2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspa protein
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
5LYDA 4P4EA 4NGSA 1CP7A 2OR4A 1F57A 4ZY0A 3RAMA 2ZEFA 3B2YA 5HVGA 3SI1A 4OC3A 2BOAA 3T8WA 1TKHA 3WC5A 2ZEDA 2AFWA 4WWVA 5JM6A 4UEEA 3PB7X 1QQ9A 3K2KA 3S9LA 4UEZA 4W9YA 4BD9A 2FVGA 3V38A 3NH5A 1Y0YA 2G9DA 4K3NA 2V8HA 2QVPA 2BO9A 4F8ZA 2EWBA 1ELMP 3FECA 4PXCA 3KQZA 5JH9A 5LYIA 3PFEA 2PJ3A 3SJXA 2AFSA 2CIJA 4UEFA 3PFOA 3S9NA 4P4BA 1AYEA 4Q7AA 3D7HA 3GLJA 4ONWA 4PQAA 1H8LA 2ZEGA 3PEIA 2V8DA 4R76A 2ZENA 3KR4A 2ZEEA 3HUVA 1ZG9A 2AFMA 2XEGA 3JRUA 4DJLA 2PJ2A 1YLOA 1F2PA 5DS0A 3NH8A 3SJFA 4R6TA 3L2NA 3FX6A 5D8NA 2PCUA 4FBEA 1LCPA 4WJBA 1EE3P 7CPAA 3DLJA 4A39A 1TKJA 3D68A 2PJ7A 1FNOA 2BCOA 4PXEA 4MHZA 3CPAA 4UF4A 4R7MA 5ELYA 3BXMA 1CBXA 3B3WA 4MCPA 2F7VA 2HC9A 2DEAA 1VHEA 4MHYA 4MRIA 2JEWA 3B3CA 1QMUA 2AFOA 1JQGA 2C6PA 3SJGA 1ZG7A 1RTQA 2PVVA 2AFZA 3PBBA 3IFEA 4O23A 3S9MA 4NGQA 1YSJA 3FEEA 4OIDA 4MCQA 4FUUA 3LMSA 5LRJA 2AFXA 1PYTB 2ZOFA 3RZAA 3B3SA 1UWYA 1R43A 2I3CA 3SI2A 3B3TA 2Q4ZA 3CPXA 3IIBA 4MHPA 1HDUA 4IK2A 1XRYA 4X2TA 4KSIA 1CPXA 2EK9A 4OMEA 1VIXA 4TWEA 1CPSA 1IGBA 1Z2LA 3D4UA 4PPZA 5CPAA 3PB8X 2C6CA 3KGQA 8CPAA 4P4JA 4MXUA 2PJAA 3KHXA 4X3RA 3ISXA 3N5FA 1M4LA 2ABZA 3LWUA 3DGVA 3VH9A 4OC0A 1OBRA 2PJBA 4EMEA 3PB9X 4ZX8A 1HDQA 1BAVA 2CTBA 2CTCA 2PJ8A 4YU9A 4A37A 4NJQA 5K8OA 2WYRA 2WZNA 4JYWA 3FH4A 2GLFA 1TF9A 2PJ9A 4PXDA 2PVWA 6CPAA 3VARA 1LOKA 4NGPA 4OC1A 3IWWA 3NFZA 3CT9A 1NSAA 3WC6A 3WT4A 3D67A 1ARLA 4X8IA 4IHMA 4OIWA 4NGMA 3IJ3A 2HB6A 4PXBA 4DYOA 1KWMA 2PRQA 2VL1A 2IMOA 2J9AA 1LFWA 1XJOA 2O53A 1CP6A 4AXVA 3SI0A 4ZI6A 2ANPA 2ZEMA 1XBUA 4NGTA 4NGNA 2RB7A 2ZEOA 3KR5A 2QJ8A 5K8NA 3FF3A 2GREA 3FMCA 5K8PA 3CDXA 4B6ZA 4FAIA 3KZWA 4TNUA 4OC5A 3BI1A 5CBMA 1CG2A 2PJ6A 4MCRA 1PCAA 3KASA 1Z5RA 2JBKA 2O4HA 3K9TA 1Y0RA 2F8HA 2XEIA 4ZYQA 3BHXA 1F2OA 5J1QA 4EFDA 3D66A 2PIYA 5F09A 5LYFA 2PE3A 3IC1A 2PJCA 2ZELA 5THWA 3IO1A 4G1PA 5D29A 1ZG8A 4FWUA 4EWTA 4OP4A 2XEJA 3PB6X 1CX8A 2XEFA 3PBEA 4LQGA 4ZY2A 3KL9A 4UIAA 4ZY1A 1YMEA 2POKA 1ZLIA 3H8FA 3D7FA 3RBUA 4P6YA 3FVLA 2CF4A 5LRKA 4P4IA 4DUKA 3QNVA 1HEEA 2PJ5A 4ZX9A 2PIZA 4MMOA 2OOTA 4OKOA 3NA6A 2EK8A 1VHOA 2PJ0A 2V77A 5IB9A 5LRGA 4P4FA 5JGFA 1YW4A 2C1CA 2PJ4A 1IY7A 2ZEPA 3BI0A 4F9VA 4RUHA 4A94A 5HVFA 5K8MA 2IQ6A 1BLLE 4MCSA 4OC4A 3HLPA 1YW6A 4NJRA 3KI9A 3B7IA 3WC7A 2C6GA 1ELLP 3GB0A 4GM5A 1LANA 3I1UA 2V8GA 4NGRA 2V8VA 3MN8A 2AFUA 3B3VA 3D7GA 2GU2A 3FJUA 1ZLHA 3V7ZA 1BPNA 3VATA 4MHNA 2PJ1A 2Q43A 3KQXA 4IAVA 4CPAA 1Z8LA 3FEDA 1AMPA 2JBJA 4P45A 3IEHA 1BPMA 1GYTA 3GUXA 3H8GA 1ARMA 3H8EA 2QYVA 3ISZA 1TKFA 1TF8A 1XFOA 4P44A 4F9UA 2IJZA 4A38A 1DTDA 2ZOGA 3TX8A 4P10A 4JZ0A 3NH4A 1Y7EA 1XMBA 2ZEHA 3MRUA 4P4DA 1LAPA 3B35A 3PRTA 2NYQA 2RFHA 3TC8A 1FT7A 5HXDA 3WABA 4R8FA 5HVHA 3KHZA 1R3NA 1LAMA 1VGYA 4NFRA 2Q51A 1TXRA 3D7DA 4H2KA 4UIBA 1DE4C 3PB4X 2NSMA 1Q7LA 5I4MA 4YWYA 4Z65A 4OC2A 2GLJA 5LYLA 3SJEA
chains in the Genus database with same CATH superfamily
