2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Aspa protein
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
3B2YA 1AYEA 4IK2A 4NGQA 2PJ9A 2Q4ZA 3SJFA 4R76A 3D66A 4P4EA 3KR5A 4MHZA 2PJ5A 2BOAA 3GB0A 4NGMA 5JM6A 3HLPA 4ZX9A 2V77A 2GREA 3KR4A 4NGSA 4UEFA 2EK9A 5LYFA 2BO9A 1F2PA 2OR4A 4YWYA 1KWMA 4ZY1A 3S9MA 3PB8X 3FJUA 8CPAA 3NH8A 3SJGA 4F9UA 1LFWA 2AFWA 5LYLA 4R7MA 4MCPA 5HVFA 4DUKA 1R43A 4G1PA 3ISZA 2GLJA 2XEFA 4PXEA 2PE3A 3BHXA 3FX6A 3FVLA 3K2KA 3KHXA 1FT7A 2CTCA 1ZLIA 1YLOA 3WABA 5K8PA 2O4HA 3BI1A 4ONWA 3FH4A 1BPNA 2VL1A 1CP6A 5HVGA 1TF9A 2GU2A 3D7FA 4RUHA 3IFEA 4FWUA 1EE3P 1Y0RA 3WC7A 3H8EA 5CPAA 4ZYQA 1CPSA 2AFUA 2ZEEA 1TKFA 2C6GA 3S9LA 4OKOA 1HEEA 3FECA 3VARA 4EFDA 5CBMA 3TX8A 2DEAA 3NH5A 2Q51A 2G9DA 2PVWA 4PXDA 1TF8A 2ZEOA 4NJQA 7CPAA 3DGVA 4O23A 1LANA 4CPAA 2PJAA 5LRKA 2C6CA 1ZG9A 2OOTA 2O53A 1VIXA 4NGNA 4ZI6A 5F09A 2CF4A 3PB9X 2RB7A 3B3TA 4MXUA 3B3WA 4P45A 2BCOA 2PJBA 2AFMA 2PJ2A 2PJ1A 3B3CA 1ARLA 4ZX8A 3D7GA 2IJZA 1CG2A 3GLJA 3SI2A 5K8MA 4MCRA 3BI0A 3H8FA 3SJEA 1QMUA 1F2OA 3GUXA 4TNUA 1FNOA 1XBUA 2PJ0A 3K9TA 2EWBA 2PJ3A 4B6ZA 2PJ8A 4AXVA 1R3NA 3MRUA 1DTDA 3FF3A 3T8WA 2Q43A 3RBUA 2PJ4A 1DE4C 4OC4A 5LYDA 4OIDA 2PJ7A 1Z2LA 3CT9A 4FAIA 2AFXA 1Y0YA 1JQGA 4UEEA 3SJXA 2V8GA 4OIWA 4F8ZA 3WC6A 4UF4A 3D68A 1Z5RA 1F57A 3B3SA 4JZ0A 3PFEA 2ZOGA 4A39A 4GM5A 2F7VA 3NFZA 1IY7A 1M4LA 2ANPA 5J1QA 4OC2A 3RAMA 1RTQA 4A94A 2F8HA 5D29A 1CX8A 4NFRA 4A38A 2AFZA 2QJ8A 2I3CA 3H8GA 3IIBA 1TXRA 4W9YA 4UIAA 2ABZA 1Y7EA 3B3VA 3V7ZA 4DJLA 2JEWA 3I1UA 3QNVA 1PCAA 2XEJA 4OC1A 1LCPA 4P4JA 3ISXA 2PIYA 1HDUA 1ZLHA 4P10A 2AFSA 4MCQA 3V38A 3NA6A 4EWTA 1NSAA 2JBKA 3WC5A 3FEDA 3WT4A 4H2KA 3RZAA 4IAVA 1OBRA 4BD9A 3BXMA 1BPMA 1ELMP 1VHEA 4OC3A 3B35A 2WYRA 3HUVA 5ELYA 4JYWA 5IB9A 3B7IA 4NGRA 4DYOA 4Q7AA 3KQZA 4P44A 4KSIA 4TWEA 2J9AA 4PPZA 1CPXA 2V8DA 5LRJA 2RFHA 3MN8A 5LRGA 4YU9A 1BAVA 4OC0A 4P4DA 4MHYA 1VHOA 3SI1A 4WWVA 2IMOA 3FMCA 1QQ9A 1YMEA 3D7DA 2NYQA 1BLLE 3TC8A 1LOKA 1CBXA 4R8FA 4PXBA 4PQAA 1AMPA 4X2TA 4OMEA 3LWUA 4FBEA 5JGFA 4P4IA 3L2NA 1Z8LA 3SI0A 2ZEPA 1PYTB 2AFOA 3N5FA 3IO1A 2PJCA 4K3NA 3CPXA 3VH9A 2PVVA 5DS0A 2CTBA 2V8HA 3PB4X 3IEHA 4ZY2A 2C6PA 1HDQA 3LMSA 2QYVA 2V8VA 2XEGA 4F9VA 5K8OA 2JBJA 3PB7X 1XJOA 4MHPA 1XFOA 3KL9A 4P6YA 1XMBA 5I4MA 1XRYA 3IWWA 1TKJA 2PJ6A 1LAMA 3PB6X 4X3RA 4MRIA 1ZG7A 6CPAA 3IJ3A 1UWYA 1YW4A 5HVHA 4Z65A 3FEEA 4R6TA 2ZOFA 4ZY0A 4OP4A 4P4BA 2WZNA 1TKHA 4NGPA 3KHZA 2C1CA 5D8NA 5LYIA 1Q7LA 2POKA 3KZWA 4A37A 1YSJA 2NSMA 2PRQA 2GLFA 3PEIA 2ZEMA 3D67A 4X8IA 5THWA 4OC5A 1CP7A 3KQXA 2ZEFA 5JH9A 4NGTA 3KI9A 3NH4A 4UEZA 3IC1A 3S9NA 2ZEGA 1IGBA 3D7HA 3PRTA 3JRUA 2ZEHA 2IQ6A 3PFOA 2ZENA 1ZG8A 3VATA 1LAPA 4NJRA 1ELLP 2PCUA 2ZELA 2EK8A 4MMOA 4IHMA 2CIJA 5HXDA 3CDXA 4P4FA 5K8NA 4FUUA 3DLJA 3CPAA 2HB6A 2ZEDA 4PXCA 4EMEA 4UIBA 4WJBA 3PBEA 3D4UA 1VGYA 2PIZA 2FVGA 4MHNA 3KASA 4LQGA 2QVPA 1GYTA 2HC9A 3PBBA 1H8LA 1YW6A 2XEIA 4MCSA 1ARMA 3KGQA
chains in the Genus database with same CATH superfamily
4A3EI 1WZNA 1VQ61 4NGQA 2JEVA 2PJ9A 2Q4ZA 3SJFA 3D66A 3KR5A 1VQP1 3R96A 2HQYA 2V8KA 1QXFA 4MHZA 5F48A 1USPA 3PO3S 3KR4A 3TOBA 2BO9A 1F2PA 4KLWA 2CXAA 1N2FA 3K7AI 3TO9A 4NCZA 1XE4A 4A32A 3SJGA 4F9UA 2QA4Z 2AFWA 3N7ZA 5KTAA 4DUKA 4KOSA 2AE6A 2VUMI 3RNZA 4G1PA 4JXRA 3ISZA 3BHXA 2KCWA 3D2LA 1VQO1 3FNCA 4E31A 2CTCA 4KOWA 4NEXA 5AG4A 2R92I 1YLOA 4MFKA 3CXCY 2O4HA 2ATRA 3CCUZ 4UA3A 3QAHA 1YI21 1CP6A 1QF8A 4RUHA 1TWAI 3G4S1 4IUSA 4NOZA 2OTLZ 1EE3P 4A3BI 2JDDA 1CPSA 1TKFA 2H5MA 4OKOA 1HEEA 3FECA 3EFAA 4PXDA 3DSBA 1LQLA 1B87A 3TT2A 4O23A 1LANA 3FQQA 2PJAA 3F8KA 4CPAA 5FVJA 3CC4Z 4UWJA 3IWGA 2G0BA 2CF4A 3B3TA 4MXUA 4R3KA 3JAMb 1Y7RA 2I79A 2PJ1A 1Z4RA 4L89A 3JTKA 1S5KA 4B5PA 2EUIA 4II9A 2ZW7A 1N8R2 2YGWA 4ZGYB 2REFA 3H8FA 1QMUA 1F2OA 2VPZA 4KOVA 4B12A 3W91A 4TNUA 1MJAA 1XIXA 2K5TA 3TFYA 4AXVA 1DTDA 5HH1A 1I21A 4BXXI 3T8WA 5C88A 5IP7I 1XEBA 3RO0A 4B13A 3D3SA 4FAIA 4A3FI 1JQGA 3SJXA 3WC6A 4CRZB 3B3SA 3PFEA 4A39A 4B5PB 2ANPA 2Q0YA 3CCJ1 1YJ9Z 5A27A 4RVGA 2B4BA 1RTQA 2Q44A 5D29A 2OTL1 3CCJZ 1KZFA 2ZXVA 3R9GA 3GTLI 1Q821 4EVYA 2Q7BA 3GTQI 1Q2CA 2I00A 5AG5A 4RV9A 4DNCA 2W04A 1VQL1 1PFTA 2VBQA 4B11A 3WR7A 4AVCA 1LCPA 4A3DI 3CME1 3NA6A 4KORA 2PR1A 4PSWA 5F46A 1Z01A 4J3GA 4NSQA 1V0CA 1VHEA 4OC3A 3RYOA 1MJBA 4L8AA 4E2AA 2WYRA 4JYWA 2DE6A 5IB9A 3IU2A 2PC1A 1VQ71 4DYOA 4KSIA 2PK7A 5IP9I 4M6HA 3IX0A 1Q7Y1 1X3WA 4GXHA 1WW9A 5D1PA 1VQ41 1BAVA 1Q2YA 1YGHA 4RVDA 1SFOI 4MHYA 2FS5A 1VQ7Z 1ZB8A 1VHOA 4XPDC 4A3CI 2JA7I 4WWVA 1YMEA 1A2ZA 4UBRA 3GKRA 1AA6A 2BUEA 1AMPA 4OMEA 1KUYA 2O28A 2WPXA 3KKWA 4PK2A 5C82A 1Z4EA 3SI0A 4Y49C 3N5FA 2OTJZ 1QVFY 4YGOA 1Q822 4A31A 4PV6A 3VH9A 5DS0A 3LACA 4ZY2A 1HDQA 5EBVA 4AB7A 2PSWA 2XEGA 4A93I 4A33A 2DE7A 2FIWA 4MHPA 3CXQA 3W6XA 2JLMA 2QREB 4C68A 2PJ6A 2YNDA 3PB6X 2VQYA 2V8IA 1ZG7A 4R6TA 5FLXb 5KTCA 2P3YA 4P4BA 1B6BA 4NGPA 1VQMZ 2C27A 3KHZA 3CCL1 1Q7LA 3S16I 3EERA 4RVHA 3CCVZ 2Z3LA 4OC5A 1CP7A 5GCNA 2KPIA 4NGTA 3NH4A 2Z3MA 3D7HA 4KOYA 2IQ6A 2JA6I 1KD11 3VATA 2PCUA 4IHMA 3CDXA 3F5BA 4P4FA 1KD12 4CRYB 3V8IA 2PRBA 2IZ4A 2IL4A 4CGLA 4FUUA 1KC82 4PXCA 4UIBA 1TWFI 2V45A 2PIZA 4MHNA 3I56Z 4U9YA 2HC9A 1N71A 1H8LA 2OOYB 1YW6A 3IF8A 2XEIA 3P2FA 1L1OC 1GHEA 4MCSA 1ARMA 2AJ6A 4KOXA 2FIAA 3CXSA 4R76A 4P4EA 3G711 5AN9F 3GB0A 5JM6A 2W03A 2GREA 4CAXA 1YHQZ 5D1OB 3M3YI 2DPSA 2EK9A 2OR4A 4YWYA 4ZY1A 3PB8X 3CCM1 4MJ8A 3D8PA 1LFWA 1Y9WA 2WB1A 4EWCA 3S1MI 4R7MA 1M4GA 2VZZA 2BSWA 1QYPA 1R43A 1VKCA 4AG9A 2XEFA 2R7ZI 4XPDB 4PXEA 3IWEA 4BBHA 2K3RA 2E2II 3FVLA 3K2KA 4YRHA 3G6EZ 1ZLIA 4A30A 4ONWA 4MY3A 2FE7A 4QTUA 3I9SA 1TF9A 2JA5I 