2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspa protein
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
3NA6A 3K2KA 3SI2A 4UF4A 3RAMA 2ZELA 3JRUA 1ARLA 2F7VA 2AFMA 2QYVA 3QNVA 4MCSA 4MHNA 4UEEA 2PJ4A 3IIBA 2POKA 3SI1A 3RBUA 2C6GA 1ELLP 1CPSA 1F2OA 4BD9A 2C6PA 2PIYA 3KQZA 1IGBA 4Z65A 3FMCA 3PFOA 3CPAA 4YU9A 1YLOA 2AFSA 3VATA 4UIAA 3FF3A 2IJZA 3MN8A 3IFEA 2WZNA 4OC0A 4DUKA 2ZEEA 2ZEPA 1KWMA 2CTCA 1XFOA 4A37A 4IHMA 4ZY1A 1NSAA 1EE3P 4EWTA 1LANA 1Z5RA 4P45A 1HEEA 3KHZA 5HVFA 4NGPA 3DGVA 4P6YA 2ZEGA 3HLPA 3FVLA 2BO9A 1XJOA 2XEIA 2GLJA 5F09A 4X3RA 4NGSA 4R6TA 3L2NA 5LYIA 4NJRA 1BAVA 2ANPA 1CPXA 2V8HA 1H8LA 4Q7AA 4PXEA 3PBEA 2XEJA 4FBEA 3PB9X 1YW4A 3NH5A 2EK9A 4PQAA 4GM5A 2PJ9A 1R3NA 4MHPA 3KR4A 5CPAA 1QMUA 3H8GA 1M4LA 4JZ0A 5JGFA 2GLFA 4R7MA 3KASA 2Q43A 3LWUA 4DYOA 3D7FA 3BI0A 2OR4A 4ONWA 2PJBA 2PVVA 4F9VA 2IQ6A 1TKJA 2AFZA 4IK2A 5JH9A 1PCAA 1CP7A 3KHXA 4B6ZA 7CPAA 4O23A 2PJ2A 3GB0A 4EFDA 2OOTA 3BHXA 5ELYA 1ARMA 3KI9A 1DE4C 1ZG7A 1JQGA 5K8OA 2I3CA 4WJBA 4MHYA 1XMBA 1DTDA 4OMEA 4TNUA 2CF4A 3WT4A 4RUHA 2F8HA 3H8FA 2BOAA 1TKHA 4ZYQA 1AMPA 1FT7A 1VIXA 3SJFA 1LOKA 3D68A 1CG2A 2AFWA 1BPNA 2WYRA 3GLJA 4NJQA 3D7HA 4P44A 1TKFA 2ABZA 5IB9A 2PJ8A 4P4BA 3B3SA 4P4FA 4A94A 1TF8A 3ISZA 3IEHA 2CTBA 3B3WA 4OP4A 2V77A 2V8VA 4NGRA 2O53A 1TF9A 1CX8A 3TX8A 3B2YA 5D8NA 3RZAA 5LYDA 4FWUA 1VHOA 4MHZA 1XRYA 4OIWA 1Y7EA 3WABA 2PJAA 4ZX8A 4ZX9A 4NGQA 4P4IA 3LMSA 4IAVA 3DLJA 3PEIA 4NGTA 1R43A 2JEWA 2O4HA 4NGNA 4OC4A 1ZG8A 2PRQA 1IY7A 1CBXA 3SJXA 4NGMA 5K8NA 3VARA 2ZEOA 2V8DA 4K3NA 1GYTA 3PB8X 1Y0YA 3S9LA 3FEEA 2ZEMA 2FVGA 4OC3A 5LRGA 3D7GA 2ZEDA 1TXRA 1LFWA 1CP6A 2RB7A 3NFZA 3B3VA 3FH4A 3FECA 4OC2A 3WC6A 3B3CA 2Q4ZA 3FJUA 2GREA 3TC8A 3WC7A 4MCRA 4LQGA 3WC5A 2G9DA 4WWVA 1ZLIA 4AXVA 4OKOA 1Q7LA 8CPAA 1VHEA 4TWEA 2PE3A 1BPMA 1VGYA 4FUUA 1AYEA 3KGQA 4MRIA 1BLLE 2AFUA 4PPZA 2VL1A 2PIZA 1Z8LA 3B7IA 3HUVA 3FX6A 5THWA 3KQXA 1LCPA 4MCPA 4MCQA 2PJ5A 3D7DA 4P4EA 4EMEA 1YSJA 2PJ0A 3BI1A 3IC1A 3SJEA 3B3TA 5K8MA 3KZWA 1UWYA 3SJGA 4PXCA 3BXMA 4PXDA 5LRKA 1HDUA 5DS0A 5J1QA 3B35A 2DEAA 3FEDA 1ZLHA 4P10A 3IWWA 3PB6X 2HB6A 2C6CA 3S9NA 3IJ3A 1PYTB 1QQ9A 2PVWA 3CT9A 2PJ7A 1YMEA 2CIJA 5JM6A 2AFXA 3H8EA 4P4JA 4W9YA 5HVHA 3VH9A 3CPXA 4UEFA 3SI0A 5LYFA 1ZG9A 3PB7X 2EWBA 2ZEHA 4R76A 2ZOGA 1Y0RA 3N5FA 2QVPA 1YW6A 4PXBA 4YWYA 5HVGA 3PRTA 2IMOA 3T8WA 4CPAA 5K8PA 3K9TA 2GU2A 2PJ3A 4JYWA 3S9MA 4MMOA 4OC1A 2JBJA 3CDXA 2RFHA 4ZY2A 5I4MA 2C1CA 2V8GA 3V38A 2EK8A 4DJLA 2XEGA 3PB4X 3MRUA 4KSIA 3KR5A 2Q51A 6CPAA 4ZY0A 1HDQA 4X2TA 3NH8A 2HC9A 4MXUA 1F57A 3D66A 4ZI6A 3NH4A 1Z2LA 2PCUA 2J9AA 3ISXA 4NFRA 4X8IA 1LAMA 3V7ZA 3PBBA 2XEFA 4R8FA 1LAPA 4G1PA 2NSMA 1FNOA 4OIDA 2ZENA 2PJ1A 5LRJA 2JBKA 2BCOA 4F9UA 4A39A 2PJCA 3KL9A 4UIBA 5LYLA 4UEZA 4F8ZA 2PJ6A 4OC5A 3D4UA 1RTQA 2AFOA 1OBRA 2ZOFA 3IO1A 3I1UA 5HXDA 1XBUA 4FAIA 4H2KA 1F2PA 3D67A 4P4DA 2NYQA 3GUXA 5D29A 5CBMA 2QJ8A 4A38A 2ZEFA 3PFEA 1ELMP
chains in the Genus database with same CATH superfamily
3K2KA 4UF4A 1VQO1 4M85A 1VQP1 3QNVA 1YJWZ 3EY5A 4DNCA 2B4DA 3SI1A 1Z9UA 5F48A 2C6PA 3R1KA 3C26A 4Z65A 4A31A 4UFXA 3PFOA 3MONA 4UCMA 4UIAA 4UA3A 3MN8A 2KPIA 4PSWA 4KUAA 3G3SA 1KWMA 3S17I 1KUYA 4ZY1A 2Z3KA 4EWTA 3PO2I 1Z5RA 4NGPA 4P6YA 2ZEGA 3HLPA 2BO9A 2GLJA 2QEXZ 4X3RA 4NGSA 4HKFA 3NE7A 2JMOA 3S14I 2P6GA 4QUSA 3HOWI 1K9M2 1X10A 1K4JA 3J81b 4FBEA 2XEJA 3NH5A 4LX9A 4PQAA 3Q87A 1S3ZA 2J8RA 1Z4EA 3H8GA 1M4LA 4UBRA 5JGFA 4DYOA 3VMIA 1Q16A 2Q7SA 2OR4A 3CCR1 2PVVA 2R98A 1VQ8Z 2IQ6A 2QIRA 2ZW7A 4E33A 3CC41 1IYLA 2FS5A 1P4NA 3QWUA 4O23A 3BHXA 5J8FA 5EC4A 3KI9A 1IOIA 1WK4A 2LEXA 4MFQA 4FD6A 4WJBA 4MHYA 2JIRA 2BL1A 2J8NA 3S6GA 2OTL1 2CF4A 3WT4A 2JA7I 3GYAA 1YIT1 4QVTA 3H8FA 2BOAA 3MGDA 4ZYQA 1FT7A 3D68A 3GCFA 1BPNA 2NVQI 1JWQA 2DPSA 5DWNA 1VQ5Z 3HOXI 4F0XA 3QAYA 2CTBA 3B3WA 1YIJ1 5F47A 3KIFA 3LODA 4NGRA 2F4MA 1TF9A 3VB9A 3HOUI 2E9HA 2PC1A 2E2JI 5IT9b 3S16I 1W2BZ 1VHOA 4XPLA 4NF1A 3RYOA 3CCU1 2B5GA 4E2WA 2CNSA 3P2HA 3DLJA 3A9LA 2IZ4A 4KOYA 2M48A 4HPSA 2R8VA 4QTUA 2DPTA 2JEWA 1ZG8A 4CL1A 5KTDA 2NVYI 3SXNA 3SHPA 4NGMA 4HH4A 5K8NA 2GE3A 3VARA 5IV0A 2YNEA 2R6MA 3VMGA 1X3WA 4KOTA 1CM0A 4CYQA 5AN9F 3RO0A 3IGRA 4OC2A 4QB9A 3D9XA 3WC6A 1USPA 3CXCZ 5C82A 1RO5A 4MHDA 4MCRA 4JJXA 3BJ8A 3S6FA 2VPXA 4RVGA 1WWZA 1ZLIA 3UY5A 8CPAA 2EUIA 1YHQZ 1Q2DA 2WPWA 2PE3A 1VQKZ 1Z02A 4JXQA 4MY0A 3GKRA 3CC21 4R9MA 3VWDA 1YJ9Z 3I4NI 2AFUA 4UFVA 3FBUA 4AVBA 3HUVA 1S7NA 2Z10A 5HMNA 1S60A 4MCPA 2PSWA 1K8A2 1M44A 5AG4A 4P4EA 4Q36A 3SJEA 5D1PA 3KZWA 3PZJA 4PXDA 5H84A 3PO3S 4XNHB 4CGNA 2BUEA 3FEDA 2DEAA 3IWWA 4R57A 3PB6X 3TE5B 3ZZIA 2C6CA 4PSXA 3TTHA 4XPDC 3KKWA 2IV2X 3ZJ0A 1IIDA 3EXNA 2AFXA 4P4JA 5HVHA 1M4GA 2B4BA 3CPXA 4UEFA 2JNYA 4MFKA 2G0BA 2JIOA 4DK1A 1YLEA 3N5FA 3MZLB 1YW6A 2KI7B 2PR8A 4YWYA 1X3ZA 3TO6A 4CPAA 3T8WA 4M6IA 4U9YA 4MMOA 2JBJA 2C1CA 2V8GA 1I12A 2EK8A 2Y0MA 2EVNA 1Q7Y1 1NMTA 3MRUA 2D4OA 3W91A 2Q51A 3VWEA 1RO4A 4ZY0A 1HDQA 2VPYA 3NH8A 2V3VA 2VEZA 4C7HA 4MH4A 4MXUA 3QAHA 3V7ZA 3PBBA 5JQ4A 2OOYB 5A27A 1Y9WA 5F46A 2LIYA 1J4JA 2DE6A 2PJ1A 2BCOA 4RVHA 3S1RI 2I79A 2OZKA 3IU1A 4UIBA 4UEZA 5AG5A 4OC5A 3CPWZ 4II9A 2ARHA 4A3LI 1VQ9Z 5C3EI 1S7LA 1OBRA 3G4SZ 3CME1 4BMHA 4NB8A 3FIXA 5HXDA 4E8OA 4H2KA 3D67A 5D29A 4CRYB 5CBMA 5FLXf 4EWCA 3SI2A 2Z3PA 2ZELA 2OZUA 1QVGZ 1YJW1 2QYVA 3F0AA 4RV9A 3BJ7A 4PV6A 3RBUA 1F2OA 4BD9A 4NXYA 2DXQA 3I56Z 1Q812 1YLOA 3VATA 4E2ZA 3FF3A 2IJZA 1I50I 2FIAA 2QKDA 2WZNA 4MONA 3D3SA 3W6SA 2HF1A 2RBLA 4KVOE 3PGPA 1IB1E 4CAEA 3FVLA 2QEX1 4JLYA 5F09A 3DR6A 3DR8A 4Q38A 4CYOA 4NJRA 3J80f 3HOVI 2ANPA 3FKII 1YI2Z 4Q7AA 3T4NB 1NJI1 