2QKDA 1KUXA 2R6MA 3RAMA 2B5GB 4CGMA 3B2YA 3D2LA 5HVGA 2QA41 4MFKA 3SI1A 4I49A 2BOAA 1YLEA 2ZEDA 2VUGA 5AG6A 1M1K2 1QQ9A 2E2JI 3I551 5T64A 4PK2A 4LX9A 4HNYB 3SHPA 3V38A 3NH5A 2G9DA 3HOWI 2FL4A 5LYIA 2PJ3A 2AFSA 2CIJA 5IV0A 4B12A 2NVQI 5FLMI 2OTLZ 1WWZA 1MJAA 5C88A 3TO9A 1XIXA 2ZW4A 4PQAA 1H8LA 1X3WA 1QVGY 3KR4A 5T6BA 1K731 4Y7NI 3TCVA 3A9LA 1R9TI 5EMIA 2XEGA 3JRUA 4UFXA 1YLOA 1SFOI 3CPWY 5DS0A 4H6ZA 3GTKI 3TDHB 4R6TA 1JWQA 3S15I 1P9NA 4FBEA 1WK4A 1L1OC 3GTQI 4MFQA 3MGDA 4Q36A 1MJBA 2QRDB 2BCOA 2QREB 4A31A 1Q821 1YJN1 2E2II 1VQN1 2VPWA 5ELYA 1I1DA 3ESWA 4A3MI 1CBXA 2DEAA 3GYAA 4MHYA 5AG7A 4QBJA 4MRIA 5C3EI 2JEWA 4XPLA 2AFOA 3T4NB 2F4OA 3JVNA 3CMAZ 2Z0ZA 2PVVA 3IFEA 3VB9A 1YSJA 2GANA 2DE7A 4MCQA 4FUUA 2BEIA 4KOUA 3R9FA 4HGZA 3TOAA 3IWGA 4MFZA 3CCS1 2DE5A 4MFLA 2I3CA 3CC4Z 3B3TA 3S1MI 1YGHA 3CPXA 4XNHB 2Z11A 2JS4A 4MHPA 1QVFY 1XRYA 3P2FA 5DWMA 1CPSA 3H5ZA 5C4JI 3NDJA 4CAWA 2C6CA 4OADA 8CPAA 1Q16A 4E32A 1NJI2 3CCV1 1S7FA 2PJAA 3KHXA 3CCRZ 4X3RA 2HQYA 1RLYA 4LQ6A 3VH9A 5A2Qb 4OC0A 3GTMI 2JEVA 1TIQA 3EFAA 4UWJA 2FSRA 3FRMA 3B8GA 3R95A 4M85A 4ZX8A 1HDQA 2ARHA 3NE8A 2E9HA 2WZNA 3GKRA 2GLFA 3OWCA 4PXDA 1I50I 4R3KA 6CPAA 3LD2A 4F0XA 4OC1A 4KSFA 1YVKA 1M901 2JUBA 2P6GA 4MFJA 4U9YA 1BO4A 4OIWA 4NGMA 4A3II 4FD6A 3TOBA 1P4NA 2FT0A 2P3YA 3CXCZ 2W03A 2ANPA 3RNZA 2VXKA 2YNCA 3QB8A 4MD9A 2Z3NA 2HF1A 3FQQA 3CC2Z 5FLXf 5CBMA 3I3GA 1Z5RA 4UFWA 4LUAA 2JBKA 4NH1C 4UCPA 1Y0RA 4E2YA 4ZYQA 5A27A 3P5JB 4JJXA 2OZUA 2PR1A 4EFDA 4R3LA 4CYPA 1QSNA 3PGPA 1Q2DA 4G1PA 4FWUA 3EEDA 3KL9A 1SQHA 2ZW7A 3M3YI 1KUVA 2OU2A 3CCMZ 4IF5A 2J8NA 3H8FA 3PO3I 4ZGYB 3D7FA 1VQ61 3FVLA 1K8A1 4CL1A 4P4IA 2ZW5A 1ZO0A 2YNEA 4ZX9A 2LFUA 2PIZA 4MMOA 3NA6A 3IR7A 4UWIA 5IB9A 1QVFZ 3D6WA 2PQ8A 1Y1WI 1YW4A 5EBVA 2P0WA 1TWHI 1IY7A 1NE9A 2FS5A 2R93I 2DF5A 3WR7A 4KVME 2R8VA 3CXPA 3RZOI 1Z4RA 5K8MA 1M4GA 4B14A 1IOFA 3H4QA 3F5BA 4OC4A 4BY1I 1YW6A 3WC7A 2I79A 1KQSY 1ELLP 3GB0A 2Q0YA 4E8OA 4KZTA 3FXTA 1M1DA 2Q04A 2V8GA 4NGRA 3GIUA 3MN8A 5AGEA 1YREA 1Q2YA 2GU2A 1N71A 3V7ZA 3CMEZ 1YITZ 1BPNA 4DK1A 3I56Z 3VATA 3GY9A 3IEHA 1BPMA 3GUXA 3H8GA 4M6HA 1Z01A 4RI1A 1TKFA 1TF8A 3D3SA 4UFVA 4F9UA 4A38A 4C7HA 3TX8A 4BY7I 1Y7EA 1L0CA 3TE4A 2ZEHA 4UBRA 1X10A 3MRUA 2VPYA 1KC81 5G20A 4NB8A 5HXDA 1FDOA 1K83I 4MONA 5AG5A 3D7DA 1S3ZA 2NSMA 5I4MA 2JIQA 4JD6A 4DQYB 4Z65A 4OC2A 5LYLA 2AE6A 5KTDA 5LYDA 4P4EA 5ISVA 1CP7A 1F57A 5IP7I 1VQ91 1JJ2Y 1WJ2A 2H85A 1R57A 4WWVA 4UEEA 2B5GA 1TWFI 3K2KA 4PV6A 5I0CA 5T67A 2FIAA 4UEZA 3EY5A 2KCWA 4BD9A 2FVGA 2EUIA 1ZH1A 2V8HA 1CJWA 4AVAA 4PXCA 3SXOA 3FNCA 4BMHA 4NBFA 1YUKA 1VQ41 2FIWA 2NMTA 3PFOA 5H86A 3IFUA 4DGLA 3GCFA 2IZ3A 1S7LA 4H6UA 4P4BA 2Y0MA 4KLVA 2B3UA 1VQM1 2QRCB 2WPWA 4H89A 4CAEA 2IV2X 1TFIA 1YJ9Z 1W2BY 3PEIA 1VLAA 2QMLA 4R76A 5LL6f 2ZEEA 4JXQA 3FQMA 1RNIA 2WSAA 2AFMA 5CM2M 2PJ2A 3NH8A 1VQOZ 2JMOA 3S1NI 3FX6A 5D8NA 2PCUA 7CPAA 1LCPA 1S7KA 2QEX1 1KQSZ 3CXQA 3JAMb 1TKJA 2YADA 4A32A 1Q7Y1 3HOYI 3W91A 1VQP1 4PK3A 4IUSA 4R7MA 2GTIA 3B3WA 4CAXA 3CCEZ 2JIPA 1VQ5Z 1RQFA 1QMUA 1JQGA 3SJGA 1K9M2 5IX3A 2AFZA 4O23A 1QSMA 3S9MA 4JXRA 4OIDA 2OZHA 5LRJA 1YQEA 5F49A 3C26A 3LUSA 3GTLI 3RZAA 1S60A 1M4IA 5DWNA 4AVCA 3CCLZ 1R43A 2PSWA 1YHQZ 4QVTA 4BBHA 2Q4ZA 1LRZA 2Z3KA 2BUEA 4HNWB 1CPXA 1VIXA 4TWEA 3J81b 4CYQA 1Z2LA 5G21A 4A3CI 3D4UA 5CPAA 4E2ZA 3DR6A 3PB8X 3KGQA 4P4JA 5F48A 1VQ8Z 1VQLZ 3F3PC 3ISXA 2Y0SA 1S7MA 2J8RA 3DGVA 1QSOA 4YRHA 3G711 4HPSA 1S72Z 2JDDA 2JLMA 3KIHA 4YU9A 4A37A 4CYNA 4NJQA 5K8OA 2REEA 1ML8A 1XMTA 2DXQA 1TF9A 4B13A 3GTMS 2PVWA 1IYKA 4J3GA 1LOKA 1BOBA 3QAYA 3IWWA 1QSRA 2OZGA 3CT9A 1ARLA 1B6BA 4X8IA 3IJ3A 4NB9A 1K732 1LFWA 1W2BZ 3CXSA 3ZZIA 1YIJZ 2DPSA 2NVYI 2RB7A 2GFQA 1ON0A 3BG0B 2QJ8A 5K8NA 3G4SZ 2GREA 4FAIA 3BI1A 2PJ6A 2RBLA 