2VUGA 3U50C 4RI1A 2PR8A 3CPWY 1X0TA 5CPAA 3SXNA 2ZEEA 2R98A 2QLVB 3VARA 1VQN1 1VHSA 3NH5A 2G9DA 2PVWA 3FIXA 1Z8TA 3MONA 4XPLA 1TF8A 4NJQA 7CPAA 3DGVA 5LRKA 2VXKA 1M1K2 1ZG9A 2OOTA 2O53A 5F09A 1IU8A 1MJ9A 1VQ5Z 1K731 2GE3A 4ZX8A 4C2XA 4CGOA 3GY9A 3HOXI 2ZW6A 1WIIA 1K8A1 2IJZA 1I6HI 5K8MA 4Y7NI 3S15I 3NE8A 3SJEA 3D9XA 1FY7A 3TOAA 2Z3NA 2PJ0A 4M3SA 1M1K1 2EWBA 2G3AA 2PJ8A 1R3NA 3PO2I 1VQ9Z 3FF3A 4C7IA 3GYAA 1CM0A 2PJ4A 5LYDA 1Z2LA 2Z3OA 4UF4A 1F57A 2M48A 2ZOGA 3G3SA 2BJOA 3NFZA 2JA8I 1VQ81 2V8JA 1M1DA 1S72Z 3BJ8A 5J1QA 5G1ZA 3S6HA 2H85A 4MD7A 3QB8A 3K9UA 4NXYA 3R95A 4QC6A 4NFRA 3KIFA 2AFZA 1Y1VS 1SQHA 4XNHC 3VB9A 2YNEA 3H3VJ 2I3CA 3H8GA 1KUXA 4UIAA 1YQEA 5A2Qb 3P5JB 1RO5A 3E0KA 4KOTA 3I1UA 2B63I 1M4IA 3GTMI 3CCRZ 1QVGY 2QIRA 4CGPA 4NH1C 2CNMA 3BG1B 1ZLHA 4P10A 2QKDA 2JBKA 4MHDA 3RZAA 1PU9A 2FT0A 3B8GA 3LODA 4XNHB 1OBRA 1RNIA 5T67A 3QAYA 3S1QI 3S6FA 4BY1I 1NMTA 1BPMA 4ZBGA 4X6AI 1VQK1 4FD6A 1YJW1 1KQSY 2J8MA 4NGRA 4Q7AA 3KQZA 3GIUA 3CCLZ 4TWEA 1CPXA 2BL1A 2V8DA 2B3VA 5LRJA 2GANA 4U9ZA 4F6AA 4BINA 2NVXI 2JMOA 3MN8A 4KSAA 5LRGA 3OW2Z 3CMAZ 4YU9A 4MFQA 4CL1A 1QSTA 3I4NI 4Y52I 4A95A 3DNSA 4E8OA 3C26A 3GKQA 2HV2A 3SI1A 1IYKA 1IOFA 1QQ9A 3TC8A 4F0XA 3CD6Z 3OWCA 3D2PA 4M6GA 3F3PC 2CNTA 1S7KA 3J80b 3CC41 2PM9A 4P4IA 1PYTB 2AFOA 3D2MA 1ZB9A 5BWAB 2VPXA 2YU9I 2PJCA 3BJ7A 3IEHA 3LMSA 3TTHA 2WAQA 2IV2X 1XF8A 1XFOA 3TE4A 5DWMA 3KL9A 3H4QA 4P6YA 4MFJA 3MZKB 3HOYI 1XRYA 1YIJ1 5H86A 4BY7I 1RLYA 2QRCB 3TO6A 4R87A 4X3RA 3MGDA 4MRIA 6CPAA 2QR1B 1UWYA 4HPSA 5HVHA 1FDOA 1KRLA 4AG7A 3VMHA 2JIQA 1U6MA 4NBFA 3I561 2EBJA 1S7FA 1USPB 1TWHI 2Q4VA 1Z8WA 5D8NA 5LYIA 2POKA 1Z03A 3KZWA 1ML8A 5C4XI 2NSMA 1WK4A 3S17I 1WWZA 3D67A 1YJNZ 3BG0B 4HH4A 3KQXA 1TWCI 3GTPI 2ZEFA 5JH9A 4K30A 3IR7A 3GTJI 5ISVA 1IYLA 4H6ZA 2ZEGA 1IGBA 3CCU1 4FD5A 3PRTA 4JJXA 4CAVA 3PFOA 1ZG8A 1LAPA 4RN7A 3T4NB 2CNSA 2CIJA 5T6BA 5K8NA 2P28A 1M4DA 1QSMA 5G21A 2A4NA 4NBHA 2ZEDA 4KUBA 1YJ91 4C7HA 1TWGI 3D4UA 1VGYA 5H84A 4LQGA 2QVPA 3ESWA 2E9HA 2CY2A 2R7HA 1YX0A 1YK3A 2JDCA 1Z02A 1UFHA 1BOBA 1S7LA 1YVKA 1FDIA 5LL6f 4QTTA 2NAPA 1YR0A 3HLPA 4ZX9A 2V77A 3G8WA 4CAEA 3TO7A 1KWMA 3S9MA 1YIT1 3FJUA 1Z9UA 2GFQA 5LYLA 4MCPA 4KVME 3I55Z 2RHBA 1Y1WI 1RO0A 3CCS1 2VEZA 4NBAA 4C2YA 2G3TA 1QSNA 1VLAA 3HOZI 2PE3A 3KHXA 3F3FC 1FT7A 1JWHC 3WABA 5K8PA 2YNCA 4E33A 5A28A 2NMTA 1N8R1 4KZTA 3VTNA 2WPWA 2GU2A 3D7FA 2JIPA 4FWUA 4OAEA 1Y0RA 1YREA 3H8EA 1P0HA 3FKII 4CGMA 2AFUA 2IZ3A 2C6GA 2FXFA 1JJ2Y 5CBMA 3CCEZ 3TX8A 4HGYA 2DEAA 2Q51A 1LRZA 1L0CA 5FLMI 1M44A 4UCNA 3Q87A 2JR6A 4JLYA 2RBLA 2C6CA 4ORFA 2OZUA 2RB7A 3B3WA 4A3MI 2BCOA 2PJBA 2AFMA 2PJ2A 1ARLA 5A2Qf 5G20A 1ZO0A 1CG2A 3SI2A 3BI0A 1TIQA 3OW2Y 3D6WA 3VWDA 4B6ZA 4B10A 1Q862 3MRUA 2YNCC 2Q43A 3I551 4Q36A 4OC4A 1DE4C 4OIDA 2PJ7A 2D4OA 3CT9A 1Q811 2AFXA 1VQNZ 2NVQI 1Y0YA 4UEEA 2RPRA 4A3II 4F8ZA 3D68A 1Z5RA 4JZ0A 2F7VA 1M4LA 1K4JA 4U5YA 2Q7SA 5DWNA 2FL4A 4OC2A 4E32A 5J8CA 3RAMA 2F5IA 1VQKZ 3CCQZ 3CC2Z 3RZOI 1I3QI 3J7A4 2R6MA 5D1OA 4Q38A 4NBDA 1TXRA 3CCE1 1Y7EA 3B3VA 4HGZA 3R1KA 2RT9A 3DR6A 3T9YA 2G2KA 1BO4A 2EGTA 2JS4A 1VQ91 4NBEA 3QNVA 2K5RA 4E2ZA 2X7BA 1PCAA 2XEJA 4OC1A 1Q861 2DXQA 4P4JA 1YHQ1 2ZAEB 1DL6A 2AFSA 3V38A 4H89A 1W2BZ 2JIMA 2Z3PA 3FEDA 4H2KA 3FB3A 4MFZA 1I12A 3BXMA 4MBUA 1K9M1 1K8A2 3B35A 5F49A 2LIYA 3B7IA 4AYBA 3CMA1 4E0AA 4AVBA 2RFHA 2ARHA 3H0GI 1QVGZ 4H6UA 2QMLA 5JPHA 4NBGA 3IU1A 3CZXA 1KQSZ 1JWQA 4OC0A 1W2BY 4BBRI 1RQFA 2PMZA 3EXNA 4P4DA 4A3KI 1YLEA 2OZHA 3TE5B 3CCMZ 3LD2A 2LEXA 4NBCA 1K83I 3CC71 3M4OI 2NVTI 2IMOA 2NYQA 1BLLE 4ONUA 1LOKA 4R8FA 4PXBA 3S6KA 1YUKA 2M6NA 2F4MA 4FD7A 4FBEA 1JJ2Z 3CC7Z 1YJWZ 1Z8LA 3IO1A 2P6FA 4X5KA 3DDDA 4K3NA 4JD6A 2PVVA 2V8HA 1Y8CA 2C6PA 1CJWA 5IB0A 2QYVA 4PK3A 3PO3I 4KOUA 5F47A 4UCMA 4GS4A 4F9VA 2ZW4A 4CGNA 1XJOA 1MK4A 1P4NA 2R1IA 2DE5A 3S1RI 1LAMA 2FSRA 2HF1A 3IJ3A 1NJI1 3PGPA 1YI2Z 3VMGA 4Z65A 3FEEA 4QB9A 2ZOFA 2E7ZA 4ZY0A 1Q812 4OP4A 3J81f 1TKHA 1VQ8Z 5AG6A 2C1CA 1I50I 3IGRA 4MD9A 4A37A 4E2WA 1YSJA 2PRQA 3PEIA 1M902 1J4JA 5I0CA 5THWA 2EVNA 4BBSI 3I4MI 4UWIA 2QEX1 3S9NA 3JRUA 2ZEHA 4M6IA 3NDIA 2OB0A 2ZENA 3FBUA 1VQ51 3EC4A 1ELLP 2ZELA 3IFUA 2OU2A 3LUSA 2PQ8A 4DQYB 3GCFA 2KI7B 2OZGA 3CPAA 2HB6A 4EMEA 3FXTA 4E2XA 5AGEA 1S721 4WJBA 1IIDA 3PBEA 2Z0ZA 4I49A 3GTGI 3KASA 2JIOA 4HNXB 1VQOZ 2WSAA 3ZZIA 4QBJA 1I1DA 3EO4A 4MY0A 3FRMA 3B2YA 1AYEA 4IK2A 3G4SZ 2PJ5A 2BOAA 3S1NI 4NGMA 4A3JI 4RVFA 1VQ4Z 2VZYA 2E2HI 2GTHA 4NGSA 4UEFA 3VMIA 3CMEZ 5LYFA 2GIVA 1SIWA 5IV0A 2OTJ1 3HOWI 8CPAA 3NH8A 2REEA 2B58A 4LQ6A 5HVFA 4XX2A 4A3GI 1OZPA 4OADA 2EO8A 2GLJA 4IF5A 4F0YA 2QA41 3FX6A 4QVTA 1S7MA 4CAWA 2P6GA 5AG7A 1S7NA 3BI1A 3FH4A 3S2HI 3A9LA 1BPNA 2VL1A 3R9FA 4CYOA 5HVGA 2QRDB 2JIRA 1IOIA 2P0WA 4LX9A 2Q4YA 3IFEA 1Z8XA 3WC7A 3GTKI 3SHPA 2J8RA 4ZYQA 4KSFA 3S9LA 4RS4A 5EMIA 4QUSA 3I3GA 2VPWA 4EFDA 2ZEOA 5JQ4A 3F0AA 1NJI2 3HOUI 1VIXA 3HKZA 4NGNA 4CYQA 4ZI6A 4DGLA 3S14I 4R57A 3PB9X 5G22A 3QWUA 4P45A 1YUAA 4KVOE 3B3CA 4JWPA 5J8FA 3D7GA 1QSRA 2BEIA 3GLJA 1K732 4MCRA 3RZDI 3GUXA 2ZPAA 5E96A 1FNOA 1XBUA 3PP9A 3K9TA 2PJ3A 2LFUA 3ZJ0A 2Q04A 1VQLZ 3RBUA 1Q7Y2 4AVAA 5C4JI 4XPKA 2VF1A 2V8GA 4OIWA 4B14A 1R9TI 4JXQA 4M85A 4GM5A 3CCQ1 2OZKA 1IY7A 3CPWZ 5HMNA 1X10A 1Y9KA 5C44I 2AYDA 5EC4A 4MD8A 4MFLA 3HOVI 1NE9A 4B5OA 4A94A 4UFXA 1YVOA 3I07A 2F8HA 2WUUA 3T90A 4CAFA 2RIQA 1YITZ 1CX8A 3J81b 2JNYA 1YIJZ 5IT9f 4MI4A 4A2ZA 4A38A 2QJ8A 2R93I 2E2JI 3IIBA 3W6SA 4W9YA 2ABZA 1X3ZA 4CS0B 3KIHA 1RO2A 2F4OA 4R3LA 3CCSZ 3V7ZA 4DJLA 2JEWA 2VI7A 3UY5A 1WJ2A 2Z10A 4NB8A 3JAMf 3NE7A 4RS2A 3JVNA 3G6E1 1ZH1A 2B4DB 3ISXA 2PIYA 3JUWA 1HDUA 4MCQA 1RXTA 