3F5BA 2ZW5A 3J80b 4B5OA 2EK9A 1VQMZ 3I55Z 2QRDB 4C7IA 4JZ0A 4IF5A 3KASA 3DDDA 3GY9A 2YNCC 3G8WA 1VQ81 2PJBA 4ONWA 3K7AI 1TKJA 3F3FC 3SXOA 1SIWA 2Q04A 1SFOI 4QC6A 2DE7A 1YX0A 4XX2A 4EFDA 4Y49C 2Z3NA 4CYPA 3S1NI 4CAFA 5ELYA 1KUVA 1DE4C 3CCJZ 1ZG7A 2YNDA 1DTDA 2WSAA 4OMEA 4TNUA 2WUUA 4E2AA 4DQYB 1QSMA 2EGTA 4QBJA 4NBBA 1QVFZ 1PFTA 2OTJZ 3FB3A 3GIUA 3CCEZ 1YREA 4Y7NI 5GCNA 2F8HA 2QMLA 1Y1WI 3KIHA 1LOKA 4KZTA 3T90A 3I4MI 2AFWA 1VQ51 3BLNA 2PJ8A 4B12A 1TF8A 3IEHA 4Y49B 4L8AA 2DE5A 1W2BY 2O53A 5EMIA 4E2YA 1ZB8A 1VQLZ 5LYDA 2R7HA 4FWUA 4MHZA 4A32A 4OIWA 1Y7EA 4ZX8A 4ZX9A 3CXQA 4LUAA 4NGQA 1WIIA 4IAVA 1Q822 3PEIA 4NGTA 2FXFA 1TFIA 1R43A 2IZ3A 5KTCA 1N8R2 3R9EA 1NJI2 4A3JI 2FSRA 2Z3LA 1YUAA 1IY7A 3D2MA 1ZO0A 4NBEA 1P0HA 1GYTA 1WZNA 3FEEA 1S5KA 2ZEMA 2FVGA 3GTKI 5LRGA 3D7GA 2ZEDA 5G22A 1TXRA 3JTKA 4BBHA 3B3VA 1P9NA 5G20A 4C68A 3CXCY 1L1OC 3FH4A 4A3FI 3FECA 3GTMI 2REEA 4E2XA 1Q862 3M3YI 3TC8A 4F0YA 4LQGA 3WC5A 2PMZA 4WWVA 2JIMA 4CRZB 4CAWA 4AXVA 3FXTA 2JUBA 3S6KA 1YHQ1 1ZH1A 1VQK1 2HQYA 1BPMA 1YJ91 1N2FA 4FUUA 4NH1C 3I3GA 2NMTA 1AUGA 3CD6Z 2PIZA 1Z8LA 2YNCA 3FX6A 5THWA 1LCPA 3H3VJ 4MCQA 2AYDA 1K8A1 3S1QI 4EMEA 2BJOA 1YSJA 3IC1A 4KSFA 2WPXA 4AB7A 4RVDA 5K8MA 4PXCA 2EO8A 2BSWA 3CCVZ 2E2II 1HDUA 1S7MA 2CXAA 2C27A 1MJAA 3IJ3A 3EERA 1PYTB 3GTOI 4L89A 3EO4A 5KTAA 2R92I 5AG6A 2J8MA 2PJ7A 1YMEA 2CIJA 2HU9A 3S2DI 4PK3A 4RS2A 1LQLA 3H8EA 3VH9A 1ZG9A 2Q7BA 2EWBA 3CMA1 4R76A 2ZOGA 3IF8A 3S2HI 2OH1A 5HVGA 1YUKA 3K9TA 2HV2A 2VZZA 2PJ3A 4YGOA 4OC1A 3CDXA 3M4OI 1VQ4Z 5E96A 1NP6A 2P6EA 4GS4A 1QSOA 2EBJA 5DWMA 3K9UA 4A93I 2VQYA 2CNTA 1Q2CA 3GTQI 2PR1A 4KSIA 2OOXB 2P3YA 1L0CA 4XNHC 1Z03A 3NH4A 4R87A 2J9AA 4NFRA 2NAPA 2XEFA 4ONUA 1ON0A 5F49A 4R8FA 1LAPA 2NSMA 4OIDA 3IFUA 3CCQZ 2PM9A 3CPWY 2REFA 3KL9A 5LYLA 1FDOA 1M4DA 2PJ6A 1VQ91 1Y1VI 1Y1VS 4NBGA 2AFOA 3G4S1 4KUBA 2GFQA 3CCSZ 4MBUA 5T67A 3CCMZ 4BBRI 3I1UA 1XBUA 4FAIA 1F2PA 4P4DA 1TWHI 4S1TA 2HUZA 4HNYB 4KLWA 4UCPA 2D4PA 3PFEA 1KD12 1QVGY 5LRJA 4CGOA 1QSTA 2V8JA 3RAMA 3JRUA 1ARLA 1NUIA 1FDIA 2M6NA 2AFMA 2PJ4A 3IIBA 4KLVA 4AVCA 3JAMf 1QSNA 2C6GA 1ELLP 2IL4A 3CQZI 1CPSA 3I561 2PIYA 3KQZA 1XOVA 4MD8A 3GTLI 2ZAEB 1Q811 1QF8A 3CPAA 1K732 4YU9A 5C44I 3IR7A 3IFEA 3OWCA 1YQEA 4OC0A 4B13A 4DUKA 2VPWA 2OB0A 2ZEEA 4A95A 3F3PC 2VF1A 2CTCA 1RXTA 4A37A 4IHMA 1EE3P 1LANA 1GHEA 5HVFA 4P45A 3KHZA 3DGVA 1Y7RA 5D1OB 3MZKB 2QRCB 2XEIA 1DL6A 4HGZA 4NBDA 2JIPA 1YI21 1CPXA 5T64A 2V8HA 3CZXA 2QLVB 4H6UA 4MFPA 3PBEA 4BINA 3PB9X 1YW4A 1VQM1 1SQHA 3I551 2PJ9A 2I00A 4MHPA 5IP7I 4E31A 5CPAA 4A3GI 4OADA 2GLFA 4R7MA 2Q43A 3R96A 2W04A 3BI0A 1R9TI 2BEIA 3GKQA 2GTHA 3T9YA 2AFZA 5JPHA 4IK2A 4A3BI 1XEBA 5JH9A 2ATRA 7CPAA 3DSBA 3GB0A 2OOTA 3I9SA 2WB1A 3FQMA 4H89A 4RVFA 4B5PB 2YADA 2GANA 3CCJ1 1JQGA 2JIQA 5K8OA 2I3CA 1QYPA 3LD2A 4J3GA 1TWGI 4C2YA 1S72Z 1QVFY 1BOBA 1NSLA 5LL6f 3GTJI 2P0WA 1B6BA 2OTJ1 3CCE1 5FLXb 3FNCA 4RUHA 2K5RA 1AMPA 4UWJA 3F8KA 4MD7A 4KS9A 4HNWB 1CG2A 1AA6A 2WYRA 1Q2YA 3GLJA 1RO2A 3D7HA 2ABZA 4GXHA 1VQNZ 2LFUA 4P4FA 5ISVA 4OP4A 2GTIA 4BY7I 2FCKA 2V77A 2QECA 5HH1A 1TIQA 1CX8A 2O28A 3DNSA 1VQL1 3B2YA 1KQSZ 4M6HA 3FYNA 3P5JB 1Z8TA 2B4DB 1XRYA 4EVYA 2PK7A 4KOSA 4NB9A 4KOUA 1I21A 2FIWA 4KOVA 1Q821 2O4HA 4FD5A 4OC4A 1N8R1 2PRQA 3S6HA 3CCLZ 2Q4YA 2JS4A 1YJNZ 1Y0YA 3S9LA 1NE9A 3EFAA 1KC81 3NDIA 2RB7A 1YVKA 3FRMA 5H86A 3EEDA 4DGLA 1S7FA 3G6EZ 1RO0A 1KZFA 2JDCA 2K3RA 1Q861 2Q4ZA 5IX3A 1YGHA 3WC7A 3CXSA 2G9DA 4LQ6A 2OZHA 3N7ZA 4OKOA 1VHEA 1K83I 2DF5A 2H5MA 5A2Qf 4BXXI 1VGYA 3KGQA 1BLLE 3CD61 4HGYA 3D2PA 3RNZA 4OLLA 4PPZA 4X6AI 4FD7A 2VBQA 2G2KA 2R93I 4Y52I 2JA6I 2PJ5A 2B63I 2QR1B 2FT0A 2PJ0A 2V45A 2ZW6A 1YVOA 5IB0A 3CCV1 5LRKA 3S15I 5J1QA 3H0GI 3JVNA 5IP9I 1OZPA 3TOAA 4NBHA 1QQ9A 4UWIA 2PVWA 3CT9A 5JM6A 2CNMA 2V8IA 3IWGA 1VQ7Z 4W9YA 1WJ2A 3SI0A 4BBSI 1Y9KA 2ZEHA 1Y0RA 3G71Z 5AGEA 3NDJA 5G21A 1UFHA 4PXBA 3PRTA 4KVME 2PDOA 4KOXA 5CM2M 2JEVA 1B87A 4JYWA 4C2ZA 4U9ZA 1VQ41 3LACA 4ZY2A 3V38A 1Z8XA 1ML8A 3J81f 4U5YA 2NVTI 3V8IA 2XEGA 3FQQA 1RQFA 3PB4X 1KC82 2Y0SA 2B5GB 2OZGA 4I49A 2P6FA 2HC9A 3GTMS 3D66A 1Z2LA 2PCUA 3ISXA 4X8IA 4NBAA 1LAMA 2E7ZA 5G1ZA 1YK3A 3IU2A 2QA4Z 2W03A 1QXFA 5A28A 3CCQ1 1FNOA 2QREB 1V0CA 2ZXVA 2ZENA 3QB8A 2JBKA 4MFLA 1TWFI 4A39A 3D6WA 2PJCA 4F8ZA 1VQ6Z 1IYKA 2A4NA 3W6XA 1KUXA 3D4UA 1RTQA 3CCS1 1USPB 3CC7Z 3CCM1 3IO1A 1XIXA 3TFYA 1Z4RA 3TDHB 4UCNA 2R7ZI 4C2XA 2VXKA 3D8PA 3GUXA 2QJ8A 2ZEFA 1KD11 1IICA 2X7BA 1ELMP 4CGMA 3NA6A 1Y8CA 1X12A 4F6AA 4E30A 3E0KA 2B3VA 1VQOZ 2F7VA 1M901 2FE7A 4MCSA 1VQPZ 4MHNA 4UEEA 4AG7A 2POKA 5FVJA 2E2HI 4KORA 4UFWA 1IGBA 3FMCA 2Z3MA 1A2ZA 4B11A 1Z8WA 3NE8A 1PUAA 1K731 2AFSA 1M1DA 4A3II 5IT9f 2OU2A 4JD6A 2NVXI 3PP9A 2ZEPA 4KVXA 1XFOA 4MJ8A 1NSAA 1HEEA 1RNIA 3OW2Y 1XJOA 4K30A 1PU9A 3VMHA 1M4IA 1JWHC 5EBVA 1JJ2Y 4R6TA 3L2NA 2K5TA 5LYIA 4A3KI 2AKLA 1BAVA 1H8LA 4PXEA 4FD4A 4M3SA 3RZOI 4GM5A 1I1DA 1R3NA 2AJ6A 4ORFA 2R1IA 3KR4A 1QMUA 4OAEA 2RIQA 1VHSA 3LWUA 3D7FA 4NEXA 1R57A 3J7A4 4QTTA 4R3KA 4F9VA 3CCRZ 4CGLA 1VKCA 3CC4Z 3TT2A 2GIVA 1LRZA 1PCAA 1CP7A 3S1MI 3KHXA 4B6ZA 2B3UA 3VTNA 2PJ2A 1XE4A 1M1K1 4MY3A 3U50C 3HOYI 1ARMA 3P2FA 2VZYA 2Z11A 4CS0B 3IWEA 3I07A 2JLMA 4NOZA 1S721 2G3AA 1XMBA 1I6HI 2Q4VA 4CGPA 4M6GA 4ZBGA 2OTLZ 1M902 1MJBA 1MK4A 2ZW4A 1TKHA 1YITZ 2YU9I 4A33A 4PK2A 1VIXA 4NSQA 2B58A 3SJFA 2JA5I 3PO3I 4NJQA 1I3QI 4B10A 1VQN1 4P44A 3JAMb 1TKFA 5IB9A 1XMTA 4P4BA 3B3SA 3RZDI 4A94A 5CNPA 3ISZA 4X5KA 4R3LA 1FY7A 2V8VA 1YIJZ 1KQSY 4CAXA 2G3TA 2RPRA 3TX8A 5D8NA 3RZAA 2VI7A 3WABA 2PJAA 3CCUZ 3CMAZ 4P4IA 3TOBA 3OW2Z 1TWAI 3LMSA 3HOZI 4IUSA 3H5ZA 4NGNA 2VPZA 1JJ2Z 4AG9A 