3TO7A 1Q822 3KASA 3EO4A 3P2HA 4A3EI 3VMIA 2OTL1 1Y1VI 2OZKA 4X5KA 4C2ZA 2O28A 1YX0A 4A3KI 2PIYA 3R96A 2PJCA 1I3QI 2G0BA 3BJ8A 3IO1A 4HKFA 3HOUI 5D29A 2XEJA 1CX8A 1XEBA 4ZY1A 3CCQZ 4NXYA 1ZB8A 1ZLIA 4P6YA 1HEEA 3TE5B 4F6AA 4XPKA 5LRGA 4P4FA 5JGFA 4KORA 3G4S1 1Z8TA 2C1CA 2PJ4A 1Y9WA 1RO5A 4QTUA 3GTGI 4E2XA 3CMA1 4RVDA 4M6IA 5HVFA 2E2HI 3ZJ0A 3W6XA 2C6GA 3RYOA 4GM5A 2PR8A 4MD7A 3CC41 1VQKZ 2E7ZA 1PFTA 1QVGZ 3CC7Z 3FJUA 2NVTI 2FXFA 5IP9I 4MHNA 5GCNA 2PJ1A 2Q43A 1M902 3FEDA 1AMPA 2JBJA 4P45A 3CPWZ 2VZYA 3VWDA 1ARMA 3G8WA 3HKZA 4NSQA 4OLLA 3CCR1 4R9MA 1XFOA 1FY7A 1DTDA 4P10A 3G3SA 3NH4A 2JA7I 3PRTA 2EVNA 4R8FA 2Q4VA 2ODFA 3FB3A 4NFRA 4JWPA 3LACA 4A2ZA 3NE7A 4MJ8A 3J80f 4YWYA 2V3VA 1IU8A 2VI7A 5IT9f 4A3FI 5JQ4A 2OR4A 3S17I 3SXNA 3DNSA 4ZY0A 1JWHC 4U5YA 2ZEFA 3W6SA 1RO4A 4II9A 1RXTA 5FLXb 4OC3A 4RS4A 3T8WA 5D1PA 2OOYB 4M3SA 5JM6A 4RVFA 1YI2Z 3R1KA 2V45A 4AG9A 4W9YA 3U50C 2AJ6A 3CC21 1Y0YA 4K3NA 4F8ZA 1Q861 1K8A2 3FECA 5G22A 5JH9A 2GE3A 2J8MA 3IX0A 3SJXA 2PM9A 2FE7A 2M6NA 4A33A 5HH1A 3S9NA 3S6HA 3TT2A 1KD11 2JA5I 1AYEA 3GLJA 4ONWA 1QF8A 2C27A 3J7A4 2V8DA 1ZG9A 2BL1A 4RN7A 4L89A 4CRZB 3G6EZ 2IL4A 1F2PA 3SJFA 3L2NA 3I4MI 1AUGA 2R1IA 3CCM1 2LIYA 2W04A 4WJBA 2CNTA 1EE3P 3TTHA 4E2WA 1MK4A 2HUZA 1VQ7Z 4KSAA 3NDIA 2PJ7A 3D2MA 1FNOA 2J6AA 4YGOA 3PP9A 1A2ZA 3CD6Z 4MHZA 2JA6I 2PRBA 1YJWZ 4XX2A 3BXMA 3EERA 3S1RI 3S1QI 4A3DI 3PZJA 2R7ZI 5FVJA 1VHEA 1N8R1 4AB7A 2HV2A 4AVBA 3LODA 1RTQA 3PBBA 4CGNA 4MH4A 4NGQA 4A95A 3T90A 4FD4A 3LMSA 2OTJZ 1B87A 1KC82 1PYTB 3N7ZA 3T9YA 3B3SA 1UWYA 3V8IA 3IU2A 2ZW6A 1IYLA 5H84A 3S2HI 3IIBA 3CME1 1YIT1 4IK2A 3I561 4X2TA 5HMNA 2G2KA 4KSIA 4OMEA 4MFPA 1YUAA 4E0AA 4PPZA 4CGPA 3CCUZ 1X3ZA 4KS9A 3CQZI 4MXUA 4HNXB 4B11A 1X12A 1M4LA 2K5RA 1XOVA 2REFA 1OBRA 2PJBA 4UCMA 3CCJZ 4EMEA 2EGTA 4KLWA 2V8IA 4ONUA 3K9UA 2WYRA 4PSXA 3FH4A 3GTPI 4Y49C 5E96A 4YFJA 1VHSA 2LEXA 4NGPA 3NFZA 3PO2I 1V0CA 1NSAA 3WC6A 2RHBA 2VEZA 2PDOA 4CGOA 2HB6A 4DYOA 1KWMA 2PRQA 2QA4Z 2VL1A 4UCNA 2IMOA 4CGLA 5J8FA 2NVXI 5D1OB 1XE4A 3KIFA 1OZPA 4AXVA 4A3LI 3EC4A 4ZI6A 2ZEMA 3I55Z 4A3BI 1Q812 1S5KA 4NBHA 4NGTA 4NGNA 2V8KA 2DE6A 2ZEOA 3IWEA 3FF3A 5F47A 3FMCA 5K8PA 3CDXA 4QUSA 5C4XI 1Y8CA 2RC4A 3KZWA 4OC5A 1Q7Y2 4MCRA 2X7BA 3F0AA 2O4HA 1NP6A 2M48A 5AG4A 3K9TA 4MD8A 4XNHC 1YR0A 2JIMA 1NUIA 5J1QA 1YJ91 4E31A 3CZXA 2Z3LA 5LYFA 2PE3A 3IC1A 2ZELA 1K4JA 5THWA 1RO2A 1M1K1 2K3RA 4OP4A 3PB6X 3PBEA 1VQO1 4LQGA 4ZY2A 4QC6A 4UIAA 2JNYA 1YMEA 3KKWA 2CNSA 2B4DB 2ATRA 3RBUA 2Z3OA 1J4JA 5LRKA 3QNVA 2PC1A 2PJ5A 3S6KA 3TFYA 1JJ2Z 3QAHA 1YJNZ 1VQNZ 1VHOA 2V77A 3CCE1 4EWCA 2HU9A 1VQ51 3D8PA 1I12A 4KVOE 4BBRI 1M4DA 3S6FA 5C44I 2ZEPA 3BI0A 4F9VA 4RUHA 1AA6A 4A94A 1WIIA 2K5TA 2PMZA 3HLPA 1P0HA 2R92I 4NJRA 3B7IA 1IB1E 3I07A 4FD7A 3TO6A 1Z8XA 1QXFA 3CCL1 3CXCY 1LANA 2GTHA 3I1UA 1YHQ1 3CCSZ 2V8VA 2WB1A 4NEXA 4B5PA 3B3VA 3D7GA 1TWAI 3VMGA 1ZLHA 2OH1A 3OW2Y 4KOYA 2D4PA 3KQXA 4IAVA 4CPAA 3F3FC 2GIVA 1Z8LA 3JUWA 3R9EA 2I00A 1USPB 4KOXA 4Y49B 1VQ81 1VQL1 2QYVA 3H8EA 3F8KA 3D9XA 4NBCA 3CCVZ 4C68A 2P28A 2B58A 4QB9A 2VPXA 2KPIA 4GS4A 4A3JI 2ZOGA 3BG1B 4JZ0A 1S721 1XMBA 1IICA 4PSWA 2NYQA 2RFHA 4MI4A 1FT7A 3WABA 2AKLA 2F5IA 5HVHA 1R3NA 1LAMA 1VGYA 2Q51A 1Z8WA 2OOXB 4F0YA 2VBQA 1DL6A 4UIBA 1DE4C 3PB4X 1I6HI 5A2Qf 3GTJI 1GHEA 4NGSA 4XPDC 4X6AI 3FKII 3GKQA 1NSLA 1Z03A 2JIOA 2JR6A 2Z3MA 4GXHA 2Z3PA 4L8AA 4C2YA 