4EWTA 1NSAA 3WC5A 1QVFZ 3EEDA 3WT4A 3TDHB 4IAVA 1ON0A 2HUZA 4BD9A 5FLXf 1ELMP 2GTIA 4KLVA 2ODFA 2VPYA 3HUVA 5ELYA 1RO4A 4UFWA 4KUAA 4P44A 4NB9A 2J9AA 1P9NA 1M901 4PPZA 3EY5A 5CM2M 4BMHA 2HU9A 1YJN1 5T64A 2J8NA 1R57A 2NVYI 1NP6A 2Y0MA 3S6GA 2R8VA 3NDJA 3TCVA 2ZW5A 3GTMS 2DF5A 2OOXB 3CQZI 3FMCA 3D7DA 4HNYB 1Q16A 4NBBA 1CBXA 3P2HA 4PQAA 3G71Z 2B3UA 4X2TA 4KVXA 3LWUA 5JGFA 2Y0SA 3L2NA 5IT9b 2ZEPA 1Y1VI 2B5GA 3CCV1 3CPXA 3SXOA 4PSXA 4YFJA 2CTBA 3PB4X 1S60A 1XOVA 2V8VA 5IX3A 2Z3KA 1KUVA 5K8OA 2JBJA 3PB7X 1NUIA 4CYNA 3CC21 2YADA 1K9M2 1XMTA 1AUGA 1XMBA 5I4MA 2D4PA 2B5GB 3IWWA 5KTDA 4LUAA 1TKJA 1VQPZ 1Q2DA 2DPTA 4E2YA 3GTOI 1IB1E 2V3VA 1YW4A 4Y49B 3FQMA 1X12A 4MFPA 4KS9A 4UFVA 3CXPA 2WZNA 4S1TA 2PDOA 1IICA 3H5ZA 4R9MA 2QEXZ 4C2ZA 2OH1A 4NF1A 2J6AA 4E30A 2GLFA 1S3ZA 2ZEMA 4X8IA 4MH4A 1KC81 1WCMI 2P6EA 2RC4A 3FYNA 4CYPA 3KI9A 4UEZA 3IC1A 4HNWB 3CXCZ 2Z11A 4HKFA 4NJRA 3VWEA 1NSLA 3CD61 2EK8A 4MMOA 5HXDA 2AKLA 4MONA 4OLLA 4UCPA 3CCR1 3DR8A 2FCKA 3S2DI 4A3LI 3J80f 4DK1A 3DLJA 2QECA 1VQ6Z 3R9EA 1QSOA 2FVGA 5CNPA 1PUAA 3MZLB 3PZJA 1VQM1 1GYTA 1TFIA 3PBBA 4FD4A 2B4DA 2JUBA 5C3EI 3BLNA 3KGQA
chains in the Genus database with same CATH topology
5LL6f 4QTTA 4A3EI 3B2YA 1AYEA 4IK2A 1VQ61 4NGQA 3G4SZ 2PJ9A 2Q4ZA 3SJFA 4R76A 3D66A 4P4EA 3KR5A 1VQP1 2V8KA 3G711 4MHZA 5AN9F 2PJ5A 2BOAA 1USPA 3GB0A 3S1NI 4NGMA 3PO3S 5JM6A 4A3JI 3HLPA 4RVFA 1VQ4Z 2V77A 4ZX9A 2E2HI 2W03A 2GREA 3KR4A 2GTHA 4NGSA 4UEFA 3VMIA 1YHQZ 5D1OB 3M3YI 2EK9A 3CMEZ 2BO9A 5LYFA 1F2PA 2OR4A 4YWYA 1KWMA 4ZY1A 1N2FA 3S9MA 3K7AI 1YIT1 2OTJ1 3CCM1 3FJUA 3PB8X 3HOWI 8CPAA 3NH8A 3SJGA 4F9UA 2QA4Z 1LFWA 2AFWA 2WB1A 4EWCA 5LYLA 3S1MI 4R7MA 4MCPA 5HVFA 4XX2A 4A3GI 3I55Z 4DUKA 2RHBA 2VUMI 1Y1WI 1RO0A 3CCS1 1QYPA 1R43A 4G1PA 4NBAA 3ISZA 2GLJA 2XEFA 1VLAA 2R7ZI 3HOZI 4PXEA 2PE3A 2QA41 2K3RA 3BHXA 3FX6A 2E2II 3FVLA 1VQO1 3K2KA 3KHXA 3F3FC 1FT7A 1S7MA 4E31A 2CTCA 3G6EZ 1ZLIA 1JWHC 2R92I 1YLOA 3WABA 5K8PA 3CXCY 4E33A 2O4HA 3BI1A 4ONWA 3CCUZ 3FH4A 3S2HI 4QTUA 1BPNA 2VL1A 1YI21 1N8R1 1CP6A 5HVGA 3VTNA 1TF9A 2QRDB 1QF8A 2GU2A 3D7FA 2JA5I 2VUGA 4RUHA 3IFEA 4FWUA 3U50C 1TWAI 3G4S1 4NOZA 2OTLZ 1EE3P 1Y0RA 3CPWY 3WC7A 1X0TA 3H8EA 3GTKI 4A3BI 5CPAA 4ZYQA 1CPSA 3FKII 2AFUA 2ZEEA 1TKFA 2IZ3A 2C6GA 3S9LA 4RS4A 2QLVB 4OKOA 1JJ2Y 1HEEA 3FECA 3VARA 1VQN1 4EFDA 5CBMA 3CCEZ 3TX8A 4HGYA 2DEAA 3NH5A 2Q51A 2G9DA 2PVWA 4PXDA 1LQLA 3MONA 5FLMI 1TF8A 2ZEOA 4NJQA 7CPAA 3DGVA 4O23A 3Q87A 1LANA 2JR6A 3FQQA 2PJAA 4CPAA 5LRKA 2RBLA 2C6CA 1M1K2 1NJI2 1ZG9A 2OOTA 3CC4Z 2O53A 3HOUI 1VIXA 3HKZA 4NGNA 4ZI6A 4DGLA 3S14I 5F09A 2CF4A 3PB9X 2RB7A 3B3TA 4MXUA 3B3WA 3JAMb 3QWUA 1VQ5Z 4A3MI 2BCOA 4P45A 2PJBA 2AFMA 2PJ2A 1YUAA 1K731 2PJ1A 3B3CA 1ARLA 4ZX8A 5A2Qf 3HOXI 3D7GA 1WIIA 1K8A1 2IJZA 1N8R2 1CG2A 1I6HI 3GLJA 1K732 3SI2A 5K8MA 4MCRA 3BI0A 4Y7NI 3S15I 3H8FA 3RZDI 3D9XA 1QMUA 3SJEA 1F2OA 3OW2Y 3GUXA 3D6WA 4TNUA 1FNOA 1XBUA 2PJ0A 3K9TA 1M1K1 2EWBA 2PJ3A 4B6ZA 2LFUA 1Q862 2PJ8A 1R3NA 4AXVA 3PO2I 3MRUA 1DTDA 1VQ9Z 3FF3A 1VQLZ 4BXXI 3T8WA 5IP7I 2Q43A 3I551 3RBUA 1Q7Y2 1DE4C 2PJ4A 4OC4A 5LYDA 4OIDA 2PJ7A 1Z2LA 3CT9A 4FAIA 1Q811 4A3FI 2AFXA 1VQNZ 2NVQI 5C4JI 1JQGA 1Y0YA 2RPRA 2VF1A 2V8GA 4UEEA 4A3II 4OIWA 3SJXA 4F8ZA 3WC6A 4UF4A 1R9TI 3D68A 1Z5RA 1F57A 3B3SA 4JZ0A 3PFEA 2M48A 2ZOGA 4A39A 4GM5A 3CCQ1 2F7VA 2OZKA 2BJOA 3NFZA 2JA8I 1IY7A 3CPWZ 1M4LA 2ANPA 1VQ81 5C44I 3CCJ1 2V8JA 1YJ9Z 1S72Z 4MD8A 5J1QA 4RVGA 3HOVI 4E32A 4OC2A 2H85A 4MD7A 3RAMA 1RTQA 4A94A 1VQKZ 3I07A 2F8HA 5D29A 3CCQZ 2OTL1 2RIQA 1YITZ 1CX8A 3CC2Z 3RZOI 3J81b 4NFRA 2JNYA 1YIJZ 5IT9f 3KIFA 4A38A 2AFZA 3CCJZ 2QJ8A 2R93I 1Y1VS 1I3QI 3GTLI 3J7A4 3VB9A 2R6MA 5D1OA 2E2JI 1Q821 3H3VJ 2I3CA 3H8GA 3IIBA 4NBDA 1TXRA 4W9YA 4UIAA 2ABZA 1X3ZA 3CCE1 1Y7EA 3B3VA 3KIHA 1RO2A 2F4OA 4HGZA 3CCSZ 3V7ZA 4DJLA 2JEWA 3GTQI 2RT9A 2G2KA 5A2Qb 2EGTA 3P5JB 4RV9A 2JS4A 2W04A 3I1UA 1VQ91 2B63I 4NBEA 3QNVA 2K5RA 4NB8A 1VQL1 1PFTA 3JAMf 4E2ZA 3GTMI 1PCAA 3CCRZ 2XEJA 4OC1A 1Q861 3G6E1 1QVGY 1LCPA 4NH1C 4A3DI 4P4JA 1ZH1A 3ISXA 1YHQ1 2ZAEB 1HDUA 2PIYA 3CME1 1DL6A 3BG1B 1ZLHA 4P10A 2AFSA 4MCQA 3V38A 3NA6A 4EWTA 1NSAA 2QKDA 2JBKA 3WC5A 1W2BZ 1QVFZ 3EEDA 3FEDA 4H2KA 3WT4A 3RZAA 3TDHB 4IAVA 1OBRA 1RNIA 5T67A 3S1QI 4BY1I 4BD9A 5FLXf 1Z01A 3BXMA 1BPMA 1ELMP 2GTIA 1K9M1 1K8A2 1VHEA 4X6AI 4OC3A 1VQK1 3B35A 2LIYA 1YJW1 1KQSY 2WYRA 3HUVA 5ELYA 4JYWA 2DE6A 5IB9A 3B7IA 1RO4A 4NGRA 4AYBA 1VQ71 4DYOA 3CMA1 4Q7AA 3KQZA 4P44A 4KSIA 4NB9A 3CCLZ 4TWEA 2J9AA 1P9NA 1M901 1CPXA 4PPZA 2V8DA 2PK7A 5CM2M 5IP9I 5LRJA 2RFHA 3IX0A 2NVXI 3H0GI 2JMOA 1Q7Y1 1X3WA 2HU9A 3MN8A 1QVGZ 5LRGA 1WW9A 3OW2Z 3CMAZ 1YJN1 5D1PA 1VQ41 4YU9A 1BAVA 4NBGA 1KQSZ 5T64A 4OC0A 2NVYI 1W2BY 4CL1A 1NP6A 4RVDA 1RQFA 4BBRI 2PMZA 4P4DA 1SFOI 4A3KI 3I4NI 4Y52I 4MHYA 3TE5B 1VQ7Z 1ZB8A 3CCMZ 1VHOA 3NDJA 3GTMS 4A3CI 3GKQA 4NBCA 2JA7I 2OOXB 3SI1A 1K83I 3CC71 3M4OI 2NVTI 3CQZI 4WWVA 2IMOA 3FMCA 1QQ9A 1YMEA 3D7DA 2NYQA 1BLLE 3TC8A 1LOKA 3CD6Z 4NBBA 1CBXA 4R8FA 4PXBA 4PQAA 3F3PC 3G71Z 1YUKA 2M6NA 1AMPA 2F4MA 4X2TA 4OMEA 3LWUA 4FBEA 3J80b 3CC41 1JJ2Z 5JGFA 2Y0SA 2PM9A 4P4IA 3L2NA 5IT9b 3CC7Z 1YJWZ 1Z8LA 3SI0A 2ZEPA 1PYTB 2AFOA 3N5FA 1ZB9A 1Y1VI 2OTJZ 3IO1A 3CCV1 1QVFY 2YU9I 2PJCA 4K3NA 1Q822 3CPXA 3VH9A 2PVVA 5DS0A 2CTBA 2V8HA 3PB4X 3IEHA 4ZY2A 2C6PA 1HDQA 3LMSA 2QYVA 3PO3I 2V8VA 2WAQA 2XEGA 4A93I 4F9VA 5K8OA 2DE7A 2JBJA 3PB7X 1XJOA 1NUIA 4MHPA 1XFOA 3CC21 3KL9A 2QREB 2YADA 4P6YA 1K9M2 3MZKB 1XMBA 3HOYI 5I4MA 1XRYA 1YIJ1 3IWWA 2DE5A 1TKJA 3S1RI 1VQPZ 4BY7I 1LAMA 2PJ6A 3PB6X 1RLYA 2QRCB 4X3RA 2HF1A 2V8IA 4E2YA 4MRIA 3GTOI 1ZG7A 6CPAA 3IJ3A 