1IOFA 4RI1A 3CCL1 1CBXA 3SJXA 1ZB9A 3IX0A 1YJN1 2ZEOA 2V8DA 4K3NA 3PB8X 4MFJA 4NCZA 4OC3A 2VUGA 2JA8I 3TO7A 1LFWA 1CP6A 4KSAA 3NFZA 4XPDB 3G6E1 4BY1I 2PRBA 1MJ9A 3B3CA 1IU8A 2P28A 3FJUA 4NBCA 2GREA 3TE4A 4MFZA 3TO9A 1RLYA 2J6AA 2JR6A 4A30A 4CAVA 3JUWA 2V8KA 1Q7LA 1M1K2 2Q44A 4TWEA 2JDDA 2Q0YA 3CC2Z 4A3CI 1AYEA 4MD9A 2F5IA 4MRIA 5J8CA 2VL1A 3B7IA 3BG1B 2ODFA 3KQXA 1YR0A 1QSRA 5I0CA 2KCWA 3GTGI 3D7DA 4CYNA 5T6BA 4A3DI 2RHBA 3BI1A 3B3TA 3LUSA 1UWYA 1TWCI 3SJGA 4A3EI 3BXMA 4RN7A 4AVAA 5DS0A 2ZPAA 2CY2A 3B35A 4P10A 1ZLHA 4JWPA 1BO4A 2FL4A 2HB6A 2Z0ZA 3S9NA 4B14A 5D1OA 1WCMI 4MI4A 3EC4A 5FLMI 2Z3OA 4YFJA 1Z01A 1VQ71 1U6MA 5LYFA 1X0TA 3PB7X 3G711 2H85A 2QVPA 4JXRA 3TCVA 4YRHA 2IMOA 5K8PA 2WAQA 2GU2A 3BG0B 5C4XI 3S9MA 4A2ZA 4A3MI 3R95A 4NBFA 2RFHA 5I4MA 3GTPI 1N71A 4ZGYB 3CXPA 4DJLA 5C4JI 1S7KA 1WW9A 2AE6A 1Q7Y2 1K9M1 3KR5A 4E0AA 2RC4A 6CPAA 4X2TA 1VLAA 4KOWA 5C88A 1F57A 4B5PA 4ZI6A 2PQ8A 5BWAB 2QA41 3R9GA 4RS4A 3B8GA 3H4QA 1KRLA 3D2LA 1XF8A 3HKZA 4G1PA 3R9FA 2RT9A 4H6ZA 5AG7A 2YGWA 4XPKA 4AYBA 4F9UA 2VUMI 4E32A 3ESWA 1VQ61 3WR7A 5A2Qb 1CJWA 3CC71 2ZOFA 4HNXB 3CMEZ 2NYQA 2F4OA 4A38A
chains in the Genus database with same CATH topology
2V8JA 3NA6A 4EWCA 3K2KA 4E30A 3SI2A 4UF4A 1VQO1 3RAMA 2ZELA 3JRUA 1QVGZ 1ARLA 1VQOZ 1VQP1 2F7VA 1YJW1 1NUIA 2M6NA 1M901 2AFMA 2QYVA 3QNVA 1VQPZ 4MCSA 4RV9A 1YJWZ 4MHNA 4UEEA 2PJ4A 3IIBA 2POKA 3SI1A 3JAMf 3RBUA 2E2HI 2C6GA 1ELLP 3CQZI 1CPSA 1F2OA 4BD9A 2C6PA 3I561 2PIYA 3KQZA 4MD8A 3GTLI 3I56Z 1IGBA 4Z65A 2ZAEB 1Q811 1Q812 3FMCA 3PFOA 3MONA 1QF8A 3CPAA 1K731 1K732 4YU9A 1YLOA 2AFSA 3VATA 4E2ZA 4UIAA 5C44I 3FF3A 2IJZA 1I50I 3MN8A 3IFEA 2KPIA 4A3II 2QKDA 5IT9f 2WZNA 4OC0A 4DUKA 2NVXI 4MONA 2ZEEA 2ZEPA 3F3PC 1KWMA 2VF1A 3S17I 2CTCA 2HF1A 1XFOA 4A37A 4IHMA 2RBLA 4ZY1A 1NSAA 1EE3P 4EWTA 1LANA 3PO2I 1Z5RA 4P45A 1HEEA 3KHZA 5HVFA 4NGPA 1RNIA 3OW2Y 3DGVA 5D1OB 4P6YA 3MZKB 2ZEGA 2QRCB 3HLPA 3FVLA 2BO9A 2QEX1 1XJOA 2XEIA 2GLJA 5F09A 2QEXZ 3VMHA 1DL6A 1JWHC 4X3RA 1JJ2Y 4NGSA 4R6TA 4HGZA 2JMOA 4NBDA 3L2NA 5LYIA 3S14I 4A3KI 4NJRA 3J80f 2AKLA 1YI21 3HOVI 1BAVA 2ANPA 3FKII 1YI2Z 1CPXA 5T64A 2V8HA 1H8LA 3T4NB 4Q7AA 1NJI1 2QLVB 1KD12 3HOWI 1K9M2 3J81b 4PXEA 3J80b 2XEJA 3PBEA 3PB9X 3RZOI 4FBEA 1YW4A 3NH5A 2EK9A 4PQAA 4GM5A 1VQM1 3I551 2PJ9A 1R3NA 3Q87A 1VQMZ 3I55Z 4MHPA 2QRDB 5IP7I 4E31A 3KR4A 5CPAA 1QMUA 4A3GI 1M4LA 3H8GA 2RIQA 4JZ0A 5JGFA 2GLFA 4R7MA 3KASA 2Q43A 3LWUA 4DYOA 3D7FA 3J7A4 3VMIA 2W04A 4QTTA 3BI0A 2OR4A 4ONWA 1VQ81 3CCR1 2PJBA 2PVVA 4F9VA 3K7AI 1R9TI 1VQ8Z 3CCRZ 2IQ6A 3GKQA 2GTHA 1TKJA 4E33A 3CC41 3F3FC 2AFZA 3CC4Z 4IK2A 1SFOI 4A3BI 5JH9A 1PCAA 3QWUA 1CP7A 3S1MI 3KHXA 4B6ZA 7CPAA 2DE7A 3VTNA 2PJ2A 4O23A 4XX2A 3GB0A 4EFDA 2OOTA 2WB1A 1M1K1 3BHXA 3FQMA 3S1NI 4RVFA 3U50C 5ELYA 2YADA 3HOYI 1ARMA 3KI9A 3CCJ1 1DE4C 3CCJZ 1ZG7A 1JQGA 5K8OA 2I3CA 4WJBA 1QYPA 4MHYA 3I07A 4NOZA 1S721 1TWGI 1XMBA 1I6HI 1DTDA 1S72Z 1QVFY 4OMEA 4TNUA 5LL6f 3GTJI 2OTL1 4DQYB 2EGTA 2OTLZ 4NBBA 2OTJ1 2CF4A 3CCE1 1QVFZ 1PFTA 2OTJZ 5FLXb 1M902 3WT4A 2JA7I 3CCEZ 4RUHA 4Y7NI 2K5RA 1YIT1 2F8HA 3H8FA 2BOAA 1TKHA 1YITZ 2YU9I 4ZYQA 1AMPA 1FT7A 1VIXA 1Y1WI 3KIHA 3SJFA 4MD7A 1LOKA 2JA5I 3PO3I 3D68A 3I4MI 1CG2A 3GCFA 2AFWA 1BPNA 2NVQI 2WYRA 3GLJA 1VQ51 4NJQA 1I3QI 1RO2A 3D7HA 1VQN1 4P44A 1VQ5Z 3JAMb 1TKFA 2ABZA 5IB9A 1VQNZ 3HOXI 2PJ8A 2LFUA 4P4BA 3B3SA 3RZDI 4P4FA 4A94A 1TF8A 3ISZA 3IEHA 2CTBA 3B3WA 1YIJ1 4OP4A 2GTIA 4BY7I 2V77A 2V8VA 3KIFA 1YIJZ 1KQSY 2DE5A 1W2BY 2O53A 2F4MA 4NGRA 1TF9A 1CX8A 2RPRA 3VB9A 1VQL1 2E9HA 3HOUI 4E2YA 3TX8A 2E2JI 5IT9b 1KQSZ 1ZB8A 1VQLZ 3B2YA 5D8NA 5LYDA 3RZAA 3S16I 4FWUA 1W2BZ 1VHOA 4MHZA 3P5JB 1XRYA 3CCU1 4OIWA 2PK7A 1Y7EA 3WABA 4NB9A 4E2WA 2PJAA 3CCUZ 4ZX8A 4ZX9A 4NGQA 3CMAZ 4P4IA 1WIIA 3OW2Z 1TWAI 3LMSA 4IAVA 3HOZI 1Q821 1Q822 3DLJA 3PEIA 2IZ4A 4NGTA 2M48A 1TFIA 1R43A 4QTUA 2JEWA 2IZ3A 2O4HA 4NGNA 4OC4A 1JJ2Z 1N8R1 1N8R2 1NJI2 1ZG8A 4A3JI 4CL1A 1YUAA 2PRQA 2NVYI 3CCL1 1IY7A 1CBXA 3SJXA 1ZB9A 4NGMA 3CCLZ 4HH4A 5K8NA 4NBEA 3IX0A 1YJN1 3VARA 2JS4A 2ZEOA 1YJNZ 2V8DA 4K3NA 2R6MA 1GYTA 1Y0YA 3PB8X 3S9LA 3FEEA 2ZEMA 3VMGA 1X3WA 3GTKI 2FVGA 4OC3A 5LRGA 3D7GA 2ZEDA 2VUGA 5AN9F 2JA8I 1TXRA 1LFWA 1CP6A 1KC81 3NDIA 2RB7A 3NFZA 3B3VA 1P9NA 3G6E1 3CXCY 3EEDA 4DGLA 3G6EZ 1L1OC 3FH4A 4A3FI 3FECA 1RO0A 4OC2A 3GTMI 3D9XA 4BY1I 2K3RA 3WC6A 1USPA 3CXCZ 4E2XA 1Q861 1Q862 3B3CA 2Q4ZA 2P28A 3M3YI 3FJUA 4NBCA 2GREA 3TC8A 3WC7A 4MCRA 4LQGA 3WC5A 2PMZA 2G9DA 4WWVA 1RLYA 2J6AA 2JR6A 4RVGA 1ZLIA 2JUBA 4OKOA 4AXVA 2V8KA 1Q7LA 1M1K2 1YHQ1 8CPAA 1VHEA 1ZH1A 1VQK1 1YHQZ 4TWEA 2PE3A 1K83I 1VQKZ 1Z02A 1BPMA 5A2Qf 4BXXI 3CC21 1YJ91 1VGYA 1N2FA 4FUUA 3CC2Z 4A3CI 1AYEA 4NH1C 1YJ9Z 4MD9A 3I4NI 3KGQA 4MRIA 1BLLE 2AFUA 3CD61 4HGYA 3CD6Z 4PPZA 2VL1A 2PIZA 4X6AI 1Z8LA 3B7IA 3HUVA 3FX6A 5THWA 3BG1B 3KQXA 2G2KA 1LCPA 4MCPA 3H3VJ 3GTGI 2R93I 4Y52I 2JA6I 2PJ5A 3D7DA 1K8A1 1K8A2 2B63I 4MCQA 3S1QI 2QR1B 5T6BA 2BJOA 4A3DI 2RHBA 4P4EA 4EMEA 1YSJA 2PJ0A 3BI1A 3IC1A 3SJEA 5D1PA 3B3TA 3LUSA 5K8MA 3KZWA 4RVDA 1TWCI 1UWYA 4A3EI 3BXMA 3CCV1 4PXCA 4PXDA 3SJGA 3CCVZ 2E2II 1HDUA 5LRKA 3S15I 5DS0A 1S7MA 3PO3S 5J1QA 3B35A 2DEAA 3H0GI 1ZLHA 3FEDA 4P10A 3IWWA 3PB6X 3TE5B 2HB6A 5IP9I 2C6CA 3S9NA 3IJ3A 3EERA 1PYTB 3GTOI 4NBHA 5D1OA 1QQ9A 1WCMI 2R92I 2PVWA 3CT9A 2PJ7A 5FLMI 1YMEA 2CIJA 2HU9A 3S2DI 5JM6A 1LQLA 1Z01A 1VQ71 2V8IA 2AFXA 3H8EA 4P4JA 1VQ7Z 4W9YA 5HVHA 3VH9A 3CPXA 4UEFA 3SI0A 5LYFA 2JNYA 1X0TA 1ZG9A 4BBSI 3PB7X 2EWBA 3CMA1 2ZEHA 4R76A 3G711 2ZOGA 4DK1A 1Y0RA 3N5FA 3IF8A 2H85A 3S2HI 3G71Z 3MZLB 2QVPA 1YW6A 3NDJA 2KI7B 4PXBA 4YWYA 5HVGA 1X3ZA 