4ORFA 1NJI1 1TKHA 2BSWA 3WC5A 2AFWA 1YIJ1 3PB7X 3S9LA 2CY2A 3M4OI 4EVYA 4M6GA 4CAVA 3PO3S 1TWCI 2QVPA 2BO9A 2EWBA 1ELMP 2CNMA 3KQZA 3FYNA 3FIXA 3PFEA 2WUUA 2YNCC 2Q7BA 1PU9A 4UEFA 1U6MA 2R7HA 4AG7A 4ZBGA 1WW9A 1XF8A 4B5PB 1KRLA 5A28A 4A93I 4Q7AA 3D7HA 2VPZA 2B63I 2ZEGA 5EC4A 2ZENA 4JLYA 3HUVA 4KVXA 4MBUA 2Q4YA 4DJLA 4DNCA 2IZ4A 3CCQ1 5CNPA 4OAEA 1KUYA 3DLJA 4A39A 3D2PA 3D68A 1YVOA 1VQ6Z 1Y9KA 3EXNA 2YNDA 4NBGA 4PXEA 3CPAA 4UF4A 5C82A 4MCPA 4BBSI 3OW2Z 2F7VA 2HC9A 4MY0A 4E33A 3B3CA 2C6PA 2AYDA 1ZG7A 2Q44A 4NBEA 4AYBA 3FEEA 1TWGI 4FD5A 1YK3A 1QYPA 2AFXA 2YU9I 4UA3A 2ZOFA 3R9GA 4E2AA 1WCMI 1IIDA 4BINA 5AN9F 3MZLB 3DDDA 2A4NA 1VQK1 3SI2A 1M44A 3K7AI 2RIQA 2P6EA 3VWEA 3CC71 1HDUA 2EO8A 1NMTA 2EK9A 1IGBA 2VZZA 2YGWA 3IU1A 5KTAA 4NBBA 4A30A 4QTTA 3S6GA 4KOTA 3E0KA 2QLVB 4S1TA 4XPDB 3H3VJ 3N5FA 4R57A 3J80b 2ABZA 3LWUA 4K30A 1Y7RA 2VF1A 5IT9b 3HOXI 3PB9X 3GTOI 1BAVA 2CTBA 2CTCA 1Q862 2PJ8A 1Z9UA 1KZFA 1CM0A 1LQLA 4JYWA 2VUMI 2FCKA 2ZAEB 4RV9A 2PJ9A 2DPTA 2ZXVA 4R87A 1Q2CA 3VARA 1KD12 2BJOA 3WT4A 4C7IA 3D67A 4KOWA 4IHMA 4HH4A 4NOZA 4PXBA 5F46A 3RZDI 1ZB9A 3Q87A 1VQ9Z 2J9AA 4Q38A 1QSTA 1XJOA 2O53A 1YI21 2EBJA 3JTKA 1CP6A 5KTCA 3BLNA 3SI0A 1WZNA 1XBUA 3FBUA 2V8JA 3KR5A 3DSBA 3VMHA 5G1ZA 4BXXI 5D1OA 2WPXA 4B6ZA 2JDCA 3S14I 3HOZI 2PK7A 4TNUA 1CG2A 4NF1A 2JIRA 1PCAA 1VQ4Z 4Y52I 3RO0A 2OB0A 2F8HA 2D4OA 2XEIA 1RO0A 3BHXA 4C2XA 4RS2A 1N8R2 1F2OA 1VQMZ 1SIWA 3D66A 5F09A 3DR8A 2ZPAA 3G6E1 1ZG8A 3BJ7A 4EWTA 2XEFA 4CRYB 2QECA 2QIRA 2POKA 3IGRA 1VQ71 2QR1B 2QEXZ 2R98A 1IOIA 2CF4A 1VKCA 3IF8A 4DUKA 3CD61 4B10A 1S7NA 1VQPZ 2OOTA 1YJW1 4OKOA 2EK8A 4MY3A 4HGYA 2PJ0A 2B4DA 4A3GI 2VQYA 1N2FA 4NBDA 2B4BA 4CS0B 2JA8I 3JAMf 4U9ZA 3S16I 1Z02A 2KI7B 3MZKB 4NBAA 2IQ6A 5IB0A 4KOVA 4RVGA 1BLLE 4MCSA 3VTNA 4E30A 3QWUA 2OTJ1 2NAPA 3KI9A 4MHDA 2H5MA 3H0GI 1I21A 4CYOA 1MJ9A 2F4MA 2Z10A 2RT9A 4KUBA 2AFUA 3HOVI 4KUAA 1PUAA 3I9SA 4KOSA 1Z4EA 1Q811 4B5OA 2CXAA 1UFHA 3MONA 4RVHA 2G3AA 1GYTA 2RPRA 2G3TA 3CCU1 1X0TA 3ISZA 3I4NI 1K9M1 4P44A 2B3VA 2IJZA 1USPA 5JPHA 4NCZA 3J81f 3CCJ1 4P4DA 2P6FA 3G71Z 1LAPA 3B35A 4CAFA 3S2DI 3TC8A 2WAQA 3UY5A 3KHZA 1FDIA 2Q7SA 1TXRA 4H2KA 1Q7LA 5J8CA 2GLJA 1Y1VS 3SJEA 5BWAB
chains in the Genus database with same CATH topology
5LYDA 4P4EA 4NGSA 4X6AI 3FKII 2QKDA 5IT9f 4A3FI 1CP7A 2OR4A 3S17I 1F57A 4ZY0A 2R6MA 3RAMA 3GKQA 1Z03A 1JWHC 2JR6A 2ZEFA 3B2YA 1RO4A 5HVGA 2QA41 3SI1A 5FLXb 5IP7I 1VQ91 1JJ2Y 4RS4A 2BOAA 4OC3A 3T8WA 5D1PA 1NJI1 2H85A 1TKHA 2OOYB 3WC5A 2ZEDA 2AFWA 4WWVA 2VUGA 1YIJ1 5JM6A 4RVFA 3PB7X 4UEEA 1YI2Z 1M1K2 1QQ9A 2E2JI 3I551 5T64A 1TWFI 3K2KA 3S9LA 5T67A 4UEZA 3M4OI 4W9YA 3U50C 4BD9A 2FVGA 1ZH1A 3PO3S 3CC21 3V38A 3NH5A 1Y0YA 2G9DA 1TWCI 3HOWI 2V8HA 4K3NA 2QVPA 2BO9A 4F8ZA 2EWBA 1Q861 1ELMP 1K8A2 3FECA 4PXCA 3KQZA 5JH9A 5LYIA 3PFEA 2PJ3A 3IX0A 3SJXA 2AFSA 2CIJA 2PM9A 4NBFA 1YUKA 1VQ41 4UEFA 2M6NA 2NVQI 5FLMI 3PFOA 3IFUA 4DGLA 3S9NA 3GCFA 2IZ3A 2OTLZ 1WW9A 1KD11 4P4BA 1KRLA 2JA5I 1AYEA 1VQM1 4A93I 4Q7AA 2QRCB 3D7HA 3GLJA 4ONWA 1QF8A 2B63I 3J7A4 1H8LA 2ZEGA 4PQAA 1TFIA 1YJ9Z 1W2BY 3PEIA 1X3WA 1VLAA 1QVGY 2V8DA 4R76A 5LL6f 2ZENA 3KR4A 2ZEEA 5T6BA 1K731 4Y7NI 3HUVA 3FQMA 1RNIA 1ZG9A 2AFMA 5CM2M 1R9TI 3G6EZ 2XEGA 3JRUA 4DJLA 2PJ2A 1YLOA 1F2PA 1SFOI 3CPWY 3NH8A 5DS0A 3GTKI 3TDHB 3SJFA 1VQOZ 4R6TA 2JMOA 3S1NI 2IZ4A 3I4MI 3CCQ1 3FX6A 3L2NA 2PCUA 