1NJI1 2QR1B 1UWYA 1YW4A 1YI2Z 3VMGA 3FQMA 5HVHA 4Z65A 3FEEA 1KRLA 4R6TA 3VMHA 2ZOFA 4ZY0A 1Q812 5FLXb 2P3YA 4OP4A 3J81f 4NBFA 4P4BA 3I561 2WZNA 1TKHA 4S1TA 1VQ8Z 4NGPA 1VQMZ 1USPB 1TWHI 3KHZA 3CCL1 2C1CA 5D8NA 1I50I 1Q7LA 2QEXZ 5LYIA 2POKA 3S16I 1Z03A 4MD9A 3KZWA 4A37A 1ML8A 4E2WA 3EERA 5C4XI 4RVHA 1YSJA 2NSMA 2J6AA 2PRQA 4E30A 2GLFA 3PEIA 1M902 2ZEMA 3CCVZ 3S17I 3D67A 4X8IA 5THWA 1YJNZ 4MH4A 1KC81 3BG0B 1WCMI 4OC5A 4HH4A 1CP7A 3KQXA 1TWCI 3GTPI 4BBSI 2ZEFA 5JH9A 2KPIA 3I4MI 4NGTA 3GTJI 3KI9A 3NH4A 4UEZA 3IC1A 2QEX1 3S9NA 2ZEGA 1IGBA 3CCU1 3D7HA 3PRTA 3JRUA 2ZEHA 3CXCZ 2IQ6A 3NDIA 2JA6I 3PFOA 2ZENA 1VQ51 1KD11 1ZG8A 3VATA 1LAPA 4NJRA 1ELLP 2PCUA 2ZELA 3T4NB 3CD61 2EK8A 3IFUA 4IHMA 2AKLA 4MONA 3LUSA 5T6BA 2CIJA 3CDXA 4MMOA 5HXDA 4P4FA 3CCR1 1KD12 5K8NA 2P28A 4DQYB 3S2DI 3GCFA 4A3LI 2IZ4A 2KI7B 3J80f 4DK1A 4FUUA 3DLJA 4NBHA 3CPAA 2HB6A 2ZEDA 1KC82 4PXCA 4EMEA 1VQ6Z 4UIBA 4E2XA 1TWFI 1YJ91 1S721 4WJBA 3PBEA 1TWGI 3D4UA 1VGYA 2PIZA 2FVGA 4MHNA 3GTGI 3KASA 3I56Z 4LQGA 2QVPA 3ESWA 3MZLB 2E9HA 1VQM1 1GYTA 2HC9A 1TFIA 1VQOZ 3PBBA 1H8LA 2OOYB 1YW6A 1Z02A 3IF8A 2XEIA 2JUBA 1L1OC 5C3EI 4MCSA 1ARMA 3KGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2Y A;  1AYE A;  4IK2 A;  4NGQ A;  2PJ9 A;  2Q4Z A;  3SJF A;  4R76 A;  3D66 A;  4P4E A;  3KR5 A;  4MHZ A;  2PJ5 A;  2BOA A;  3GB0 A;  4NGM A;  5JM6 A;  3HLP A;  4ZX9 A;  2V77 A;  2GRE A;  3KR4 A;  4NGS A;  4UEF A;  2EK9 A;  5LYF A;  2BO9 A;  1F2P A;  2OR4 A;  4YWY A;  1KWM A;  4ZY1 A;  3S9M A;  3PB8 X;  3FJU A;  8CPA A;  3NH8 A;  3SJG A;  4F9U A;  1LFW A;  2AFW A;  5LYL A;  4R7M A;  4MCP A;  5HVF A;  4DUK A;  1R43 A;  4G1P A;  3ISZ A;  2GLJ A;  2XEF A;  4PXE A;  2PE3 A;  3BHX A;  3FX6 A;  3FVL A;  3K2K A;  3KHX A;  1FT7 A;  2CTC A;  1ZLI A;  1YLO A;  3WAB A;  5K8P A;  2O4H A;  3BI1 A;  4ONW A;  3FH4 A;  1BPN A;  2VL1 A;  1CP6 A;  5HVG A;  1TF9 A;  2GU2 A;  3D7F A;  4RUH A;  3IFE A;  4FWU A;  1EE3 P;  1Y0R A;  3WC7 A;  3H8E A;  5CPA A;  4ZYQ A;  1CPS A;  2AFU A;  2ZEE A;  1TKF A;  2C6G A;  3S9L A;  4OKO A;  1HEE A;  3FEC A;  3VAR A;  4EFD A;  5CBM A;  3TX8 A;  2DEA A;  3NH5 A;  2Q51 A;  2G9D A;  2PVW A;  4PXD A;  1TF8 A;  2ZEO A;  4NJQ A;  7CPA A;  3DGV A;  4O23 A;  1LAN A;  4CPA A;  2PJA A;  5LRK A;  2C6C A;  1ZG9 A;  2OOT A;  2O53 A;  1VIX A;  4NGN A;  4ZI6 A;  5F09 A;  2CF4 A;  3PB9 X;  2RB7 A;  3B3T A;  4MXU A;  3B3W A;  4P45 A;  2BCO A;  2PJB A;  2AFM A;  2PJ2 A;  2PJ1 A;  3B3C A;  1ARL A;  4ZX8 A;  3D7G A;  2IJZ A;  1CG2 A;  3GLJ A;  3SI2 A;  5K8M A;  4MCR A;  3BI0 A;  3H8F A;  3SJE A;  1QMU A;  1F2O A;  3GUX A;  4TNU A;  1FNO A;  1XBU A;  2PJ0 A;  3K9T A;  2EWB A;  2PJ3 A;  4B6Z A;  2PJ8 A;  4AXV A;  1R3N A;  3MRU A;  1DTD A;  3FF3 A;  3T8W A;  2Q43 A;  3RBU A;  2PJ4 A;  1DE4 C;  4OC4 A;  5LYD A;  4OID A;  2PJ7 A;  1Z2L A;  3CT9 A;  4FAI A;  2AFX A;  1Y0Y A;  1JQG A;  4UEE A;  3SJX A;  2V8G A;  4OIW A;  4F8Z A;  3WC6 A;  4UF4 A;  3D68 A;  1Z5R A;  1F57 A;  3B3S A;  4JZ0 A;  3PFE A;  2ZOG A;  4A39 A;  4GM5 A;  2F7V A;  3NFZ A;  1IY7 A;  1M4L A;  2ANP A;  5J1Q A;  4OC2 A;  3RAM A;  1RTQ A;  4A94 A;  2F8H A;  5D29 A;  1CX8 A;  4NFR A;  4A38 A;  2AFZ A;  2QJ8 A;  2I3C A;  3H8G A;  3IIB A;  1TXR A;  4W9Y A;  4UIA A;  2ABZ A;  1Y7E A;  3B3V A;  3V7Z A;  4DJL A;  2JEW A;  3I1U A;  3QNV A;  1PCA A;  2XEJ A;  4OC1 A;  1LCP A;  4P4J A;  3ISX A;  2PIY A;  1HDU A;  1ZLH A;  4P10 A;  2AFS A;  4MCQ A;  3V38 A;  3NA6 A;  4EWT A;  1NSA A;  2JBK A;  3WC5 A;  3FED A;  3WT4 A;  4H2K A;  3RZA A;  4IAV A;  1OBR A;  4BD9 A;  3BXM A;  1BPM A;  1ELM P;  1VHE A;  4OC3 A;  3B35 A;  2WYR A;  3HUV A;  5ELY A;  4JYW A;  5IB9 A;  3B7I A;  4NGR A;  4DYO A;  4Q7A A;  3KQZ A;  4P44 A;  4KSI A;  4TWE A;  2J9A A;  4PPZ A;  1CPX A;  2V8D A;  5LRJ A;  2RFH A;  3MN8 A;  5LRG A;  4YU9 A;  1BAV A;  4OC0 A;  4P4D A;  4MHY A;  1VHO A;  3SI1 A;  4WWV A;  2IMO A;  3FMC A;  1QQ9 A;  1YME A;  3D7D A;  2NYQ A;  1BLL E;  3TC8 A;  1LOK A;  1CBX A;  4R8F A;  4PXB A;  4PQA A;  1AMP A;  4X2T A;  4OME A;  3LWU A;  4FBE A;  5JGF A;  4P4I A;  3L2N A;  1Z8L A;  3SI0 A;  2ZEP A;  1PYT B;  2AFO A;  3N5F A;  3IO1 A;  2PJC A;  4K3N A;  3CPX A;  3VH9 A;  2PVV A;  5DS0 A;  2CTB A;  2V8H A;  3PB4 X;  3IEH A;  4ZY2 A;  2C6P A;  1HDQ A;  3LMS A;  2QYV A;  2V8V A;  2XEG A;  4F9V A;  5K8O A;  2JBJ A;  3PB7 X;  1XJO A;  4MHP A;  1XFO A;  3KL9 A;  4P6Y A;  1XMB A;  5I4M A;  1XRY A;  3IWW A;  1TKJ A;  2PJ6 A;  1LAM A;  3PB6 X;  4X3R A;  4MRI A;  1ZG7 A;  6CPA A;  3IJ3 A;  1UWY A;  1YW4 A;  5HVH A;  4Z65 A;  3FEE A;  4R6T A;  2ZOF A;  4ZY0 A;  4OP4 A;  4P4B A;  2WZN A;  1TKH A;  4NGP A;  3KHZ A;  2C1C A;  5D8N A;  5LYI A;  1Q7L A;  2POK A;  3KZW A;  4A37 A;  1YSJ A;  2NSM A;  2PRQ A;  2GLF A;  3PEI A;  2ZEM A;  3D67 A;  4X8I A;  5THW A;  4OC5 A;  1CP7 A;  3KQX A;  2ZEF A;  5JH9 A;  4NGT A;  3KI9 A;  3NH4 A;  4UEZ A;  3IC1 A;  3S9N A;  2ZEG A;  1IGB A;  3D7H A;  3PRT A;  3JRU A;  2ZEH A;  2IQ6 A;  3PFO A;  2ZEN A;  1ZG8 A;  3VAT A;  1LAP A;  4NJR A;  1ELL P;  2PCU A;  2ZEL A;  2EK8 A;  4MMO A;  4IHM A;  2CIJ A;  5HXD A;  3CDX A;  4P4F A;  5K8N A;  4FUU A;  3DLJ A;  3CPA A;  2HB6 A;  2ZED A;  4PXC A;  4EME A;  4UIB A;  4WJB A;  3PBE A;  3D4U A;  1VGY A;  2PIZ A;  2FVG A;  4MHN A;  3KAS A;  4LQG A;  2QVP A;  1GYT A;  2HC9 A;  3PBB A;  1H8L A;  1YW6 A;  2XEI A;  4MCS A;  1ARM A;  3KGQ A; 
#chains in the Genus database with same CATH topology