3PRTA 2IMOA 3T8WA 4CPAA 5K8PA 1YUKA 3K9TA 2WAQA 5CM2M 2GU2A 2PJ3A 4JYWA 3BG0B 5C4XI 3S9MA 4MMOA 1VQ41 4OC1A 2JBJA 4A3MI 3CDXA 4NBFA 1VQ4Z 3M4OI 3GTPI 2RFHA 4ZY2A 2C1CA 5I4MA 1NP6A 2V8GA 3V38A 2EK8A 1ML8A 3J81f 2NVTI 4DJLA 5C4JI 4A93I 2XEGA 3FQQA 1WW9A 1Q7Y1 1Q7Y2 1RQFA 3PB4X 1KC82 3MRUA 2Y0SA 3GTQI 4KSIA 1K9M1 3KR5A 2OOXB 2Q51A 2P3YA 1RO4A 6CPAA 4ZY0A 1HDQA 4X2TA 1VLAA 3NH8A 2HC9A 4MH4A 4MXUA 3GTMS 1Z03A 1F57A 3D66A 4ZI6A 3NH4A 1Z2LA 2PCUA 2J9AA 3ISXA 4NFRA 4X8IA 4NBAA 1LAMA 2QA41 3V7ZA 3PBBA 4RS4A 2QA4Z 2XEFA 2OOYB 2W03A 1KRLA 4R8FA 2LIYA 3HKZA 1LAPA 4G1PA 2NSMA 2RT9A 3CCQ1 1FNOA 4OIDA 2QREB 3IFUA 3CCQZ 2DE6A 2ZENA 2PJ1A 5LRJA 4AYBA 2JBKA 2BCOA 2PM9A 4RVHA 3S1RI 4F9UA 3CPWY 2VUMI 1TWFI 4A39A 4E32A 3ESWA 3D6WA 2PJCA 2OZKA 1VQ61 3KL9A 4UIBA 5LYLA 4UEZA 4F8ZA 1VQ6Z 5A2Qb 2PJ6A 1VQ91 4OC5A 1Y1VI 3CPWZ 4A3LI 1VQ9Z 1Y1VS 3CC71 5C3EI 3CCS1 1RTQA 4NBGA 2AFOA 3D4UA 3G4S1 1USPB 1OBRA 3CC7Z 3CCSZ 3CCM1 3G4SZ 2ZOFA 3IO1A 5T67A 3CME1 4BBRI 3CCMZ 4NB8A 3I1UA 3CMEZ 5HXDA 1XBUA 4FAIA 3TDHB 4H2KA 1F2PA 3D67A 1TWHI 4S1TA 2NYQA 2R7ZI 4P4DA 3GUXA 5D29A 5CBMA 2F4OA 2QJ8A 5FLXf 4A38A 2ZEFA 1KD11 1QVGY 3PFEA 1ELMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NA6 A;  3K2K A;  3SI2 A;  4UF4 A;  3RAM A;  2ZEL A;  3JRU A;  1ARL A;  2F7V A;  2AFM A;  2QYV A;  3QNV A;  4MCS A;  4MHN A;  4UEE A;  2PJ4 A;  3IIB A;  2POK A;  3SI1 A;  3RBU A;  2C6G A;  1ELL P;  1CPS A;  1F2O A;  4BD9 A;  2C6P A;  2PIY A;  3KQZ A;  1IGB A;  4Z65 A;  3FMC A;  3PFO A;  3CPA A;  4YU9 A;  1YLO A;  2AFS A;  3VAT A;  4UIA A;  3FF3 A;  2IJZ A;  3MN8 A;  3IFE A;  2WZN A;  4OC0 A;  4DUK A;  2ZEE A;  2ZEP A;  1KWM A;  2CTC A;  1XFO A;  4A37 A;  4IHM A;  4ZY1 A;  1NSA A;  1EE3 P;  4EWT A;  1LAN A;  1Z5R A;  4P45 A;  1HEE A;  3KHZ A;  5HVF A;  4NGP A;  3DGV A;  4P6Y A;  2ZEG A;  3HLP A;  3FVL A;  2BO9 A;  1XJO A;  2XEI A;  2GLJ A;  5F09 A;  4X3R A;  4NGS A;  4R6T A;  3L2N A;  5LYI A;  4NJR A;  1BAV A;  2ANP A;  1CPX A;  2V8H A;  1H8L A;  4Q7A A;  4PXE A;  3PBE A;  2XEJ A;  4FBE A;  3PB9 X;  1YW4 A;  3NH5 A;  2EK9 A;  4PQA A;  4GM5 A;  2PJ9 A;  1R3N A;  4MHP A;  3KR4 A;  5CPA A;  1QMU A;  3H8G A;  1M4L A;  4JZ0 A;  5JGF A;  2GLF A;  4R7M A;  3KAS A;  2Q43 A;  3LWU A;  4DYO A;  3D7F A;  3BI0 A;  2OR4 A;  4ONW A;  2PJB A;  2PVV A;  4F9V A;  2IQ6 A;  1TKJ A;  2AFZ A;  4IK2 A;  5JH9 A;  1PCA A;  1CP7 A;  3KHX A;  4B6Z A;  7CPA A;  4O23 A;  2PJ2 A;  3GB0 A;  4EFD A;  2OOT A;  3BHX A;  5ELY A;  1ARM A;  3KI9 A;  1DE4 C;  1ZG7 A;  1JQG A;  5K8O A;  2I3C A;  4WJB A;  4MHY A;  1XMB A;  1DTD A;  4OME A;  4TNU A;  2CF4 A;  3WT4 A;  4RUH A;  2F8H A;  3H8F A;  2BOA A;  1TKH A;  4ZYQ A;  1AMP A;  1FT7 A;  1VIX A;  3SJF A;  1LOK A;  3D68 A;  1CG2 A;  2AFW A;  1BPN A;  2WYR A;  3GLJ A;  4NJQ A;  3D7H A;  4P44 A;  1TKF A;  2ABZ A;  5IB9 A;  2PJ8 A;  4P4B A;  3B3S A;  4P4F A;  4A94 A;  1TF8 A;  3ISZ A;  3IEH A;  2CTB A;  3B3W A;  4OP4 A;  2V77 A;  2V8V A;  4NGR A;  2O53 A;  1TF9 A;  1CX8 A;  3TX8 A;  3B2Y A;  5D8N A;  3RZA A;  5LYD A;  4FWU A;  1VHO A;  4MHZ A;  1XRY A;  4OIW A;  1Y7E A;  3WAB A;  2PJA A;  4ZX8 A;  4ZX9 A;  4NGQ A;  4P4I A;  3LMS A;  4IAV A;  3DLJ A;  3PEI A;  4NGT A;  1R43 A;  2JEW A;  2O4H A;  4NGN A;  4OC4 A;  1ZG8 A;  2PRQ A;  1IY7 A;  1CBX A;  3SJX A;  4NGM A;  5K8N A;  3VAR A;  2ZEO A;  2V8D A;  4K3N A;  1GYT A;  3PB8 X;  1Y0Y A;  3S9L A;  3FEE A;  2ZEM A;  2FVG A;  4OC3 A;  5LRG A;  3D7G A;  2ZED A;  1TXR A;  1LFW A;  1CP6 A;  2RB7 A;  3NFZ A;  3B3V A;  3FH4 A;  3FEC A;  4OC2 A;  3WC6 A;  3B3C A;  2Q4Z A;  3FJU A;  2GRE A;  3TC8 A;  3WC7 A;  4MCR A;  4LQG A;  3WC5 A;  2G9D A;  4WWV A;  1ZLI A;  4AXV A;  4OKO A;  1Q7L A;  8CPA A;  1VHE A;  4TWE A;  2PE3 A;  1BPM A;  1VGY A;  4FUU A;  1AYE A;  3KGQ A;  4MRI A;  1BLL E;  2AFU A;  4PPZ A;  2VL1 A;  2PIZ A;  1Z8L A;  3B7I A;  3HUV A;  3FX6 A;  5THW A;  3KQX A;  1LCP A;  4MCP A;  4MCQ A;  2PJ5 A;  3D7D A;  4P4E A;  4EME A;  1YSJ A;  2PJ0 A;  3BI1 A;  3IC1 A;  3SJE A;  3B3T A;  5K8M A;  3KZW A;  1UWY A;  3SJG A;  4PXC A;  3BXM A;  4PXD A;  5LRK A;  1HDU A;  5DS0 A;  5J1Q A;  3B35 A;  2DEA A;  3FED A;  1ZLH A;  4P10 A;  3IWW A;  3PB6 X;  2HB6 A;  2C6C A;  3S9N A;  3IJ3 A;  1PYT B;  1QQ9 A;  2PVW A;  3CT9 A;  2PJ7 A;  1YME A;  2CIJ A;  5JM6 A;  2AFX A;  3H8E A;  4P4J A;  4W9Y A;  5HVH A;  3VH9 A;  3CPX A;  4UEF A;  3SI0 A;  5LYF A;  1ZG9 A;  3PB7 X;  2EWB A;  2ZEH A;  4R76 A;  2ZOG A;  1Y0R A;  3N5F A;  2QVP A;  1YW6 A;  4PXB A;  4YWY A;  5HVG A;  3PRT A;  2IMO A;  3T8W A;  4CPA A;  5K8P A;  3K9T A;  2GU2 A;  2PJ3 A;  4JYW A;  3S9M A;  4MMO A;  4OC1 A;  2JBJ A;  3CDX A;  2RFH A;  4ZY2 A;  5I4M A;  2C1C A;  2V8G A;  3V38 A;  2EK8 A;  4DJL A;  2XEG A;  3PB4 X;  3MRU A;  4KSI A;  3KR5 A;  2Q51 A;  6CPA A;  4ZY0 A;  1HDQ A;  4X2T A;  3NH8 A;  2HC9 A;  4MXU A;  1F57 A;  3D66 A;  4ZI6 A;  3NH4 A;  1Z2L A;  2PCU A;  2J9A A;  3ISX A;  4NFR A;  4X8I A;  1LAM A;  3V7Z A;  3PBB A;  2XEF A;  4R8F A;  1LAP A;  4G1P A;  2NSM A;  1FNO A;  4OID A;  2ZEN A;  2PJ1 A;  5LRJ A;  2JBK A;  2BCO A;  4F9U A;  4A39 A;  2PJC A;  3KL9 A;  4UIB A;  5LYL A;  4UEZ A;  4F8Z A;  2PJ6 A;  4OC5 A;  3D4U A;  1RTQ A;  2AFO A;  1OBR A;  2ZOF A;  3IO1 A;  3I1U A;  5HXD A;  1XBU A;  4FAI A;  4H2K A;  1F2P A;  3D67 A;  4P4D A;  2NYQ A;  3GUX A;  5D29 A;  5CBM A;  2QJ8 A;  4A38 A;  2ZEF A;  3PFE A;  1ELM P; 
#chains in the Genus database with same CATH topology