3S15I 5D8NA 1P9NA 3CCM1 2LIYA 2W04A 4FBEA 1LCPA 4WJBA 1EE3P 7CPAA 4E2WA 1L1OC 3GTQI 2QEX1 1VQ7Z 1KQSZ 3DLJA 4A39A 3NDIA 3JAMb 1TKJA 2PJ7A 3D68A 1VQ6Z 2YADA 1FNOA 2J6AA 1Q7Y1 2QRDB 4NBGA 2BCOA 3CD6Z 4PXEA 3HOYI 2QREB 1VQP1 1Q821 1YJN1 2E2II 2JA6I 4MHZA 3CPAA 1VQN1 1YJWZ 4UF4A 4XX2A 4R7MA 2GTIA 5ELYA 3BXMA 3EERA 3S1RI 3ESWA 4A3MI 1CBXA 3B3WA 4MCPA 3CCEZ 3OW2Z 3S1QI 4BBSI 4A3DI 2F7VA 2HC9A 2R7ZI 1VQ5Z 2DEAA 1VHEA 4E33A 4MHYA 1N8R1 1RQFA 4MRIA 5C3EI 2JEWA 3B3CA 1QMUA 2AFOA 1JQGA 2C6PA 3T4NB 3SJGA 2F4OA 1ZG7A 3CMAZ 1K9M2 1RTQA 2PVVA 4NBEA 2AFZA 3PBBA 3IFEA 4O23A 4MH4A 4AYBA 3S9MA 4NGQA 3VB9A 1YSJA 3FEEA 2DE7A 4OIDA 4MCQA 4FUUA 3LMSA 1TWGI 2OTJZ 5LRJA 1QYPA 1KC82 2YU9I 2AFXA 1PYTB 2ZOFA 3LUSA 4HGZA 3GTLI 1WCMI 3RZAA 3B3SA 5AN9F 3MZLB 3CCLZ 1R43A 1UWYA 3CCS1 2DE5A 1VQK1 2I3CA 3SI2A 1YHQZ 3CC4Z 3B3TA 3K7AI 3S1MI 2Q4ZA 2RIQA 3CPXA 3S2HI 3IIBA 3CC71 2JS4A 4MHPA 3CME1 1YIT1 1QVFY 1HDUA 4IK2A 1XRYA 3I561 4X2TA 2G2KA 4KSIA 1CPXA 2EK9A 4OMEA 1VIXA 4TWEA 1CPSA 3J81b 1YUAA 1IGBA 5C4JI 1Z2LA 4NBBA 4A3CI 3D4UA 4PPZA 5CPAA 3NDJA 4E2ZA 2C6CA 3PB8X 3KGQA 8CPAA 4QTTA 4P4JA 1VQ8Z 4E32A 3CCUZ 1X3ZA 1VQLZ 1NJI2 3CQZI 4MXUA 3CCV1 2PJAA 2QLVB 4S1TA 3KHXA 3H3VJ 3CCRZ 4X3RA 3F3PC 3ISXA 3N5FA 2Y0SA 1S7MA 1RLYA 1M4LA 2K5RA 3J80b 2ABZA 3LWUA 3DGVA 3VH9A 5A2Qb 4OC0A 3GTMI 2VF1A 1OBRA 2PJBA 3CCJZ 3G711 1S72Z 5IT9b 4EMEA 3HOXI 3PB9X 2EGTA 3KIHA 4ZX8A 1HDQA 3GTOI 1BAVA 2V8IA 2CTBA 2CTCA 1Q862 2PJ8A 4YU9A 4A37A 2E9HA 4NJQA 5K8OA 2WYRA 2WZNA 1LQLA 1ML8A 2VUMI 3FH4A 2ZAEB 2GLFA 4JYWA 4RV9A 1TF9A 2PJ9A 3GTPI 4PXDA 3GTMS 2PVWA 1I50I 6CPAA 3VARA 1LOKA 4NGPA 4OC1A 1KD12 3NFZA 3IWWA 3PO2I 3CT9A 2BJOA 1NSAA 3WC6A 1M901 2JUBA 3WT4A 2RHBA 3D67A 1ARLA 4X8IA 4IHMA 4OIWA 4HH4A 4NOZA 4NGMA 3IJ3A 4A3II 2HB6A 3RZDI 1KWMA 1ZB9A 4NB9A 2PRQA 4PXBA 4DYOA 2QA4Z 2P3YA 2VL1A 3Q87A 1K732 1VQ9Z 2IMOA 2J9AA 1LFWA 3CXCZ 1W2BZ 5D1OB 2NVXI 2W03A 1XJOA 2O53A 1YI21 3KIFA 1CP6A 1YIJZ 4AXVA 4A3LI 3SI0A 2NVYI 4ZI6A 3I55Z 4A3BI 1XBUA 1Q812 2ANPA 4NBHA 2ZEMA 4MD9A 4NGTA 2RB7A 4NGNA 2V8KA 2DE6A 2ZEOA 2HF1A 3BG0B 2V8JA 3KR5A 3FQQA 2QJ8A 3VMHA 5K8NA 3FF3A 3CC2Z 3G4SZ 2GREA 3FMCA 4BXXI 5D1OA 3CDXA 5K8PA 5FLXf 4B6ZA 5C4XI 4FAIA 3S14I 3HOZI 3KZWA 2PK7A 4TNUA 4OC5A 3BI1A 5CBMA 1Q7Y2 1CG2A 2PJ6A 2RBLA 4MCRA 1PCAA 1Q822 3KASA 1Z5RA 1VQ4Z 4Y52I 2JBKA 2O4HA 1NP6A 4NH1C 2M48A 4A3EI 3K9TA 3VMIA 2OTL1 1Y1VI 1Y0RA 4E2YA 2F8HA 4MD8A 2XEIA 4ZYQA 1RO0A 3BHXA 2OZKA 1N8R2 1F2OA 3P5JB 1VQMZ 1NUIA 5J1QA 4EFDA 1YJ91 4E31A 3D66A 4A3KI 2PIYA 5F09A 5LYFA 2PE3A 3IC1A 2PJCA 1I3QI 2ZELA 5THWA 3IO1A 1RO2A 3HOUI 3G6E1 1M1K1 4G1PA 1ZG8A 2K3RA 4FWUA 5D29A 4EWTA 4OP4A 3EEDA 2XEJA 3PB6X 1CX8A 1VQO1 2XEFA 3PBEA 4LQGA 4ZY2A 3KL9A 4UIAA 2JNYA 4ZY1A 3M3YI 3CCQZ 1YMEA 3CCMZ 1ZB8A 2POKA 1ZLIA 3H8FA 3PO3I 1VQ71 3D7FA 2QR1B 2QEXZ 3RBUA 4P6YA 1VQ61 3FVLA 1K8A1 2CF4A 4CL1A 3IF8A 4P4IA 4DUKA 5LRKA 3CD61 3QNVA 1HEEA 2PJ5A 4ZX9A 2LFUA 3TE5B 1JJ2Z 2PIZA 1VQPZ 4MMOA 2OOTA 1YJW1 1YJNZ 4OKOA 3NA6A 1VQNZ 2EK8A 1VHOA 4HGYA 1QVFZ 2PJ0A 2V77A 5LRGA 3CCE1 4EWCA 4A3GI 5IB9A 4P4FA 2HU9A 3D6WA 5JGFA 1Y1WI 1VQ51 3G4S1 1YW4A 2C1CA 2PJ4A 1N2FA 1TWHI 4BBRI 1IY7A 4NBDA 5C44I 2R93I 2ZEPA 3BI0A 2JA8I 3JAMf 4F9VA 4RUHA 4QTUA 3GTGI 4E2XA 3S16I 3CMA1 4RVDA 1Z02A 2KI7B 3MZKB 4A94A 4NBAA 3RZOI 5HVFA 5K8MA 2IQ6A 1WIIA 4RVGA 2E2HI 1BLLE 4MCSA 2PMZA 3VTNA 4E30A 3QWUA 4BY1I 3HLPA 