 4A3E I;  1WZN A;  1VQ6 1;  4NGQ A;  2JEV A;  2PJ9 A;  2Q4Z A;  3SJF A;  3D66 A;  3KR5 A;  1VQP 1;  3R96 A;  2HQY A;  2V8K A;  1QXF A;  4MHZ A;  5F48 A;  1USP A;  3PO3 S;  3KR4 A;  3TOB A;  2BO9 A;  1F2P A;  4KLW A;  2CXA A;  1N2F A;  3K7A I;  3TO9 A;  4NCZ A;  1XE4 A;  4A32 A;  3SJG A;  4F9U A;  2QA4 Z;  2AFW A;  3N7Z A;  5KTA A;  4DUK A;  4KOS A;  2AE6 A;  2VUM I;  3RNZ A;  4G1P A;  4JXR A;  3ISZ A;  3BHX A;  2KCW A;  3D2L A;  1VQO 1;  3FNC A;  4E31 A;  2CTC A;  4KOW A;  4NEX A;  5AG4 A;  2R92 I;  1YLO A;  4MFK A;  3CXC Y;  2O4H A;  2ATR A;  3CCU Z;  4UA3 A;  3QAH A;  1YI2 1;  1CP6 A;  1QF8 A;  4RUH A;  1TWA I;  3G4S 1;  4IUS A;  4NOZ A;  2OTL Z;  1EE3 P;  4A3B I;  2JDD A;  1CPS A;  1TKF A;  2H5M A;  4OKO A;  1HEE A;  3FEC A;  3EFA A;  4PXD A;  3DSB A;  1LQL A;  1B87 A;  3TT2 A;  4O23 A;  1LAN A;  3FQQ A;  2PJA A;  3F8K A;  4CPA A;  5FVJ A;  3CC4 Z;  4UWJ A;  3IWG A;  2G0B A;  2CF4 A;  3B3T A;  4MXU A;  4R3K A;  3JAM b;  1Y7R A;  2I79 A;  2PJ1 A;  1Z4R A;  4L89 A;  3JTK A;  1S5K A;  4B5P A;  2EUI A;  4II9 A;  2ZW7 A;  1N8R 2;  2YGW A;  4ZGY B;  2REF A;  3H8F A;  1QMU A;  1F2O A;  2VPZ A;  4KOV A;  4B12 A;  3W91 A;  4TNU A;  1MJA A;  1XIX A;  2K5T A;  3TFY A;  4AXV A;  1DTD A;  5HH1 A;  1I21 A;  4BXX I;  3T8W A;  5C88 A;  5IP7 I;  1XEB A;  3RO0 A;  4B13 A;  3D3S A;  4FAI A;  4A3F I;  1JQG A;  3SJX A;  3WC6 A;  4CRZ B;  3B3S A;  3PFE A;  4A39 A;  4B5P B;  2ANP A;  2Q0Y A;  3CCJ 1;  1YJ9 Z;  5A27 A;  4RVG A;  2B4B A;  1RTQ A;  2Q44 A;  5D29 A;  2OTL 1;  3CCJ Z;  1KZF A;  2ZXV A;  3R9G A;  3GTL I;  1Q82 1;  4EVY A;  2Q7B A;  3GTQ I;  1Q2C A;  2I00 A;  5AG5 A;  4RV9 A;  4DNC A;  2W04 A;  1VQL 1;  1PFT A;  2VBQ A;  4B11 A;  3WR7 A;  4AVC A;  1LCP A;  4A3D I;  3CME 1;  3NA6 A;  4KOR A;  2PR1 A;  4PSW A;  5F46 A;  1Z01 A;  4J3G A;  4NSQ A;  1V0C A;  1VHE A;  4OC3 A;  3RYO A;  1MJB A;  4L8A A;  4E2A A;  2WYR A;  4JYW A;  2DE6 A;  5IB9 A;  3IU2 A;  2PC1 A;  1VQ7 1;  4DYO A;  4KSI A;  2PK7 A;  5IP9 I;  4M6H A;  3IX0 A;  1Q7Y 1;  1X3W A;  4GXH A;  1WW9 A;  5D1P A;  1VQ4 1;  1BAV A;  1Q2Y A;  1YGH A;  4RVD A;  1SFO I;  4MHY A;  2FS5 A;  1VQ7 Z;  1ZB8 A;  1VHO A;  4XPD C;  4A3C I;  2JA7 I;  4WWV A;  1YME A;  1A2Z A;  4UBR A;  3GKR A;  1AA6 A;  2BUE A;  1AMP A;  4OME A;  1KUY A;  2O28 A;  2WPX A;  3KKW A;  4PK2 A;  5C82 A;  1Z4E A;  3SI0 A;  4Y49 C;  3N5F A;  2OTJ Z;  1QVF Y;  4YGO A;  1Q82 2;  4A31 A;  4PV6 A;  3VH9 A;  5DS0 A;  3LAC A;  4ZY2 A;  1HDQ A;  5EBV A;  4AB7 A;  2PSW A;  2XEG A;  4A93 I;  4A33 A;  2DE7 A;  2FIW A;  4MHP A;  3CXQ A;  3W6X A;  2JLM A;  2QRE B;  4C68 A;  2PJ6 A;  2YND A;  3PB6 X;  2VQY A;  2V8I A;  1ZG7 A;  4R6T A;  5FLX b;  5KTC A;  2P3Y A;  4P4B A;  1B6B A;  4NGP A;  1VQM Z;  2C27 A;  3KHZ A;  3CCL 1;  1Q7L A;  3S16 I;  3EER A;  4RVH A;  3CCV Z;  2Z3L A;  4OC5 A;  1CP7 A;  5GCN A;  2KPI A;  4NGT A;  3NH4 A;  2Z3M A;  3D7H A;  4KOY A;  2IQ6 A;  2JA6 I;  1KD1 1;  3VAT A;  2PCU A;  4IHM A;  3CDX A;  3F5B A;  4P4F A;  1KD1 2;  4CRY B;  3V8I A;  2PRB A;  2IZ4 A;  2IL4 A;  4CGL A;  4FUU A;  1KC8 2;  4PXC A;  4UIB A;  1TWF I;  2V45 A;  2PIZ A;  4MHN A;  3I56 Z;  4U9Y A;  2HC9 A;  1N71 A;  1H8L A;  2OOY B;  1YW6 A;  3IF8 A;  2XEI A;  3P2F A;  1L1O C;  1GHE A;  4MCS A;  1ARM A;  2AJ6 A;  4KOX A;  2FIA A;  3CXS A;  4R76 A;  4P4E A;  3G71 1;  5AN9 F;  3GB0 A;  5JM6 A;  2W03 A;  2GRE A;  4CAX A;  1YHQ Z;  5D1O B;  3M3Y I;  2DPS A;  2EK9 A;  2OR4 A;  4YWY A;  4ZY1 A;  3PB8 X;  3CCM 1;  4MJ8 A;  3D8P A;  1LFW A;  1Y9W A;  2WB1 A;  4EWC A;  3S1M I;  4R7M A;  1M4G A;  2VZZ A;  2BSW A;  1QYP A;  1R43 A;  1VKC A;  4AG9 A;  2XEF A;  2R7Z I;  4XPD B;  4PXE A;  3IWE A;  4BBH A;  2K3R A;  2E2I I;  3FVL A;  3K2K A;  4YRH A;  3G6E Z;  1ZLI A;  4A30 A;  4ONW A;  4MY3 A;  2FE7 A;  4QTU A;  3I9S A;  1TF9 A;  2JA5 I;  2VUG A;  3U50 C;  4RI1 A;  2PR8 A;  3CPW Y;  1X0T A;  5CPA A;  3SXN A;  2ZEE A;  2R98 A;  2QLV B;  3VAR A;  1VQN 1;  1VHS A;  3NH5 A;  2G9D A;  2PVW A;  3FIX A;  1Z8T A;  3MON A;  4XPL A;  1TF8 A;  4NJQ A;  7CPA A;  3DGV A;  5LRK A;  2VXK A;  1M1K 2;  1ZG9 A;  2OOT A;  2O53 A;  5F09 A;  1IU8 A;  1MJ9 A;  1VQ5 Z;  1K73 1;  2GE3 A;  4ZX8 A;  4C2X A;  4CGO A;  3GY9 A;  3HOX I;  2ZW6 A;  1WII A;  1K8A 1;  2IJZ A;  1I6H I;  5K8M A;  4Y7N I;  3S15 I;  3NE8 A;  3SJE A;  3D9X A;  1FY7 A;  3TOA A;  2Z3N A;  2PJ0 A;  4M3S A;  1M1K 1;  2EWB A;  2G3A A;  2PJ8 A;  1R3N A;  3PO2 I;  1VQ9 Z;  3FF3 A;  4C7I A;  3GYA A;  1CM0 A;  2PJ4 A;  5LYD A;  1Z2L A;  2Z3O A;  4UF4 A;  1F57 A;  2M48 A;  2ZOG A;  3G3S A;  2BJO A;  3NFZ A;  2JA8 I;  1VQ8 1;  2V8J A;  1M1D A;  1S72 Z;  3BJ8 A;  5J1Q A;  5G1Z A;  3S6H A;  2H85 A;  4MD7 A;  3QB8 A;  3K9U A;  4NXY A;  3R95 A;  4QC6 A;  4NFR A;  3KIF A;  2AFZ A;  1Y1V S;  1SQH A;  4XNH C;  3VB9 A;  2YNE A;  3H3V J;  2I3C A;  3H8G A;  1KUX A;  4UIA A;  1YQE A;  5A2Q b;  3P5J B;  1RO5 A;  3E0K A;  4KOT A;  3I1U A;  2B63 I;  1M4I A;  3GTM I;  3CCR Z;  1QVG Y;  2QIR A;  4CGP A;  4NH1 C;  2CNM A;  3BG1 B;  1ZLH A;  4P10 A;  2QKD A;  2JBK A;  4MHD A;  3RZA A;  1PU9 A;  2FT0 A;  3B8G A;  3LOD A;  4XNH B;  1OBR A;  1RNI A;  5T67 A;  3QAY A;  3S1Q I;  3S6F A;  4BY1 I;  1NMT A;  1BPM A;  4ZBG A;  4X6A I;  1VQK 1;  4FD6 A;  1YJW 1;  1KQS Y;  2J8M A;  4NGR A;  4Q7A A;  3KQZ A;  3GIU A;  3CCL Z;  4TWE A;  1CPX A;  2BL1 A;  2V8D A;  2B3V A;  5LRJ A;  2GAN A;  4U9Z A;  4F6A A;  4BIN A;  2NVX I;  2JMO A;  3MN8 A;  4KSA A;  5LRG A;  3OW2 Z;  3CMA Z;  4YU9 A;  4MFQ A;  4CL1 A;  1QST A;  3I4N I;  4Y52 I;  4A95 A;  3DNS A;  4E8O A;  3C26 A;  3GKQ A;  2HV2 A;  3SI1 A;  1IYK