 3K2K A;  4UF4 A;  1VQO 1;  4M85 A;  1VQP 1;  3QNV A;  1YJW Z;  3EY5 A;  4DNC A;  2B4D A;  3SI1 A;  1Z9U A;  5F48 A;  2C6P A;  3R1K A;  3C26 A;  4Z65 A;  4A31 A;  4UFX A;  3PFO A;  3MON A;  4UCM A;  4UIA A;  4UA3 A;  3MN8 A;  2KPI A;  4PSW A;  4KUA A;  3G3S A;  1KWM A;  3S17 I;  1KUY A;  4ZY1 A;  2Z3K A;  4EWT A;  3PO2 I;  1Z5R A;  4NGP A;  4P6Y A;  2ZEG A;  3HLP A;  2BO9 A;  2GLJ A;  2QEX Z;  4X3R A;  4NGS A;  4HKF A;  3NE7 A;  2JMO A;  3S14 I;  2P6G A;  4QUS A;  3HOW I;  1K9M 2;  1X10 A;  1K4J A;  3J81 b;  4FBE A;  2XEJ A;  3NH5 A;  4LX9 A;  4PQA A;  3Q87 A;  1S3Z A;  2J8R A;  1Z4E A;  3H8G A;  1M4L A;  4UBR A;  5JGF A;  4DYO A;  3VMI A;  1Q16 A;  2Q7S A;  2OR4 A;  3CCR 1;  2PVV A;  2R98 A;  1VQ8 Z;  2IQ6 A;  2QIR A;  2ZW7 A;  4E33 A;  3CC4 1;  1IYL A;  2FS5 A;  1P4N A;  3QWU A;  4O23 A;  3BHX A;  5J8F A;  5EC4 A;  3KI9 A;  1IOI A;  1WK4 A;  2LEX A;  4MFQ A;  4FD6 A;  4WJB A;  4MHY A;  2JIR A;  2BL1 A;  2J8N A;  3S6G A;  2OTL 1;  2CF4 A;  3WT4 A;  2JA7 I;  3GYA A;  1YIT 1;  4QVT A;  3H8F A;  2BOA A;  3MGD A;  4ZYQ A;  1FT7 A;  3D68 A;  3GCF A;  1BPN A;  2NVQ I;  1JWQ A;  2DPS A;  5DWN A;  1VQ5 Z;  3HOX I;  4F0X A;  3QAY A;  2CTB A;  3B3W A;  1YIJ 1;  5F47 A;  3KIF A;  3LOD A;  4NGR A;  2F4M A;  1TF9 A;  3VB9 A;  3HOU I;  2E9H A;  2PC1 A;  2E2J I;  5IT9 b;  3S16 I;  1W2B Z;  1VHO A;  4XPL A;  4NF1 A;  3RYO A;  3CCU 1;  2B5G A;  4E2W A;  2CNS A;  3P2H A;  3DLJ A;  3A9L A;  2IZ4 A;  4KOY A;  2M48 A;  4HPS A;  2R8V A;  4QTU A;  2DPT A;  2JEW A;  1ZG8 A;  4CL1 A;  5KTD A;  2NVY I;  3SXN A;  3SHP A;  4NGM A;  4HH4 A;  5K8N A;  2GE3 A;  3VAR A;  5IV0 A;  2YNE A;  2R6M A;  3VMG A;  1X3W A;  4KOT A;  1CM0 A;  4CYQ A;  5AN9 F;  3RO0 A;  3IGR A;  4OC2 A;  4QB9 A;  3D9X A;  3WC6 A;  1USP A;  3CXC Z;  5C82 A;  1RO5 A;  4MHD A;  4MCR A;  4JJX A;  3BJ8 A;  3S6F A;  2VPX A;  4RVG A;  1WWZ A;  1ZLI A;  3UY5 A;  8CPA A;  2EUI A;  1YHQ Z;  1Q2D A;  2WPW A;  2PE3 A;  1VQK Z;  1Z02 A;  4JXQ A;  4MY0 A;  3GKR A;  3CC2 1;  4R9M A;  3VWD A;  1YJ9 Z;  3I4N I;  2AFU A;  4UFV A;  3FBU A;  4AVB A;  3HUV A;  1S7N A;  2Z10 A;  5HMN A;  1S60 A;  4MCP A;  2PSW A;  1K8A 2;  1M44 A;  5AG4 A;  4P4E A;  4Q36 A;  3SJE A;  5D1P A;  3KZW A;  3PZJ A;  4PXD A;  5H84 A;  3PO3 S;  4XNH B;  4CGN A;  2BUE A;  3FED A;  2DEA A;  3IWW A;  4R57 A;  3PB6 X;  3TE5 B;  3ZZI A;  2C6C A;  4PSX A;  3TTH A;  4XPD C;  3KKW A;  2IV2 X;  3ZJ0 A;  1IID A;  3EXN A;  2AFX A;  4P4J A;  5HVH A;  1M4G A;  2B4B A;  3CPX A;  4UEF A;  2JNY A;  4MFK A;  2G0B A;  2JIO A;  4DK1 A;  1YLE A;  3N5F A;  3MZL B;  1YW6 A;  2KI7 B;  2PR8 A;  4YWY A;  1X3Z A;  3TO6 A;  4CPA A;  3T8W A;  4M6I A;  4U9Y A;  4MMO A;  2JBJ A;  2C1C A;  2V8G A;  1I12 A;  2EK8 A;  2Y0M A;  2EVN A;  1Q7Y 1;  1NMT A;  3MRU A;  2D4O A;  3W91 A;  2Q51 A;  3VWE A;  1RO4 A;  4ZY0 A;  1HDQ A;  2VPY A;  3NH8 A;  2V3V A;  2VEZ A;  4C7H A;  4MH4 A;  4MXU A;  3QAH A;  3V7Z A;  3PBB A;  5JQ4 A;  2OOY B;  5A27 A;  1Y9W A;  5F46 A;  2LIY A;  1J4J A;  2DE6 A;  2PJ1 A;  2BCO A;  4RVH A;  3S1R I;  2I79 A;  2OZK A;  3IU1 A;  4UIB A;  4UEZ A;  5AG5 A;  4OC5 A;  3CPW Z;  4II9 A;  2ARH A;  4A3L I;  1VQ9 Z;  5C3E I;  1S7L A;  1OBR A;  3G4S Z;  3CME 1;  4BMH A;  4NB8 A;  3FIX A;  5HXD A;  4E8O A;  4H2K A;  3D67 A;  5D29 A;  4CRY B;  5CBM A;  5FLX f;  4EWC A;  3SI2 A;  2Z3P A;  2ZEL A;  2OZU A;  1QVG Z;  1YJW 1;  2QYV A;  3F0A A;  4RV9 A;  3BJ7 A;  4PV6 A;  3RBU A;  1F2O A;  4BD9 A;  4NXY A;  2DXQ A;  3I56 Z;  1Q81 2;  1YLO A;  3VAT A;  4E2Z A;  3FF3 A;  2IJZ A;  1I50 I;  2FIA A;  2QKD A;  2WZN A;  4MON A;  3D3S A;  3W6S A;  2HF1 A;  2RBL A;  4KVO E;  3PGP A;  1IB1 E;  4CAE A;  3FVL A;  2QEX 1;  4JLY A;  5F09 A;  3DR6 A;  3DR8 A;  4Q38 A;  4CYO A;  4NJR A;  3J80 f;  3HOV I;  2ANP A;  3FKI I;  1YI2 Z;  4Q7A A;  3T4N B;  1NJI 1;  3F5B A;  2ZW5 A;  3J80 b;  4B5O A;  2EK9 A;  1VQM Z;  3I55 Z;  2QRD B;  4C7I A;  4JZ0 A;  4IF5 A;  3KAS A;  3DDD A;  3GY9 A;  2YNC C;  3G8W A;  1VQ8 1;  2PJB A;  4ONW A;  3K7A I;  1TKJ A;  3F3F C;  3SXO A;  1SIW A;  2Q04 A;  1SFO I;  4QC6 A;  2DE7 A;  1YX0 A;  4XX2 A;  4EFD A;  4Y49 C;  2Z3N A;  4CYP A;  3S1N I;  4CAF A;  5ELY A;  1KUV A;  1DE4 C;  3CCJ Z;  1ZG7 A;  2YND A;  1DTD A;  2WSA A;  4OME A;  4TNU A;  2WUU A;  4E2A A;  4DQY B;  1QSM A;  2EGT A;  4QBJ A;  4NBB A;  1QVF Z;  1PFT A;  2OTJ Z;  3FB3 A;  3GIU A;  3CCE Z;  1YRE A;  4Y7N I;  5GCN A;  2F8H A;  2QML A;  1Y1W I;  3KIH A;  1LOK A;  4KZT A;  3T90 A;  3I4M I;  2AFW A;  1VQ5 1;  3BLN A;  2PJ8 A;  4B12 A;  1TF8 A;  3IEH A;  4Y49 B;  4L8A A;  2DE5 A;  1W2B Y;  2O53 A;  5EMI A;  4E2Y A;  1ZB8 A;  1VQL Z;  5LYD A;  2R7H A;  4FWU A;  4MHZ A;  4A32 A;  4OIW A;  1Y7E A;  4ZX8 A;  4ZX9 A;  3CXQ A;  4LUA A;  4NGQ A;  1WII A;  4IAV A;  1Q82 2;  3PEI A;  4NGT A;  2FXF A;  1TFI A;  1R43 A;  2IZ3 A;  5KTC A;  1N8R 2;  3R9E A;  1NJI 2;  4A3J I;  2FSR A;  2Z3L A;  1YUA A;  1IY7 A;  3D2M A;  1ZO0 A;  4NBE A;  1P0H A;  1GYT A;  1WZN A;  3FEE A;  1S5K A;  2ZEM A;  2FVG A;  3GTK I;  5LRG A;  3D7G A;  2ZED A;  5G22 A;  1TXR A;  3JTK A;  4BBH A;  3B3V A;  1P9N A;  5G20 A;  4C68 A;  3CXC Y;  1L1O C;  3FH4 A;  4A3F I;  3FEC A;  3GTM I;  2REE A;  4E2X A;  1Q86 2;  3M3Y I;  3TC8 A;  4F0Y A;  4LQG A;  3WC5 A;  2PMZ A;  4WWV A;  2JIM A;  4CRZ B;  4CAW A;  4AXV A;  3FXT A;  2JUB A;  3S6K A;  1YHQ 1;  1ZH1 A;  1VQK 1;  2HQY A;  1BPM A;  1YJ9 1;  1N2F A;  4FUU A;  4NH1 C;  3I3G A;  2NMT A;  1AUG A;  3CD6 Z;  2PIZ A;  1Z8L A;  2YNC A;  3FX6 A;  5THW A;  1LCP A;  3H3V J;  4MCQ A;  2AYD A;  1K8A 1;  3S1Q I;  4EME A;  2BJO A;  1YSJ A;  3IC1 