2OTJ1 4OC4A 1YW6A 2R92I 4NJRA 3KI9A 3B7IA 3WC7A 2C6GA 1KQSY 1ELLP 3H0GI 3GB0A 3I07A 3CCL1 3CXCY 4GM5A 1LANA 2GTHA 3I1UA 2V8GA 4MD7A 3CC41 1YHQ1 4NGRA 2F4MA 3CCSZ 1VQKZ 2V8VA 2RT9A 3MN8A 2WB1A 2AFUA 3HOVI 1PFTA 3B3VA 3D7GA 1QVGZ 1TWAI 2GU2A 3VMGA 3CC7Z 3FJUA 1ZLHA 3V7ZA 3CMEZ 1YITZ 2NVTI 3OW2Y 4DK1A 3I56Z 1Q811 1BPNA 3VATA 5IP9I 4MHNA 2PJ1A 2Q43A 3KQXA 4IAVA 4CPAA 3F3FC 1M902 1Z8LA 3FEDA 1AMPA 2JBJA 1USPB 4P45A 3MONA 4RVHA 3IEHA 1BPMA 3CPWZ 2RPRA 1GYTA 3GUXA 3H8GA 1ARMA 1VQ81 1VQL1 3CCU1 2QYVA 3H8EA 1X0TA 3ISZA 1Z01A 3D9XA 3HKZA 4NBCA 1TKFA 3I4NI 3CCVZ 3CCR1 1TF8A 1XFOA 1K9M1 2P28A 4P44A 4F9UA 2IJZA 4A38A 2KPIA 1USPA 4A3JI 1DTDA 2ZOGA 3TX8A 3BG1B 4P10A 3J81f 4BY7I 3CCJ1 4JZ0A 3NH4A 1Y7EA 1S721 1XMBA 2ZEHA 3MRUA 4P4DA 2JA7I 3G71Z 1LAPA 3B35A 3PRTA 1KC81 3S2DI 2NYQA 4NB8A 2RFHA 3TC8A 1FT7A 5HXDA 3WABA 2WAQA 4R8FA 2AKLA 5HVHA 1R3NA 1LAMA 1VGYA 4NFRA 3KHZA 2Q51A 1TXRA 1K83I 4MONA 3D7DA 2OOXB 4H2KA 1DL6A 3J80f 4UIBA 1DE4C 3PB4X 2NSMA 1Q7LA 1I6HI 5I4MA 4YWYA 4DQYB 5A2Qf 4OC2A 4Z65A 2GLJA 5LYLA 1Y1VS 3GTJI 3SJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LYD A;  4P4E A;  4NGS A;  1CP7 A;  2OR4 A;  1F57 A;  4ZY0 A;  3RAM A;  2ZEF A;  3B2Y A;  5HVG A;  3SI1 A;  4OC3 A;  2BOA A;  3T8W A;  1TKH A;  3WC5 A;  2ZED A;  2AFW A;  4WWV A;  5JM6 A;  4UEE A;  3PB7 X;  1QQ9 A;  3K2K A;  3S9L A;  4UEZ A;  4W9Y A;  4BD9 A;  2FVG A;  3V38 A;  3NH5 A;  1Y0Y A;  2G9D A;  4K3N A;  2V8H A;  2QVP A;  2BO9 A;  4F8Z A;  2EWB A;  1ELM P;  3FEC A;  4PXC A;  3KQZ A;  5JH9 A;  5LYI A;  3PFE A;  2PJ3 A;  3SJX A;  2AFS A;  2CIJ A;  4UEF A;  3PFO A;  3S9N A;  4P4B A;  1AYE A;  4Q7A A;  3D7H A;  3GLJ A;  4ONW A;  4PQA A;  1H8L A;  2ZEG A;  3PEI A;  2V8D A;  4R76 A;  2ZEN A;  3KR4 A;  2ZEE A;  3HUV A;  1ZG9 A;  2AFM A;  2XEG A;  3JRU A;  4DJL A;  2PJ2 A;  1YLO A;  1F2P A;  5DS0 A;  3NH8 A;  3SJF A;  4R6T A;  3L2N A;  3FX6 A;  5D8N A;  2PCU A;  4FBE A;  1LCP A;  4WJB A;  1EE3 P;  7CPA A;  3DLJ A;  4A39 A;  1TKJ A;  3D68 A;  2PJ7 A;  1FNO A;  2BCO A;  4PXE A;  4MHZ A;  3CPA A;  4UF4 A;  4R7M A;  5ELY A;  3BXM A;  1CBX A;  3B3W A;  4MCP A;  2F7V A;  2HC9 A;  2DEA A;  1VHE A;  4MHY A;  4MRI A;  2JEW A;  3B3C A;  1QMU A;  2AFO A;  1JQG A;  2C6P A;  3SJG A;  1ZG7 A;  1RTQ A;  2PVV A;  2AFZ A;  3PBB A;  3IFE A;  4O23 A;  3S9M A;  4NGQ A;  1YSJ A;  3FEE A;  4OID A;  4MCQ A;  4FUU A;  3LMS A;  5LRJ A;  2AFX A;  1PYT B;  2ZOF A;  3RZA A;  3B3S A;  1UWY A;  1R43 A;  2I3C A;  3SI2 A;  3B3T A;  2Q4Z A;  3CPX A;  3IIB A;  4MHP A;  1HDU A;  4IK2 A;  1XRY A;  4X2T A;  4KSI A;  1CPX A;  2EK9 A;  4OME A;  1VIX A;  4TWE A;  1CPS A;  1IGB A;  1Z2L A;  3D4U A;  4PPZ A;  5CPA A;  3PB8 X;  2C6C A;  3KGQ A;  8CPA A;  4P4J A;  4MXU A;  2PJA A;  3KHX A;  4X3R A;  3ISX A;  3N5F A;  1M4L A;  2ABZ A;  3LWU A;  3DGV A;  3VH9 A;  4OC0 A;  1OBR A;  2PJB A;  4EME A;  3PB9 X;  4ZX8 A;  1HDQ A;  1BAV A;  2CTB A;  2CTC A;  2PJ8 A;  4YU9 A;  4A37 A;  4NJQ A;  5K8O A;  2WYR A;  2WZN A;  4JYW A;  3FH4 A;  2GLF A;  1TF9 A;  2PJ9 A;  4PXD A;  2PVW A;  6CPA A;  3VAR A;  1LOK A;  4NGP A;  4OC1 A;  3IWW A;  3NFZ A;  3CT9 A;  1NSA A;  3WC6 A;  3WT4 A;  3D67 A;  1ARL A;  4X8I A;  4IHM A;  4OIW A;  4NGM A;  3IJ3 A;  2HB6 A;  4PXB A;  4DYO A;  1KWM A;  2PRQ A;  2VL1 A;  2IMO A;  2J9A A;  1LFW A;  1XJO A;  2O53 