A;  1IOF A;  1QQ9 A;  3TC8 A;  4F0X A;  3CD6 Z;  3OWC A;  3D2P A;  4M6G A;  3F3P C;  2CNT A;  1S7K A;  3J80 b;  3CC4 1;  2PM9 A;  4P4I A;  1PYT B;  2AFO A;  3D2M A;  1ZB9 A;  5BWA B;  2VPX A;  2YU9 I;  2PJC A;  3BJ7 A;  3IEH A;  3LMS A;  3TTH A;  2WAQ A;  2IV2 X;  1XF8 A;  1XFO A;  3TE4 A;  5DWM A;  3KL9 A;  3H4Q A;  4P6Y A;  4MFJ A;  3MZK B;  3HOY I;  1XRY A;  1YIJ 1;  5H86 A;  4BY7 I;  1RLY A;  2QRC B;  3TO6 A;  4R87 A;  4X3R A;  3MGD A;  4MRI A;  6CPA A;  2QR1 B;  1UWY A;  4HPS A;  5HVH A;  1FDO A;  1KRL A;  4AG7 A;  3VMH A;  2JIQ A;  1U6M A;  4NBF A;  3I56 1;  2EBJ A;  1S7F A;  1USP B;  1TWH I;  2Q4V A;  1Z8W A;  5D8N A;  5LYI A;  2POK A;  1Z03 A;  3KZW A;  1ML8 A;  5C4X I;  2NSM A;  1WK4 A;  3S17 I;  1WWZ A;  3D67 A;  1YJN Z;  3BG0 B;  4HH4 A;  3KQX A;  1TWC I;  3GTP I;  2ZEF A;  5JH9 A;  4K30 A;  3IR7 A;  3GTJ I;  5ISV A;  1IYL A;  4H6Z A;  2ZEG A;  1IGB A;  3CCU 1;  4FD5 A;  3PRT A;  4JJX A;  4CAV A;  3PFO A;  1ZG8 A;  1LAP A;  4RN7 A;  3T4N B;  2CNS A;  2CIJ A;  5T6B A;  5K8N A;  2P28 A;  1M4D A;  1QSM A;  5G21 A;  2A4N A;  4NBH A;  2ZED A;  4KUB A;  1YJ9 1;  4C7H A;  1TWG I;  3D4U A;  1VGY A;  5H84 A;  4LQG A;  2QVP A;  3ESW A;  2E9H A;  2CY2 A;  2R7H A;  1YX0 A;  1YK3 A;  2JDC A;  1Z02 A;  1UFH A;  1BOB A;  1S7L A;  1YVK A;  1FDI A;  5LL6 f;  4QTT A;  2NAP A;  1YR0 A;  3HLP A;  4ZX9 A;  2V77 A;  3G8W A;  4CAE A;  3TO7 A;  1KWM A;  3S9M A;  1YIT 1;  3FJU A;  1Z9U A;  2GFQ A;  5LYL A;  4MCP A;  4KVM E;  3I55 Z;  2RHB A;  1Y1W I;  1RO0 A;  3CCS 1;  2VEZ A;  4NBA A;  4C2Y A;  2G3T A;  1QSN A;  1VLA A;  3HOZ I;  2PE3 A;  3KHX A;  3F3F C;  1FT7 A;  1JWH C;  3WAB A;  5K8P A;  2YNC A;  4E33 A;  5A28 A;  2NMT A;  1N8R 1;  4KZT A;  3VTN A;  2WPW A;  2GU2 A;  3D7F A;  2JIP A;  4FWU A;  4OAE A;  1Y0R A;  1YRE A;  3H8E A;  1P0H A;  3FKI I;  4CGM A;  2AFU A;  2IZ3 A;  2C6G A;  2FXF A;  1JJ2 Y;  5CBM A;  3CCE Z;  3TX8 A;  4HGY A;  2DEA A;  2Q51 A;  1LRZ A;  1L0C A;  5FLM I;  1M44 A;  4UCN A;  3Q87 A;  2JR6 A;  4JLY A;  2RBL A;  2C6C A;  4ORF A;  2OZU A;  2RB7 A;  3B3W A;  4A3M I;  2BCO A;  2PJB A;  2AFM A;  2PJ2 A;  1ARL A;  5A2Q f;  5G20 A;  1ZO0 A;  1CG2 A;  3SI2 A;  3BI0 A;  1TIQ A;  3OW2 Y;  3D6W A;  3VWD A;  4B6Z A;  4B10 A;  1Q86 2;  3MRU A;  2YNC C;  2Q43 A;  3I55 1;  4Q36 A;  4OC4 A;  1DE4 C;  4OID A;  2PJ7 A;  2D4O A;  3CT9 A;  1Q81 1;  2AFX A;  1VQN Z;  2NVQ I;  1Y0Y A;  4UEE A;  2RPR A;  4A3I I;  4F8Z A;  3D68 A;  1Z5R A;  4JZ0 A;  2F7V A;  1M4L A;  1K4J A;  4U5Y A;  2Q7S A;  5DWN A;  2FL4 A;  4OC2 A;  4E32 A;  5J8C A;  3RAM A;  2F5I A;  1VQK Z;  3CCQ Z;  3CC2 Z;  3RZO I;  1I3Q I;  3J7A 4;  2R6M A;  5D1O A;  4Q38 A;  4NBD A;  1TXR A;  3CCE 1;  1Y7E A;  3B3V A;  4HGZ A;  3R1K A;  2RT9 A;  3DR6 A;  3T9Y A;  2G2K A;  1BO4 A;  2EGT A;  2JS4 A;  1VQ9 1;  4NBE A;  3QNV A;  2K5R A;  4E2Z A;  2X7B A;  1PCA A;  2XEJ A;  4OC1 A;  1Q86 1;  2DXQ A;  4P4J A;  1YHQ 1;  2ZAE B;  1DL6 A;  2AFS A;  3V38 A;  4H89 A;  1W2B Z;  2JIM A;  2Z3P A;  3FED A;  4H2K A;  3FB3 A;  4MFZ A;  1I12 A;  3BXM A;  4MBU A;  1K9M 1;  1K8A 2;  3B35 A;  5F49 A;  2LIY A;  3B7I A;  4AYB A;  3CMA 1;  4E0A A;  4AVB A;  2RFH A;  2ARH A;  3H0G I;  1QVG Z;  4H6U A;  2QML A;  5JPH A;  4NBG A;  3IU1 A;  3CZX A;  1KQS Z;  1JWQ A;  4OC0 A;  1W2B Y;  4BBR I;  1RQF A;  2PMZ A;  3EXN A;  4P4D A;  4A3K I;  1YLE A;  2OZH A;  3TE5 B;  3CCM Z;  3LD2 A;  2LEX A;  4NBC A;  1K83 I;  3CC7 1;  3M4O I;  2NVT I;  2IMO A;  2NYQ A;  1BLL E;  4ONU A;  1LOK A;  4R8F A;  4PXB A;  3S6K A;  1YUK A;  2M6N A;  2F4M A;  4FD7 A;  4FBE A;  1JJ2 Z;  3CC7 Z;  1YJW Z;  1Z8L A;  3IO1 A;  2P6F A;  4X5K A;  3DDD A;  4K3N A;  4JD6 A;  2PVV A;  2V8H A;  1Y8C A;  2C6P A;  1CJW A;  5IB0 A;  2QYV A;  4PK3 A;  3PO3 I;  4KOU A;  5F47 A;  4UCM A;  4GS4 A;  4F9V A;  2ZW4 A;  4CGN A;  1XJO A;  1MK4 A;  1P4N A;  2R1I A;  2DE5 A;  3S1R I;  1LAM A;  2FSR A;  2HF1 A;  3IJ3 A;  1NJI 1;  3PGP A;  1YI2 Z;  3VMG A;  4Z65 A;  3FEE A;  4QB9 A;  2ZOF A;  2E7Z A;  4ZY0 A;  1Q81 2;  4OP4 A;  3J81 f;  1TKH A;  1VQ8 Z;  5AG6 A;  2C1C A;  1I50 I;  3IGR A;  4MD9 A;  4A37 A;  4E2W A;  1YSJ A;  2PRQ A;  3PEI A;  1M90 2;  1J4J A;  5I0C A;  5THW A;  2EVN A;  4BBS I;  3I4M I;  4UWI A;  2QEX 1;  3S9N A;  3JRU A;  2ZEH A;  4M6I A;  3NDI A;  2OB0 A;  2ZEN A;  3FBU A;  1VQ5 1;  3EC4 A;  1ELL P;  2ZEL A;  3IFU A;  2OU2 A;  3LUS A;  2PQ8 A;  4DQY B;  3GCF A;  2KI7 B;  2OZG A;  3CPA A;  2HB6 A;  4EME A;  3FXT A;  4E2X A;  5AGE A;  1S72 1;  4WJB A;  1IID A;  3PBE A;  2Z0Z A;  4I49 A;  3GTG I;  3KAS A;  2JIO A;  4HNX B;  1VQO Z;  2WSA A;  3ZZI A;  4QBJ A;  1I1D A;  3EO4 A;  4MY0 A;  3FRM A;  3B2Y A;  1AYE A;  4IK2 A;  3G4S Z;  2PJ5 A;  2BOA A;  3S1N I;  4NGM A;  4A3J I;  4RVF A;  1VQ4 Z;  2VZY A;  2E2H I;  2GTH A;  4NGS A;  4UEF A;  3VMI A;  3CME Z;  5LYF A;  2GIV A;  1SIW A;  5IV0 A;  2OTJ 1;  3HOW I;  8CPA A;  3NH8 A;  2REE A;  2B58 A;  4LQ6 A;  5HVF A;  4XX2 A;  4A3G I;  1OZP A;  4OAD A;  2EO8 A;  2GLJ A;  4IF5 A;  4F0Y A;  2QA4 1;  3FX6 A;  4QVT A;  1S7M A;  4CAW A;  2P6G A;  5AG7 A;  1S7N A;  3BI1 A;  3FH4 A;  3S2H I;  3A9L A;  1BPN A;  2VL1 A;  3R9F A;  4CYO A;  5HVG A;  2QRD B;  2JIR A;  1IOI A;  2P0W A;  4LX9 A;  2Q4Y A;  3IFE A;  1Z8X A;  3WC7 A;  3GTK I;  3SHP A;  2J8R A;  4ZYQ A;  4KSF A;  3S9L A;  4RS4 A;  5EMI A;  4QUS A;  3I3G A;  2VPW A;  4EFD A;  2ZEO A;  5JQ4 A;  3F0A A;  1NJI 2;  3HOU I;  1VIX A;  3HKZ A;  4NGN A;  4CYQ A;  4ZI6 A;  4DGL A;  3S14 I;  4R57 A;  3PB9 X;  5G22 A;  3QWU A;  