A;  4KSF A;  2WPX A;  4AB7 A;  4RVD A;  5K8M A;  4PXC A;  2EO8 A;  2BSW A;  3CCV Z;  2E2I I;  1HDU A;  1S7M A;  2CXA A;  2C27 A;  1MJA A;  3IJ3 A;  3EER A;  1PYT B;  3GTO I;  4L89 A;  3EO4 A;  5KTA A;  2R92 I;  5AG6 A;  2J8M A;  2PJ7 A;  1YME A;  2CIJ A;  2HU9 A;  3S2D I;  4PK3 A;  4RS2 A;  1LQL A;  3H8E A;  3VH9 A;  1ZG9 A;  2Q7B A;  2EWB A;  3CMA 1;  4R76 A;  2ZOG A;  3IF8 A;  3S2H I;  2OH1 A;  5HVG A;  1YUK A;  3K9T A;  2HV2 A;  2VZZ A;  2PJ3 A;  4YGO A;  4OC1 A;  3CDX A;  3M4O I;  1VQ4 Z;  5E96 A;  1NP6 A;  2P6E A;  4GS4 A;  1QSO A;  2EBJ A;  5DWM A;  3K9U A;  4A93 I;  2VQY A;  2CNT A;  1Q2C A;  3GTQ I;  2PR1 A;  4KSI A;  2OOX B;  2P3Y A;  1L0C A;  4XNH C;  1Z03 A;  3NH4 A;  4R87 A;  2J9A A;  4NFR A;  2NAP A;  2XEF A;  4ONU A;  1ON0 A;  5F49 A;  4R8F A;  1LAP A;  2NSM A;  4OID A;  3IFU A;  3CCQ Z;  2PM9 A;  3CPW Y;  2REF A;  3KL9 A;  5LYL A;  1FDO A;  1M4D A;  2PJ6 A;  1VQ9 1;  1Y1V I;  1Y1V S;  4NBG A;  2AFO A;  3G4S 1;  4KUB A;  2GFQ A;  3CCS Z;  4MBU A;  5T67 A;  3CCM Z;  4BBR I;  3I1U A;  1XBU A;  4FAI A;  1F2P A;  4P4D A;  1TWH I;  4S1T A;  2HUZ A;  4HNY B;  4KLW A;  4UCP A;  2D4P A;  3PFE A;  1KD1 2;  1QVG Y;  5LRJ A;  4CGO A;  1QST A;  2V8J A;  3RAM A;  3JRU A;  1ARL A;  1NUI A;  1FDI A;  2M6N A;  2AFM A;  2PJ4 A;  3IIB A;  4KLV A;  4AVC A;  3JAM f;  1QSN A;  2C6G A;  1ELL P;  2IL4 A;  3CQZ I;  1CPS A;  3I56 1;  2PIY A;  3KQZ A;  1XOV A;  4MD8 A;  3GTL I;  2ZAE B;  1Q81 1;  1QF8 A;  3CPA A;  1K73 2;  4YU9 A;  5C44 I;  3IR7 A;  3IFE A;  3OWC A;  1YQE A;  4OC0 A;  4B13 A;  4DUK A;  2VPW A;  2OB0 A;  2ZEE A;  4A95 A;  3F3P C;  2VF1 A;  2CTC A;  1RXT A;  4A37 A;  4IHM A;  1EE3 P;  1LAN A;  1GHE A;  5HVF A;  4P45 A;  3KHZ A;  3DGV A;  1Y7R A;  5D1O B;  3MZK B;  2QRC B;  2XEI A;  1DL6 A;  4HGZ A;  4NBD A;  2JIP A;  1YI2 1;  1CPX A;  5T64 A;  2V8H A;  3CZX A;  2QLV B;  4H6U A;  4MFP A;  3PBE A;  4BIN A;  3PB9 X;  1YW4 A;  1VQM 1;  1SQH A;  3I55 1;  2PJ9 A;  2I00 A;  4MHP A;  5IP7 I;  4E31 A;  5CPA A;  4A3G I;  4OAD A;  2GLF A;  4R7M A;  2Q43 A;  3R96 A;  2W04 A;  3BI0 A;  1R9T I;  2BEI A;  3GKQ A;  2GTH A;  3T9Y A;  2AFZ A;  5JPH A;  4IK2 A;  4A3B I;  1XEB A;  5JH9 A;  2ATR A;  7CPA A;  3DSB A;  3GB0 A;  2OOT A;  3I9S A;  2WB1 A;  3FQM A;  4H89 A;  4RVF A;  4B5P B;  2YAD A;  2GAN A;  3CCJ 1;  1JQG A;  2JIQ A;  5K8O A;  2I3C A;  1QYP A;  3LD2 A;  4J3G A;  1TWG I;  4C2Y A;  1S72 Z;  1QVF Y;  1BOB A;  1NSL A;  5LL6 f;  3GTJ I;  2P0W A;  1B6B A;  2OTJ 1;  3CCE 1;  5FLX b;  3FNC A;  4RUH A;  2K5R A;  1AMP A;  4UWJ A;  3F8K A;  4MD7 A;  4KS9 A;  4HNW B;  1CG2 A;  1AA6 A;  2WYR A;  1Q2Y A;  3GLJ A;  1RO2 A;  3D7H A;  2ABZ A;  4GXH A;  1VQN Z;  2LFU A;  4P4F A;  5ISV A;  4OP4 A;  2GTI A;  4BY7 I;  2FCK A;  2V77 A;  2QEC A;  5HH1 A;  1TIQ A;  1CX8 A;  2O28 A;  3DNS A;  1VQL 1;  3B2Y A;  1KQS Z;  4M6H A;  3FYN A;  3P5J B;  1Z8T A;  2B4D B;  1XRY A;  4EVY A;  2PK7 A;  4KOS A;  4NB9 A;  4KOU A;  1I21 A;  2FIW A;  4KOV A;  1Q82 1;  2O4H A;  4FD5 A;  4OC4 A;  1N8R 1;  2PRQ A;  3S6H A;  3CCL Z;  2Q4Y A;  2JS4 A;  1YJN Z;  1Y0Y A;  3S9L A;  1NE9 A;  3EFA A;  1KC8 1;  3NDI A;  2RB7 A;  1YVK A;  3FRM A;  5H86 A;  3EED A;  4DGL A;  1S7F A;  3G6E Z;  1RO0 A;  1KZF A;  2JDC A;  2K3R A;  1Q86 1;  2Q4Z A;  5IX3 A;  1YGH A;  3WC7 A;  3CXS A;  2G9D A;  4LQ6 A;  2OZH A;  3N7Z A;  4OKO A;  1VHE A;  1K83 I;  2DF5 A;  2H5M A;  5A2Q f;  4BXX I;  1VGY A;  3KGQ A;  1BLL E;  3CD6 1;  4HGY A;  3D2P A;  3RNZ A;  4OLL A;  4PPZ A;  4X6A I;  4FD7 A;  2VBQ A;  2G2K A;  2R93 I;  4Y52 I;  2JA6 I;  2PJ5 A;  2B63 I;  2QR1 B;  2FT0 A;  2PJ0 A;  2V45 A;  2ZW6 A;  1YVO A;  5IB0 A;  3CCV 1;  5LRK A;  3S15 I;  5J1Q A;  3H0G I;  3JVN A;  5IP9 I;  1OZP A;  3TOA A;  4NBH A;  1QQ9 A;  4UWI A;  2PVW A;  3CT9 A;  5JM6 A;  2CNM A;  2V8I A;  3IWG A;  1VQ7 Z;  4W9Y A;  1WJ2 A;  3SI0 A;  4BBS I;  1Y9K A;  2ZEH A;  1Y0R A;  3G71 Z;  5AGE A;  3NDJ A;  5G21 A;  1UFH A;  4PXB A;  3PRT A;  4KVM E;  2PDO A;  4KOX A;  5CM2 M;  2JEV A;  1B87 A;  4JYW A;  4C2Z A;  4U9Z A;  1VQ4 1;  3LAC A;  4ZY2 A;  3V38 A;  1Z8X A;  1ML8 A;  3J81 f;  4U5Y A;  2NVT I;  3V8I A;  2XEG A;  3FQQ A;  1RQF A;  3PB4 X;  1KC8 2;  2Y0S A;  2B5G B;  2OZG A;  4I49 A;  2P6F A;  2HC9 A;  3GTM S;  3D66 A;  1Z2L A;  2PCU A;  3ISX A;  4X8I A;  4NBA A;  1LAM A;  2E7Z A;  5G1Z A;  1YK3 A;  3IU2 A;  2QA4 Z;  2W03 A;  1QXF A;  5A28 A;  3CCQ 1;  1FNO A;  2QRE B;  1V0C A;  2ZXV A;  2ZEN A;  3QB8 A;  2JBK A;  4MFL A;  1TWF I;  4A39 A;  3D6W A;  2PJC A;  4F8Z A;  1VQ6 Z;  1IYK A;  2A4N A;  3W6X A;  1KUX A;  3D4U A;  1RTQ A;  3CCS 1;  1USP B;  3CC7 Z;  3CCM 1;  3IO1 A;  1XIX A;  3TFY A;  1Z4R A;  3TDH B;  4UCN A;  2R7Z I;  4C2X A;  2VXK A;  3D8P A;  3GUX A;  2QJ8 A;  2ZEF A;  1KD1 1;  1IIC A;  2X7B A;  1ELM P;  4CGM A;  3NA6 A;  1Y8C A;  1X12 A;  4F6A A;  4E30 A;  3E0K A;  2B3V A;  1VQO Z;  2F7V A;  1M90 1;  2FE7 A;  4MCS A;  1VQP Z;  4MHN A;  4UEE A;  4AG7 A;  2POK A;  5FVJ A;  2E2H I;  4KOR A;  4UFW A;  1IGB A;  3FMC A;  2Z3M A;  1A2Z A;  4B11 A;  1Z8W A;  3NE8 A;  1PUA A;  1K73 1;  2AFS A;  1M1D A;  4A3I I;  5IT9 f;  2OU2 A;  4JD6 A;  2NVX I;  3PP9 A;  2ZEP A;  4KVX A;  1XFO A;  4MJ8 A;  1NSA A;  1HEE A;  1RNI A;  3OW2 Y;  1XJO A;  4K30 A;  1PU9 A;  3VMH A;  1M4I A;  1JWH C;  5EBV A;  1JJ2 Y;  4R6T A;  3L2N A;  2K5T A;  5LYI A;  4A3K I;  2AKL A;  1BAV A;  1H8L A;  4PXE A;  4FD4 A;  4M3S A;  3RZO I;  4GM5 A;  1I1D A;  1R3N A;  2AJ6 A;  4ORF A;  2R1I A;  3KR4 A;  1QMU A;  4OAE A;  2RIQ A;  