A;  1CP6 A;  4AXV A;  3SI0 A;  4ZI6 A;  2ANP A;  2ZEM A;  1XBU A;  4NGT A;  4NGN A;  2RB7 A;  2ZEO A;  3KR5 A;  2QJ8 A;  5K8N A;  3FF3 A;  2GRE A;  3FMC A;  5K8P A;  3CDX A;  4B6Z A;  4FAI A;  3KZW A;  4TNU A;  4OC5 A;  3BI1 A;  5CBM A;  1CG2 A;  2PJ6 A;  4MCR A;  1PCA A;  3KAS A;  1Z5R A;  2JBK A;  2O4H A;  3K9T A;  1Y0R A;  2F8H A;  2XEI A;  4ZYQ A;  3BHX A;  1F2O A;  5J1Q A;  4EFD A;  3D66 A;  2PIY A;  5F09 A;  5LYF A;  2PE3 A;  3IC1 A;  2PJC A;  2ZEL A;  5THW A;  3IO1 A;  4G1P A;  5D29 A;  1ZG8 A;  4FWU A;  4EWT A;  4OP4 A;  2XEJ A;  3PB6 X;  1CX8 A;  2XEF A;  3PBE A;  4LQG A;  4ZY2 A;  3KL9 A;  4UIA A;  4ZY1 A;  1YME A;  2POK A;  1ZLI A;  3H8F A;  3D7F A;  3RBU A;  4P6Y A;  3FVL A;  2CF4 A;  5LRK A;  4P4I A;  4DUK A;  3QNV A;  1HEE A;  2PJ5 A;  4ZX9 A;  2PIZ A;  4MMO A;  2OOT A;  4OKO A;  3NA6 A;  2EK8 A;  1VHO A;  2PJ0 A;  2V77 A;  5IB9 A;  5LRG A;  4P4F A;  5JGF A;  1YW4 A;  2C1C A;  2PJ4 A;  1IY7 A;  2ZEP A;  3BI0 A;  4F9V A;  4RUH A;  4A94 A;  5HVF A;  5K8M A;  2IQ6 A;  1BLL E;  4MCS A;  4OC4 A;  3HLP A;  1YW6 A;  4NJR A;  3KI9 A;  3B7I A;  3WC7 A;  2C6G A;  1ELL P;  3GB0 A;  4GM5 A;  1LAN A;  3I1U A;  2V8G A;  4NGR A;  2V8V A;  3MN8 A;  2AFU A;  3B3V A;  3D7G A;  2GU2 A;  3FJU A;  1ZLH A;  3V7Z A;  1BPN A;  3VAT A;  4MHN A;  2PJ1 A;  2Q43 A;  3KQX A;  4IAV A;  4CPA A;  1Z8L A;  3FED A;  1AMP A;  2JBJ A;  4P45 A;  3IEH A;  1BPM A;  1GYT A;  3GUX A;  3H8G A;  1ARM A;  3H8E A;  2QYV A;  3ISZ A;  1TKF A;  1TF8 A;  1XFO A;  4P44 A;  4F9U A;  2IJZ A;  4A38 A;  1DTD A;  2ZOG A;  3TX8 A;  4P10 A;  4JZ0 A;  3NH4 A;  1Y7E A;  1XMB A;  2ZEH A;  3MRU A;  4P4D A;  1LAP A;  3B35 A;  3PRT A;  2NYQ A;  2RFH A;  3TC8 A;  1FT7 A;  5HXD A;  3WAB A;  4R8F A;  5HVH A;  3KHZ A;  1R3N A;  1LAM A;  1VGY A;  4NFR A;  2Q51 A;  1TXR A;  3D7D A;  4H2K A;  4UIB A;  1DE4 C;  3PB4 X;  2NSM A;  1Q7L A;  5I4M A;  4YWY A;  4Z65 A;  4OC2 A;  2GLJ A;  5LYL A;  3SJE A; 
#chains in the Genus database with same CATH topology
 2QKD A;  1KUX A;  2R6M A;  3RAM A;  2B5G B;  4CGM A;  3B2Y A;  3D2L A;  5HVG A;  2QA4 1;  4MFK A;  3SI1 A;  4I49 A;  2BOA A;  1YLE A;  2ZED A;  2VUG A;  5AG6 A;  1M1K 2;  1QQ9 A;  2E2J I;  3I55 1;  5T64 A;  4PK2 A;  4LX9 A;  4HNY B;  3SHP A;  3V38 A;  3NH5 A;  2G9D A;  3HOW I;  2FL4 A;  5LYI A;  2PJ3 A;  2AFS A;  2CIJ A;  5IV0 A;  4B12 A;  2NVQ I;  5FLM I;  2OTL Z;  1WWZ A;  1MJA A;  5C88 A;  3TO9 A;  1XIX A;  2ZW4 A;  4PQA A;  1H8L A;  1X3W A;  1QVG Y;  3KR4 A;  5T6B A;  1K73 1;  4Y7N I;  3TCV A;  3A9L A;  1R9T I;  5EMI A;  2XEG A;  3JRU A;  4UFX A;  1YLO A;  1SFO I;  3CPW Y;  5DS0 A;  4H6Z A;  3GTK I;  3TDH B;  4R6T A;  1JWQ A;  3S15 I;  1P9N A;  4FBE A;  1WK4 A;  1L1O C;  3GTQ I;  4MFQ A;  3MGD A;  4Q36 A;  1MJB A;  2QRD B;  2BCO A;  2QRE B;  4A31 A;  1Q82 1;  1YJN 1;  2E2I I;  1VQN 1;  2VPW A;  5ELY A;  1I1D A;  3ESW A;  4A3M I;  1CBX A;  2DEA A;  3GYA A;  4MHY A;  5AG7 A;  4QBJ A;  4MRI A;  5C3E I;  2JEW A;  4XPL A;  2AFO A;  3T4N B;  2F4O A;  3JVN A;  3CMA Z;  2Z0Z A;  2PVV A;  3IFE A;  3VB9 A;  1YSJ A;  2GAN A;  2DE7 A;  4MCQ A;  4FUU A;  2BEI A;  4KOU A;  3R9F A;  4HGZ A;  3TOA A;  3IWG A;  4MFZ A;  3CCS 1;  2DE5 A;  4MFL A;  2I3C A;  3CC4 Z;  3B3T A;  3S1M I;  1YGH A;  3CPX A;  4XNH B;  2Z11 A;  2JS4 A;  4MHP A;  1QVF Y;  1XRY A;  