N A;  4ZY2 A;  5FLX b;  1XJO A;  4NGN A;  2NVT I;  4ZX8 A;  2GLF A;  3VMI A;  2QYV A;  3PEI A;  3IIB A;  1QYP A;  2WB1 A;  2QRE B;  3IFU A;  3KAS A;  4AYB A;  4FAI A;  2KI7 B;  2DE5 A;  4UEE A;  4DUK A;  3IC1 A;  4WJB A;  1K73 2;  3IEH A;  2HB6 A;  2YAD A;  1TWA I;  2GTI A;  4LQG A;  1K73 1;  1RTQ A;  5JH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...