1VHS A;  3LWU A;  3D7F A;  4NEX A;  1R57 A;  3J7A 4;  4QTT A;  4R3K A;  4F9V A;  3CCR Z;  4CGL A;  1VKC A;  3CC4 Z;  3TT2 A;  2GIV A;  1LRZ A;  1PCA A;  1CP7 A;  3S1M I;  3KHX A;  4B6Z A;  2B3U A;  3VTN A;  2PJ2 A;  1XE4 A;  1M1K 1;  4MY3 A;  3U50 C;  3HOY I;  1ARM A;  3P2F A;  2VZY A;  2Z11 A;  4CS0 B;  3IWE A;  3I07 A;  2JLM A;  4NOZ A;  1S72 1;  2G3A A;  1XMB A;  1I6H I;  2Q4V A;  4CGP A;  4M6G A;  4ZBG A;  2OTL Z;  1M90 2;  1MJB A;  1MK4 A;  2ZW4 A;  1TKH A;  1YIT Z;  2YU9 I;  4A33 A;  4PK2 A;  1VIX A;  4NSQ A;  2B58 A;  3SJF A;  2JA5 I;  3PO3 I;  4NJQ A;  1I3Q I;  4B10 A;  1VQN 1;  4P44 A;  3JAM b;  1TKF A;  5IB9 A;  1XMT A;  4P4B A;  3B3S A;  3RZD I;  4A94 A;  5CNP A;  3ISZ A;  4X5K A;  4R3L A;  1FY7 A;  2V8V A;  1YIJ Z;  1KQS Y;  4CAX A;  2G3T A;  2RPR A;  3TX8 A;  5D8N A;  3RZA A;  2VI7 A;  3WAB A;  2PJA A;  3CCU Z;  3CMA Z;  4P4I A;  3TOB A;  3OW2 Z;  1TWA I;  3LMS A;  3HOZ I;  4IUS A;  3H5Z A;  4NGN A;  2VPZ A;  1JJ2 Z;  4AG9 A;  1IOF A;  4RI1 A;  3CCL 1;  1CBX A;  3SJX A;  1ZB9 A;  3IX0 A;  1YJN 1;  2ZEO A;  2V8D A;  4K3N A;  3PB8 X;  4MFJ A;  4NCZ A;  4OC3 A;  2VUG A;  2JA8 I;  3TO7 A;  1LFW A;  1CP6 A;  4KSA A;  3NFZ A;  4XPD B;  3G6E 1;  4BY1 I;  2PRB A;  1MJ9 A;  3B3C A;  1IU8 A;  2P28 A;  3FJU A;  4NBC A;  2GRE A;  3TE4 A;  4MFZ A;  3TO9 A;  1RLY A;  2J6A A;  2JR6 A;  4A30 A;  4CAV A;  3JUW A;  2V8K A;  1Q7L A;  1M1K 2;  2Q44 A;  4TWE A;  2JDD A;  2Q0Y A;  3CC2 Z;  4A3C I;  1AYE A;  4MD9 A;  2F5I A;  4MRI A;  5J8C A;  2VL1 A;  3B7I A;  3BG1 B;  2ODF A;  3KQX A;  1YR0 A;  1QSR A;  5I0C A;  2KCW A;  3GTG I;  3D7D A;  4CYN A;  5T6B A;  4A3D I;  2RHB A;  3BI1 A;  3B3T A;  3LUS A;  1UWY A;  1TWC I;  3SJG A;  4A3E I;  3BXM A;  4RN7 A;  4AVA A;  5DS0 A;  2ZPA A;  2CY2 A;  3B35 A;  4P10 A;  1ZLH A;  4JWP A;  1BO4 A;  2FL4 A;  2HB6 A;  2Z0Z A;  3S9N A;  4B14 A;  5D1O A;  1WCM I;  4MI4 A;  3EC4 A;  5FLM I;  2Z3O A;  4YFJ A;  1Z01 A;  1VQ7 1;  1U6M A;  5LYF A;  1X0T A;  3PB7 X;  3G71 1;  2H85 A;  2QVP A;  4JXR A;  3TCV A;  4YRH A;  2IMO A;  5K8P A;  2WAQ A;  2GU2 A;  3BG0 B;  5C4X I;  3S9M A;  4A2Z A;  4A3M I;  3R95 A;  4NBF A;  2RFH A;  5I4M A;  3GTP I;  1N71 A;  4ZGY B;  3CXP A;  4DJL A;  5C4J I;  1S7K A;  1WW9 A;  2AE6 A;  1Q7Y 2;  1K9M 1;  3KR5 A;  4E0A A;  2RC4 A;  6CPA A;  4X2T A;  1VLA A;  4KOW A;  5C88 A;  1F57 A;  4B5P A;  4ZI6 A;  2PQ8 A;  5BWA B;  2QA4 1;  3R9G A;  4RS4 A;  3B8G A;  3H4Q A;  1KRL A;  3D2L A;  1XF8 A;  3HKZ A;  4G1P A;  3R9F A;  2RT9 A;  4H6Z A;  5AG7 A;  2YGW A;  4XPK A;  4AYB A;  4F9U A;  2VUM I;  4E32 A;  3ESW A;  1VQ6 1;  3WR7 A;  5A2Q b;  1CJW A;  3CC7 1;  2ZOF A;  4HNX B;  3CME Z;  2NYQ A;  2F4O A;  4A38 A; 
#chains in the Genus database with same CATH homology
 2V8J A;  3NA6 A;  4EWC A;  3K2K A;  4E30 A;  3SI2 A;  4UF4 A;  1VQO 1;  3RAM A;  2ZEL A;  3JRU A;  1QVG Z;  1ARL A;  1VQO Z;  1VQP 1;  2F7V A;  1YJW 1;  1NUI A;  2M6N A;  1M90 1;  2AFM A;  2QYV A;  3QNV A;  1VQP Z;  4MCS A;  4RV9 A;  1YJW Z;  4MHN A;  4UEE A;  2PJ4 A;  3IIB A;  2POK A;  3SI1 A;  3JAM f;  3RBU A;  2E2H I;  2C6G A;  1ELL P;  3CQZ I;  1CPS A;  1F2O A;  4BD9 A;  2C6P A;  3I56 1;  2PIY A;  3KQZ A;  4MD8 A;  3GTL I;  3I56 Z;  1IGB A;  4Z65 A;  2ZAE B;  1Q81 1;  1Q81 2;  3FMC A;  3PFO A;  3MON A;  1QF8 A;  3CPA A;  1K73 1;  1K73 2;  4YU9 A;  1YLO A;  2AFS A;  3VAT A;  4E2Z A;  4UIA A;  5C44 I;  3FF3 A;  2IJZ A;  1I50 I;  3MN8 A;  3IFE A;  2KPI A;  4A3I I;  2QKD A;  5IT9 f;  2WZN A;  4OC0 A;  4DUK A;  2NVX I;  4MON A;  2ZEE A;  2ZEP A;  3F3P C;  1KWM A;  2VF1 A;  3S17 I;  2CTC A;  2HF1 A;  1XFO A;  4A37 A;  4IHM A;  2RBL A;  4ZY1 A;  1NSA A;  1EE3 P;  4EWT A;  1LAN A;  3PO2 I;  1Z5R A;  4P45 A;  1HEE A;  3KHZ A;  5HVF A;  4NGP A;  1RNI A;  3OW2 Y;  3DGV A;  5D1O B;  4P6Y A;  3MZK B;  2ZEG A;  2QRC B;  3HLP A;  3FVL A;  2BO9 A;  2QEX 1;  1XJO A;  2XEI A;  2GLJ A;  5F09 A;  2QEX Z;  3VMH A;  1DL6 A;  1JWH C;  4X3R A;  1JJ2 Y;  4NGS A;  4R6T A;  4HGZ A;  2JMO A;  4NBD A;  3L2N A;  5LYI A;  3S14 I;  4A3K I;  4NJR A;  3J80 f;  2AKL A;  1YI2 1;  3HOV I;  1BAV A;  2ANP A;  3FKI I;  1YI2 Z;  1CPX A;  5T64 A;  2V8H A;  1H8L A;  3T4N B;  4Q7A A;  1NJI 1;  2QLV B;  1KD1 2;  3HOW I;  1K9M 2;  3J81 b;  4PXE A;  3J80 b;  2XEJ A;  3PBE A;  3PB9 X;  3RZO I;  4FBE A;  1YW4 A;  3NH5 A;  2EK9 A;  4PQA A;  4GM5 A;  1VQM 1;  3I55 1;  2PJ9 A;  1R3N A;  3Q87 A;  1VQM Z;  3I55 Z;  4MHP A;  2QRD B;  5IP7 I;  4E31 A;  3KR4 A;  5CPA A;  1QMU A;  4A3G I;  1M4L A;  3H8G A;  2RIQ A;  4JZ0 A;  5JGF A;  2GLF A;  4R7M A;  3KAS A;  2Q43 A;  3LWU A;  4DYO A;  3D7F A;  3J7A 4;  3VMI A;  2W04 A;  4QTT A;  3BI0 A;  2OR4 A;  4ONW A;  1VQ8 1;  3CCR 1;  2PJB A;  2PVV A;  4F9V A;  3K7A I;  1R9T I;  1VQ8 Z;  3CCR Z;  2IQ6 A;  3GKQ A;  2GTH A;  1TKJ A;  4E33 A;  3CC4 1;  3F3F C;  2AFZ A;  3CC4 Z;  4IK2 A;  1SFO I;  4A3B I;  5JH9 A;  1PCA A;  3QWU A;  1CP7 A;  3S1M I;  3KHX A;  4B6Z A;  7CPA A;  2DE7 A;  3VTN A;  2PJ2 A;  4O23 A;  4XX2 A;  3GB0 A;  4EFD A;  2OOT A;  2WB1 A;  1M1K 1;  3BHX A;  3FQM A;  3S1N I;  4RVF A;  3U50 C;  5ELY A;  2YAD A;  3HOY I;  1ARM A;  3KI9 A;  3CCJ 1;  1DE4 C;  3CCJ Z;  1ZG7 A;  1JQG A;  5K8O A;  2I3C A;  4WJB A;  1QYP A;  4MHY A;  3I07 A;  4NOZ A;  1S72 1;  1TWG I;  1XMB A;  1I6H I;  1DTD A;  1S72 Z;  1QVF Y;  4OME A;  4TNU A;  5LL6 f;  3GTJ I;  2OTL 1;  4DQY B;  2EGT A;  2OTL Z;  4NBB A;  2OTJ 1;  2CF4 A;  3CCE 1;  1QVF Z;  1PFT A;  2OTJ Z;  5FLX b;  1M90 2;  3WT4 A;  2JA7 I;  3CCE Z;  4RUH A;  4Y7N I;  