4P45 A;  1YUA A;  4KVO E;  3B3C A;  4JWP A;  5J8F A;  3D7G A;  1QSR A;  2BEI A;  3GLJ A;  1K73 2;  4MCR A;  3RZD I;  3GUX A;  2ZPA A;  5E96 A;  1FNO A;  1XBU A;  3PP9 A;  3K9T A;  2PJ3 A;  2LFU A;  3ZJ0 A;  2Q04 A;  1VQL Z;  3RBU A;  1Q7Y 2;  4AVA A;  5C4J I;  4XPK A;  2VF1 A;  2V8G A;  4OIW A;  4B14 A;  1R9T I;  4JXQ A;  4M85 A;  4GM5 A;  3CCQ 1;  2OZK A;  1IY7 A;  3CPW Z;  5HMN A;  1X10 A;  1Y9K A;  5C44 I;  2AYD A;  5EC4 A;  4MD8 A;  4MFL A;  3HOV I;  1NE9 A;  4B5O A;  4A94 A;  4UFX A;  1YVO A;  3I07 A;  2F8H A;  2WUU A;  3T90 A;  4CAF A;  2RIQ A;  1YIT Z;  1CX8 A;  3J81 b;  2JNY A;  1YIJ Z;  5IT9 f;  4MI4 A;  4A2Z A;  4A38 A;  2QJ8 A;  2R93 I;  2E2J I;  3IIB A;  3W6S A;  4W9Y A;  2ABZ A;  1X3Z A;  4CS0 B;  3KIH A;  1RO2 A;  2F4O A;  4R3L A;  3CCS Z;  3V7Z A;  4DJL A;  2JEW A;  2VI7 A;  3UY5 A;  1WJ2 A;  2Z10 A;  4NB8 A;  3JAM f;  3NE7 A;  4RS2 A;  3JVN A;  3G6E 1;  1ZH1 A;  2B4D B;  3ISX A;  2PIY A;  3JUW A;  1HDU A;  4MCQ A;  1RXT A;  4EWT A;  1NSA A;  3WC5 A;  1QVF Z;  3EED A;  3WT4 A;  3TDH B;  4IAV A;  1ON0 A;  2HUZ A;  4BD9 A;  5FLX f;  1ELM P;  2GTI A;  4KLV A;  2ODF A;  2VPY A;  3HUV A;  5ELY A;  1RO4 A;  4UFW A;  4KUA A;  4P44 A;  4NB9 A;  2J9A A;  1P9N A;  1M90 1;  4PPZ A;  3EY5 A;  5CM2 M;  4BMH A;  2HU9 A;  1YJN 1;  5T64 A;  2J8N A;  1R57 A;  2NVY I;  1NP6 A;  2Y0M A;  3S6G A;  2R8V A;  3NDJ A;  3TCV A;  2ZW5 A;  3GTM S;  2DF5 A;  2OOX B;  3CQZ I;  3FMC A;  3D7D A;  4HNY B;  1Q16 A;  4NBB A;  1CBX A;  3P2H A;  4PQA A;  3G71 Z;  2B3U A;  4X2T A;  4KVX A;  3LWU A;  5JGF A;  2Y0S A;  3L2N A;  5IT9 b;  2ZEP A;  1Y1V I;  2B5G A;  3CCV 1;  3CPX A;  3SXO A;  4PSX A;  4YFJ A;  2CTB A;  3PB4 X;  1S60 A;  1XOV A;  2V8V A;  5IX3 A;  2Z3K A;  1KUV A;  5K8O A;  2JBJ A;  3PB7 X;  1NUI A;  4CYN A;  3CC2 1;  2YAD A;  1K9M 2;  1XMT A;  1AUG A;  1XMB A;  5I4M A;  2D4P A;  2B5G B;  3IWW A;  5KTD A;  4LUA A;  1TKJ A;  1VQP Z;  1Q2D A;  2DPT A;  4E2Y A;  3GTO I;  1IB1 E;  2V3V A;  1YW4 A;  4Y49 B;  3FQM A;  1X12 A;  4MFP A;  4KS9 A;  4UFV A;  3CXP A;  2WZN A;  4S1T A;  2PDO A;  1IIC A;  3H5Z A;  4R9M A;  2QEX Z;  4C2Z A;  2OH1 A;  4NF1 A;  2J6A A;  4E30 A;  2GLF A;  1S3Z A;  2ZEM A;  4X8I A;  4MH4 A;  1KC8 1;  1WCM I;  2P6E A;  2RC4 A;  3FYN A;  4CYP A;  3KI9 A;  4UEZ A;  3IC1 A;  4HNW B;  3CXC Z;  2Z11 A;  4HKF A;  4NJR A;  3VWE A;  1NSL A;  3CD6 1;  2EK8 A;  4MMO A;  5HXD A;  2AKL A;  4MON A;  4OLL A;  4UCP A;  3CCR 1;  3DR8 A;  2FCK A;  3S2D I;  4A3L I;  3J80 f;  4DK1 A;  3DLJ A;  2QEC A;  1VQ6 Z;  3R9E A;  1QSO A;  2FVG A;  5CNP A;  1PUA A;  3MZL B;  3PZJ A;  1VQM 1;  1GYT A;  1TFI A;  3PBB A;  4FD4 A;  2B4D A;  2JUB A;  5C3E I;  3BLN A;  3KGQ A; 
#chains in the Genus database with same CATH homology
 5LL6 f;  4QTT A;  4A3E I;  3B2Y A;  1AYE A;  4IK2 A;  1VQ6 1;  4NGQ A;  3G4S Z;  2PJ9 A;  2Q4Z A;  3SJF A;  4R76 A;  3D66 A;  4P4E A;  3KR5 A;  1VQP 1;  2V8K A;  3G71 1;  4MHZ A;  5AN9 F;  2PJ5 A;  2BOA A;  1USP A;  3GB0 A;  3S1N I;  4NGM A;  3PO3 S;  5JM6 A;  4A3J I;  3HLP A;  4RVF A;  1VQ4 Z;  2V77 A;  4ZX9 A;  2E2H I;  2W03 A;  2GRE A;  3KR4 A;  2GTH A;  4NGS A;  4UEF A;  3VMI A;  1YHQ Z;  5D1O B;  3M3Y I;  2EK9 A;  3CME Z;  2BO9 A;  5LYF A;  1F2P A;  2OR4 A;  4YWY A;  1KWM A;  4ZY1 A;  1N2F A;  3S9M A;  3K7A I;  1YIT 1;  2OTJ 1;  3CCM 1;  3FJU A;  3PB8 X;  3HOW I;  8CPA A;  3NH8 A;  3SJG A;  4F9U A;  2QA4 Z;  1LFW A;  2AFW A;  2WB1 A;  4EWC A;  5LYL A;  3S1M I;  4R7M A;  4MCP A;  5HVF A;  4XX2 A;  4A3G I;  3I55 Z;  4DUK A;  2RHB A;  2VUM I;  1Y1W I;  1RO0 A;  3CCS 1;  1QYP A;  1R43 A;  4G1P A;  4NBA A;  3ISZ A;  2GLJ A;  2XEF A;  1VLA A;  2R7Z I;  3HOZ I;  4PXE A;  2PE3 A;  2QA4 1;  2K3R A;  3BHX A;  3FX6 A;  2E2I I;  3FVL A;  1VQO 1;  3K2K A;  3KHX A;  3F3F C;  1FT7 A;  1S7M A;  4E31 A;  2CTC A;  3G6E Z;  1ZLI A;  1JWH C;  2R92 I;  1YLO A;  3WAB A;  5K8P A;  3CXC Y;  4E33 A;  2O4H A;  3BI1 A;  4ONW A;  3CCU Z;  3FH4 A;  3S2H I;  4QTU A;  1BPN A;  2VL1 A;  1YI2 1;  1N8R 1;  1CP6 A;  5HVG A;  3VTN A;  1TF9 A;  2QRD B;  1QF8 A;  2GU2 A;  3D7F A;  2JA5 I;  2VUG A;  4RUH A;  3IFE A;  4FWU A;  3U50 C;  1TWA I;  3G4S 1;  4NOZ A;  2OTL Z;  1EE3 P;  1Y0R A;  3CPW Y;  3WC7 A;  1X0T A;  3H8E A;  3GTK I;  4A3B I;  5CPA A;  4ZYQ A;  1CPS A;  3FKI I;  2AFU A;  2ZEE A;  1TKF A;  2IZ3 A;  2C6G A;  3S9L A;  4RS4 A;  2QLV B;  4OKO A;  1JJ2 Y;  1HEE A;  3FEC A;  3VAR A;  1VQN 1;  4EFD A;  5CBM A;  3CCE Z;  3TX8 A;  4HGY A;  2DEA A;  3NH5 A;  2Q51 A;  2G9D A;  2PVW A;  4PXD A;  1LQL A;  3MON A;  5FLM I;  1TF8 A;  2ZEO A;  4NJQ A;  7CPA A;  3DGV A;  4O23 A;  3Q87 A;  1LAN A;  2JR6 A;  3FQQ A;  2PJA A;  4CPA A;  5LRK A;  2RBL A;  2C6C A;  1M1K 2;  1NJI 2;  1ZG9 A;  2OOT A;  3CC4 Z;  2O53 A;  3HOU I;  1VIX A;  3HKZ A;  4NGN A;  4ZI6 A;  4DGL A;  3S14 I;  5F09 A;  2CF4 A;  3PB9 X;  2RB7 A;  3B3T A;  4MXU A;  3B3W A;  3JAM b;  3QWU A;  1VQ5 Z;  4A3M I;  2BCO A;  4P45 A;  2PJB A;  2AFM A;  2PJ2 A;  1YUA A;  1K73 1;  2PJ1 A;  3B3C A;  1ARL A;  4ZX8 A;  5A2Q f;  3HOX I;  3D7G A;  1WII A;  1K8A 1;  2IJZ A;  1N8R 2;  1CG2 A;  1I6H I;  3GLJ A;  1K73 2;  3SI2 A;  5K8M A;  4MCR A;  3BI0 A;  4Y7N I;  3S15 I;  3H8F A;  3RZD I;  3D9X A;  1QMU A;  3SJE A;  1F2O A;  3OW2 Y;  3GUX A;  3D6W A;  4TNU A;  1FNO A;  1XBU A;  2PJ0 A;  3K9T A;  1M1K 1;  2EWB A;  2PJ3 A;  4B6Z A;  2LFU A;  1Q86 2;  2PJ8 A;  1R3N A;  4AXV A;  3PO2 I;  3MRU A;  1DTD A;  1VQ9 Z;  3FF3 A;  1VQL Z;  4BXX I;  3T8W A;  5IP7 I;  2Q43 A;  3I55 1;  3RBU A;  1Q7Y 2;  