2K5R A;  1YIT 1;  2F8H A;  3H8F A;  2BOA A;  1TKH A;  1YIT Z;  2YU9 I;  4ZYQ A;  1AMP A;  1FT7 A;  1VIX A;  1Y1W I;  3KIH A;  3SJF A;  4MD7 A;  1LOK A;  2JA5 I;  3PO3 I;  3D68 A;  3I4M I;  1CG2 A;  3GCF A;  2AFW A;  1BPN A;  2NVQ I;  2WYR A;  3GLJ A;  1VQ5 1;  4NJQ A;  1I3Q I;  1RO2 A;  3D7H A;  1VQN 1;  4P44 A;  1VQ5 Z;  3JAM b;  1TKF A;  2ABZ A;  5IB9 A;  1VQN Z;  3HOX I;  2PJ8 A;  2LFU A;  4P4B A;  3B3S A;  3RZD I;  4P4F A;  4A94 A;  1TF8 A;  3ISZ A;  3IEH A;  2CTB A;  3B3W A;  1YIJ 1;  4OP4 A;  2GTI A;  4BY7 I;  2V77 A;  2V8V A;  3KIF A;  1YIJ Z;  1KQS Y;  2DE5 A;  1W2B Y;  2O53 A;  2F4M A;  4NGR A;  1TF9 A;  1CX8 A;  2RPR A;  3VB9 A;  1VQL 1;  2E9H A;  3HOU I;  4E2Y A;  3TX8 A;  2E2J I;  5IT9 b;  1KQS Z;  1ZB8 A;  1VQL Z;  3B2Y A;  5D8N A;  5LYD A;  3RZA A;  3S16 I;  4FWU A;  1W2B Z;  1VHO A;  4MHZ A;  3P5J B;  1XRY A;  3CCU 1;  4OIW A;  2PK7 A;  1Y7E A;  3WAB A;  4NB9 A;  4E2W A;  2PJA A;  3CCU Z;  4ZX8 A;  4ZX9 A;  4NGQ A;  3CMA Z;  4P4I A;  1WII A;  3OW2 Z;  1TWA I;  3LMS A;  4IAV A;  3HOZ I;  1Q82 1;  1Q82 2;  3DLJ A;  3PEI A;  2IZ4 A;  4NGT A;  2M48 A;  1TFI A;  1R43 A;  4QTU A;  2JEW A;  2IZ3 A;  2O4H A;  4NGN A;  4OC4 A;  1JJ2 Z;  1N8R 1;  1N8R 2;  1NJI 2;  1ZG8 A;  4A3J I;  4CL1 A;  1YUA A;  2PRQ A;  2NVY I;  3CCL 1;  1IY7 A;  1CBX A;  3SJX A;  1ZB9 A;  4NGM A;  3CCL Z;  4HH4 A;  5K8N A;  4NBE A;  3IX0 A;  1YJN 1;  3VAR A;  2JS4 A;  2ZEO A;  1YJN Z;  2V8D A;  4K3N A;  2R6M A;  1GYT A;  1Y0Y A;  3PB8 X;  3S9L A;  3FEE A;  2ZEM A;  3VMG A;  1X3W A;  3GTK I;  2FVG A;  4OC3 A;  5LRG A;  3D7G A;  2ZED A;  2VUG A;  5AN9 F;  2JA8 I;  1TXR A;  1LFW A;  1CP6 A;  1KC8 1;  3NDI A;  2RB7 A;  3NFZ A;  3B3V A;  1P9N A;  3G6E 1;  3CXC Y;  3EED A;  4DGL A;  3G6E Z;  1L1O C;  3FH4 A;  4A3F I;  3FEC A;  1RO0 A;  4OC2 A;  3GTM I;  3D9X A;  4BY1 I;  2K3R A;  3WC6 A;  1USP A;  3CXC Z;  4E2X A;  1Q86 1;  1Q86 2;  3B3C A;  2Q4Z A;  2P28 A;  3M3Y I;  3FJU A;  4NBC A;  2GRE A;  3TC8 A;  3WC7 A;  4MCR A;  4LQG A;  3WC5 A;  2PMZ A;  2G9D A;  4WWV A;  1RLY A;  2J6A A;  2JR6 A;  4RVG A;  1ZLI A;  2JUB A;  4OKO A;  4AXV A;  2V8K A;  1Q7L A;  1M1K 2;  1YHQ 1;  8CPA A;  1VHE A;  1ZH1 A;  1VQK 1;  1YHQ Z;  4TWE A;  2PE3 A;  1K83 I;  1VQK Z;  1Z02 A;  1BPM A;  5A2Q f;  4BXX I;  3CC2 1;  1YJ9 1;  1VGY A;  1N2F A;  4FUU A;  3CC2 Z;  4A3C I;  1AYE A;  4NH1 C;  1YJ9 Z;  4MD9 A;  3I4N I;  3KGQ A;  4MRI A;  1BLL E;  2AFU A;  3CD6 1;  4HGY A;  3CD6 Z;  4PPZ A;  2VL1 A;  2PIZ A;  4X6A I;  1Z8L A;  3B7I A;  3HUV A;  3FX6 A;  5THW A;  3BG1 B;  3KQX A;  2G2K A;  1LCP A;  4MCP A;  3H3V J;  3GTG I;  2R93 I;  4Y52 I;  2JA6 I;  2PJ5 A;  3D7D A;  1K8A 1;  1K8A 2;  2B63 I;  4MCQ A;  3S1Q I;  2QR1 B;  5T6B A;  2BJO A;  4A3D I;  2RHB A;  4P4E A;  4EME A;  1YSJ A;  2PJ0 A;  3BI1 A;  3IC1 A;  3SJE A;  5D1P A;  3B3T A;  3LUS A;  5K8M A;  3KZW A;  4RVD A;  1TWC I;  1UWY A;  4A3E I;  3BXM A;  3CCV 1;  4PXC A;  4PXD A;  3SJG A;  3CCV Z;  2E2I I;  1HDU A;  5LRK A;  3S15 I;  5DS0 A;  1S7M A;  3PO3 S;  5J1Q A;  3B35 A;  2DEA A;  3H0G I;  1ZLH A;  3FED A;  4P10 A;  3IWW A;  3PB6 X;  3TE5 B;  2HB6 A;  5IP9 I;  2C6C A;  3S9N A;  3IJ3 A;  3EER A;  1PYT B;  3GTO I;  4NBH A;  5D1O A;  1QQ9 A;  1WCM I;  2R92 I;  2PVW A;  3CT9 A;  2PJ7 A;  5FLM I;  1YME A;  2CIJ A;  2HU9 A;  3S2D I;  5JM6 A;  1LQL A;  1Z01 A;  1VQ7 1;  2V8I A;  2AFX A;  3H8E A;  4P4J A;  1VQ7 Z;  4W9Y A;  5HVH A;  3VH9 A;  3CPX A;  4UEF A;  3SI0 A;  5LYF A;  2JNY A;  1X0T A;  1ZG9 A;  4BBS I;  3PB7 X;  2EWB A;  3CMA 1;  2ZEH A;  4R76 A;  3G71 1;  2ZOG A;  4DK1 A;  1Y0R A;  3N5F A;  3IF8 A;  2H85 A;  3S2H I;  3G71 Z;  3MZL B;  2QVP A;  1YW6 A;  3NDJ A;  2KI7 B;  4PXB A;  4YWY A;  5HVG A;  1X3Z A;  3PRT A;  2IMO A;  3T8W A;  4CPA A;  5K8P A;  1YUK A;  3K9T A;  2WAQ A;  5CM2 M;  2GU2 A;  2PJ3 A;  4JYW A;  3BG0 B;  5C4X I;  3S9M A;  4MMO A;  1VQ4 1;  4OC1 A;  2JBJ A;  4A3M I;  3CDX A;  4NBF A;  1VQ4 Z;  3M4O I;  3GTP I;  2RFH A;  4ZY2 A;  2C1C A;  5I4M A;  1NP6 A;  2V8G A;  3V38 A;  2EK8 A;  1ML8 A;  3J81 f;  2NVT I;  4DJL A;  5C4J I;  4A93 I;  2XEG A;  3FQQ A;  1WW9 A;  1Q7Y 1;  1Q7Y 2;  1RQF A;  3PB4 X;  1KC8 2;  3MRU A;  2Y0S A;  3GTQ I;  4KSI A;  1K9M 1;  3KR5 A;  2OOX B;  2Q51 A;  2P3Y A;  1RO4 A;  6CPA A;  4ZY0 A;  1HDQ A;  4X2T A;  1VLA A;  3NH8 A;  2HC9 A;  4MH4 A;  4MXU A;  3GTM S;  1Z03 A;  1F57 A;  3D66 A;  4ZI6 A;  3NH4 A;  1Z2L A;  2PCU A;  2J9A A;  3ISX A;  4NFR A;  4X8I A;  4NBA A;  1LAM A;  2QA4 1;  3V7Z A;  3PBB A;  4RS4 A;  2QA4 Z;  2XEF A;  2OOY B;  2W03 A;  1KRL A;  4R8F A;  2LIY A;  3HKZ A;  1LAP A;  4G1P A;  2NSM A;  2RT9 A;  3CCQ 1;  1FNO A;  4OID A;  2QRE B;  3IFU A;  3CCQ Z;  2DE6 A;  2ZEN A;  2PJ1 A;  5LRJ A;  4AYB A;  2JBK A;  2BCO A;  2PM9 A;  4RVH A;  3S1R I;  4F9U A;  3CPW Y;  2VUM I;  1TWF I;  4A39 A;  4E32 A;  3ESW A;  3D6W A;  2PJC A;  2OZK A;  1VQ6 1;  3KL9 A;  4UIB A;  5LYL A;  4UEZ A;  4F8Z A;  1VQ6 Z;  5A2Q b;  2PJ6 A;  1VQ9 1;  4OC5 A;  1Y1V I;  3CPW Z;  4A3L I;  1VQ9 Z;  1Y1V S;  3CC7 1;  5C3E I;  3CCS 1;  1RTQ A;  4NBG A;  2AFO A;  3D4U A;  3G4S 1;  1USP B;  1OBR A;  3CC7 Z;  3CCS Z;  3CCM 1;  3G4S Z;  2ZOF A;  3IO1 A;  5T67 A;  3CME 1;  4BBR I;  3CCM Z;  4NB8 A;  3I1U A;  3CME Z;  5HXD A;  1XBU A;  4FAI A;  3TDH B;  4H2K A;  1F2P A;  3D67 A;  1TWH I;  4S1T A;  2NYQ A;  2R7Z I;  4P4D A;  3GUX A;  5D29 A;  5CBM A;  2F4O A;  2QJ8 A;  5FLX f;  4A38 A;  2ZEF A;  1KD1 1;  1QVG Y;  3PFE A;  1ELM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...