1DE4 C;  2PJ4 A;  4OC4 A;  5LYD A;  4OID A;  2PJ7 A;  1Z2L A;  3CT9 A;  4FAI A;  1Q81 1;  4A3F I;  2AFX A;  1VQN Z;  2NVQ I;  5C4J I;  1JQG A;  1Y0Y A;  2RPR A;  2VF1 A;  2V8G A;  4UEE A;  4A3I I;  4OIW A;  3SJX A;  4F8Z A;  3WC6 A;  4UF4 A;  1R9T I;  3D68 A;  1Z5R A;  1F57 A;  3B3S A;  4JZ0 A;  3PFE A;  2M48 A;  2ZOG A;  4A39 A;  4GM5 A;  3CCQ 1;  2F7V A;  2OZK A;  2BJO A;  3NFZ A;  2JA8 I;  1IY7 A;  3CPW Z;  1M4L A;  2ANP A;  1VQ8 1;  5C44 I;  3CCJ 1;  2V8J A;  1YJ9 Z;  1S72 Z;  4MD8 A;  5J1Q A;  4RVG A;  3HOV I;  4E32 A;  4OC2 A;  2H85 A;  4MD7 A;  3RAM A;  1RTQ A;  4A94 A;  1VQK Z;  3I07 A;  2F8H A;  5D29 A;  3CCQ Z;  2OTL 1;  2RIQ A;  1YIT Z;  1CX8 A;  3CC2 Z;  3RZO I;  3J81 b;  4NFR A;  2JNY A;  1YIJ Z;  5IT9 f;  3KIF A;  4A38 A;  2AFZ A;  3CCJ Z;  2QJ8 A;  2R93 I;  1Y1V S;  1I3Q I;  3GTL I;  3J7A 4;  3VB9 A;  2R6M A;  5D1O A;  2E2J I;  1Q82 1;  3H3V J;  2I3C A;  3H8G A;  3IIB A;  4NBD A;  1TXR A;  4W9Y A;  4UIA A;  2ABZ A;  1X3Z A;  3CCE 1;  1Y7E A;  3B3V A;  3KIH A;  1RO2 A;  2F4O A;  4HGZ A;  3CCS Z;  3V7Z A;  4DJL A;  2JEW A;  3GTQ I;  2RT9 A;  2G2K A;  5A2Q b;  2EGT A;  3P5J B;  4RV9 A;  2JS4 A;  2W04 A;  3I1U A;  1VQ9 1;  2B63 I;  4NBE A;  3QNV A;  2K5R A;  4NB8 A;  1VQL 1;  1PFT A;  3JAM f;  4E2Z A;  3GTM I;  1PCA A;  3CCR Z;  2XEJ A;  4OC1 A;  1Q86 1;  3G6E 1;  1QVG Y;  1LCP A;  4NH1 C;  4A3D I;  4P4J A;  1ZH1 A;  3ISX A;  1YHQ 1;  2ZAE B;  1HDU A;  2PIY A;  3CME 1;  1DL6 A;  3BG1 B;  1ZLH A;  4P10 A;  2AFS A;  4MCQ A;  3V38 A;  3NA6 A;  4EWT A;  1NSA A;  2QKD A;  2JBK A;  3WC5 A;  1W2B Z;  1QVF Z;  3EED A;  3FED A;  4H2K A;  3WT4 A;  3RZA A;  3TDH B;  4IAV A;  1OBR A;  1RNI A;  5T67 A;  3S1Q I;  4BY1 I;  4BD9 A;  5FLX f;  1Z01 A;  3BXM A;  1BPM A;  1ELM P;  2GTI A;  1K9M 1;  1K8A 2;  1VHE A;  4X6A I;  4OC3 A;  1VQK 1;  3B35 A;  2LIY A;  1YJW 1;  1KQS Y;  2WYR A;  3HUV A;  5ELY A;  4JYW A;  2DE6 A;  5IB9 A;  3B7I A;  1RO4 A;  4NGR A;  4AYB A;  1VQ7 1;  4DYO A;  3CMA 1;  4Q7A A;  3KQZ A;  4P44 A;  4KSI A;  4NB9 A;  3CCL Z;  4TWE A;  2J9A A;  1P9N A;  1M90 1;  1CPX A;  4PPZ A;  2V8D A;  2PK7 A;  5CM2 M;  5IP9 I;  5LRJ A;  2RFH A;  3IX0 A;  2NVX I;  3H0G I;  2JMO A;  1Q7Y 1;  1X3W A;  2HU9 A;  3MN8 A;  1QVG Z;  5LRG A;  1WW9 A;  3OW2 Z;  3CMA Z;  1YJN 1;  5D1P A;  1VQ4 1;  4YU9 A;  1BAV A;  4NBG A;  1KQS Z;  5T64 A;  4OC0 A;  2NVY I;  1W2B Y;  4CL1 A;  1NP6 A;  4RVD A;  1RQF A;  4BBR I;  2PMZ A;  4P4D A;  1SFO I;  4A3K I;  3I4N I;  4Y52 I;  4MHY A;  3TE5 B;  1VQ7 Z;  1ZB8 A;  3CCM Z;  1VHO A;  3NDJ A;  3GTM S;  4A3C I;  3GKQ A;  4NBC A;  2JA7 I;  2OOX B;  3SI1 A;  1K83 I;  3CC7 1;  3M4O I;  2NVT I;  3CQZ I;  4WWV A;  2IMO A;  3FMC A;  1QQ9 A;  1YME A;  3D7D A;  2NYQ A;  1BLL E;  3TC8 A;  1LOK A;  3CD6 Z;  4NBB A;  1CBX A;  4R8F A;  4PXB A;  4PQA A;  3F3P C;  3G71 Z;  1YUK A;  2M6N A;  1AMP A;  2F4M A;  4X2T A;  4OME A;  3LWU A;  4FBE A;  3J80 b;  3CC4 1;  1JJ2 Z;  5JGF A;  2Y0S A;  2PM9 A;  4P4I A;  3L2N A;  5IT9 b;  3CC7 Z;  1YJW Z;  1Z8L A;  3SI0 A;  2ZEP A;  1PYT B;  2AFO A;  3N5F A;  1ZB9 A;  1Y1V I;  2OTJ Z;  3IO1 A;  3CCV 1;  1QVF Y;  2YU9 I;  2PJC A;  4K3N A;  1Q82 2;  3CPX A;  3VH9 A;  2PVV A;  5DS0 A;  2CTB A;  2V8H A;  3PB4 X;  3IEH A;  4ZY2 A;  2C6P A;  1HDQ A;  3LMS A;  2QYV A;  3PO3 I;  2V8V A;  2WAQ A;  2XEG A;  4A93 I;  4F9V A;  5K8O A;  2DE7 A;  2JBJ A;  3PB7 X;  1XJO A;  1NUI A;  4MHP A;  1XFO A;  3CC2 1;  3KL9 A;  2QRE B;  2YAD A;  4P6Y A;  1K9M 2;  3MZK B;  1XMB A;  3HOY I;  5I4M A;  1XRY A;  1YIJ 1;  3IWW A;  2DE5 A;  1TKJ A;  3S1R I;  1VQP Z;  4BY7 I;  1LAM A;  2PJ6 A;  3PB6 X;  1RLY A;  2QRC B;  4X3R A;  2HF1 A;  2V8I A;  4E2Y A;  4MRI A;  3GTO I;  1ZG7 A;  6CPA A;  3IJ3 A;  1NJI 1;  2QR1 B;  1UWY A;  1YW4 A;  1YI2 Z;  3VMG A;  3FQM A;  5HVH A;  4Z65 A;  3FEE A;  1KRL A;  4R6T A;  3VMH A;  2ZOF A;  4ZY0 A;  1Q81 2;  5FLX b;  2P3Y A;  4OP4 A;  3J81 f;  4NBF A;  4P4B A;  3I56 1;  2WZN A;  1TKH A;  4S1T A;  1VQ8 Z;  4NGP A;  1VQM Z;  1USP B;  1TWH I;  3KHZ A;  3CCL 1;  2C1C A;  5D8N A;  1I50 I;  1Q7L A;  2QEX Z;  5LYI A;  2POK A;  3S16 I;  1Z03 A;  4MD9 A;  3KZW A;  4A37 A;  1ML8 A;  4E2W A;  3EER A;  5C4X I;  4RVH A;  1YSJ A;  2NSM A;  2J6A A;  2PRQ A;  4E30 A;  2GLF A;  3PEI A;  1M90 2;  2ZEM A;  3CCV Z;  3S17 I;  3D67 A;  4X8I A;  5THW A;  1YJN Z;  4MH4 A;  1KC8 1;  3BG0 B;  1WCM I;  4OC5 A;  4HH4 A;  1CP7 A;  3KQX A;  1TWC I;  3GTP I;  4BBS I;  2ZEF A;  5JH9 A;  2KPI A;  3I4M I;  4NGT A;  3GTJ I;  3KI9 A;  3NH4 A;  4UEZ A;  3IC1 A;  2QEX 1;  3S9N A;  2ZEG A;  1IGB A;  3CCU 1;  3D7H A;  3PRT A;  3JRU A;  2ZEH A;  3CXC Z;  2IQ6 A;  3NDI A;  2JA6 I;  3PFO A;  2ZEN A;  1VQ5 1;  1KD1 1;  1ZG8 A;  3VAT A;  1LAP A;  4NJR A;  1ELL P;  2PCU A;  2ZEL A;  3T4N B;  3CD6 1;  2EK8 A;  3IFU A;  4IHM A;  2AKL A;  4MON A;  3LUS A;  5T6B A;  2CIJ A;  3CDX A;  4MMO A;  5HXD A;  4P4F A;  3CCR 1;  1KD1 2;  5K8N A;  2P28 A;  4DQY B;  3S2D I;  3GCF A;  4A3L I;  2IZ4 A;  2KI7 B;  3J80 f;  4DK1 A;  4FUU A;  3DLJ A;  4NBH A;  3CPA A;  2HB6 A;  2ZED A;  1KC8 2;  4PXC A;  4EME A;  1VQ6 Z;  4UIB A;  4E2X A;  1TWF I;  1YJ9 1;  1S72 1;  4WJB A;  3PBE A;  1TWG I;  3D4U A;  1VGY A;  2PIZ A;  2FVG A;  4MHN A;  3GTG I;  3KAS A;  3I56 Z;  4LQG A;  2QVP A;  3ESW A;  3MZL B;  2E9H A;  1VQM 1;  1GYT A;  2HC9 A;  1TFI A;  1VQO Z;  3PBB A;  1H8L A;  2OOY B;  1YW6 A;  1Z02 A;  3IF8 A;  2XEI A;  2JUB A;  1L1O C;  5C3E I;  4MCS A;  1ARM A;  3KGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...