3P2F A;  5DWM A;  1CPS A;  3H5Z A;  5C4J I;  3NDJ A;  4CAW A;  2C6C A;  4OAD A;  8CPA A;  1Q16 A;  4E32 A;  1NJI 2;  3CCV 1;  1S7F A;  2PJA A;  3KHX A;  3CCR Z;  4X3R A;  2HQY A;  1RLY A;  4LQ6 A;  3VH9 A;  5A2Q b;  4OC0 A;  3GTM I;  2JEV A;  1TIQ A;  3EFA A;  4UWJ A;  2FSR A;  3FRM A;  3B8G A;  3R95 A;  4M85 A;  4ZX8 A;  1HDQ A;  2ARH A;  3NE8 A;  2E9H A;  2WZN A;  3GKR A;  2GLF A;  3OWC A;  4PXD A;  1I50 I;  4R3K A;  6CPA A;  3LD2 A;  4F0X A;  4OC1 A;  4KSF A;  1YVK A;  1M90 1;  2JUB A;  2P6G A;  4MFJ A;  4U9Y A;  1BO4 A;  4OIW A;  4NGM A;  4A3I I;  4FD6 A;  3TOB A;  1P4N A;  2FT0 A;  2P3Y A;  3CXC Z;  2W03 A;  2ANP A;  3RNZ A;  2VXK A;  2YNC A;  3QB8 A;  4MD9 A;  2Z3N A;  2HF1 A;  3FQQ A;  3CC2 Z;  5FLX f;  5CBM A;  3I3G A;  1Z5R A;  4UFW A;  4LUA A;  2JBK A;  4NH1 C;  4UCP A;  1Y0R A;  4E2Y A;  4ZYQ A;  5A27 A;  3P5J B;  4JJX A;  2OZU A;  2PR1 A;  4EFD A;  4R3L A;  4CYP A;  1QSN A;  3PGP A;  1Q2D A;  4G1P A;  4FWU A;  3EED A;  3KL9 A;  1SQH A;  2ZW7 A;  3M3Y I;  1KUV A;  2OU2 A;  3CCM Z;  4IF5 A;  2J8N A;  3H8F A;  3PO3 I;  4ZGY B;  3D7F A;  1VQ6 1;  3FVL A;  1K8A 1;  4CL1 A;  4P4I A;  2ZW5 A;  1ZO0 A;  2YNE A;  4ZX9 A;  2LFU A;  2PIZ A;  4MMO A;  3NA6 A;  3IR7 A;  4UWI A;  5IB9 A;  1QVF Z;  3D6W A;  2PQ8 A;  1Y1W I;  1YW4 A;  5EBV A;  2P0W A;  1TWH I;  1IY7 A;  1NE9 A;  2FS5 A;  2R93 I;  2DF5 A;  3WR7 A;  4KVM E;  2R8V A;  3CXP A;  3RZO I;  1Z4R A;  5K8M A;  1M4G A;  4B14 A;  1IOF A;  3H4Q A;  3F5B A;  4OC4 A;  4BY1 I;  1YW6 A;  3WC7 A;  2I79 A;  1KQS Y;  1ELL P;  3GB0 A;  2Q0Y A;  4E8O A;  4KZT A;  3FXT A;  1M1D A;  2Q04 A;  2V8G A;  4NGR A;  3GIU A;  3MN8 A;  5AGE A;  1YRE A;  1Q2Y A;  2GU2 A;  1N71 A;  3V7Z A;  3CME Z;  1YIT Z;  1BPN A;  4DK1 A;  3I56 Z;  3VAT A;  3GY9 A;  3IEH A;  1BPM A;  3GUX A;  3H8G A;  4M6H A;  1Z01 A;  4RI1 A;  1TKF A;  1TF8 A;  3D3S A;  4UFV A;  4F9U A;  4A38 A;  4C7H A;  3TX8 A;  4BY7 I;  1Y7E A;  1L0C A;  3TE4 A;  2ZEH A;  4UBR A;  1X10 A;  3MRU A;  2VPY A;  1KC8 1;  5G20 A;  4NB8 A;  5HXD A;  1FDO A;  1K83 I;  4MON A;  5AG5 A;  3D7D A;  1S3Z A;  2NSM A;  5I4M A;  2JIQ A;  4JD6 A;  4DQY B;  4Z65 A;  4OC2 A;  5LYL A;  2AE6 A;  5KTD A;  5LYD A;  4P4E A;  5ISV A;  1CP7 A;  1F57 A;  5IP7 I;  1VQ9 1;  1JJ2 Y;  1WJ2 A;  2H85 A;  1R57 A;  4WWV A;  4UEE A;  2B5G A;  1TWF I;  3K2K A;  4PV6 A;  5I0C A;  5T67 A;  2FIA A;  4UEZ A;  3EY5 A;  2KCW A;  4BD9 A;  2FVG A;  2EUI A;  1ZH1 A;  2V8H A;  1CJW A;  4AVA A;  4PXC A;  3SXO A;  3FNC A;  4BMH A;  4NBF A;  1YUK A;  1VQ4 1;  2FIW A;  2NMT A;  3PFO A;  5H86 A;  3IFU A;  4DGL A;  3GCF A;  2IZ3 A;  1S7L A;  4H6U A;  4P4B A;  2Y0M A;  4KLV A;  2B3U A;  1VQM 1;  2QRC B;  2WPW A;  4H89 A;  4CAE A;  2IV2 X;  1TFI A;  1YJ9 Z;  1W2B Y;  3PEI A;  1VLA A;  2QML A;  4R76 A;  5LL6 f;  2ZEE A;  4JXQ A;  3FQM A;  1RNI A;  2WSA A;  2AFM A;  5CM2 M;  2PJ2 A;  3NH8 A;  1VQO Z;  2JMO A;  3S1N I;  3FX6 A;  5D8N A;  2PCU A;  7CPA A;  1LCP A;  1S7K A;  2QEX 1;  1KQS Z;  3CXQ A;  3JAM b;  1TKJ A;  2YAD A;  4A32 A;  1Q7Y 1;  3HOY I;  3W91 A;  1VQP 1;  4PK3 A;  4IUS A;  4R7M A;  2GTI A;  3B3W A;  4CAX A;  3CCE Z;  2JIP A;  1VQ5 Z;  1RQF A;  1QMU A;  1JQG A;  3SJG A;  1K9M 2;  5IX3 A;  2AFZ A;  4O23 A;  1QSM A;  3S9M A;  4JXR A;  4OID A;  2OZH A;  5LRJ A;  1YQE A;  5F49 A;  3C26 A;  3LUS A;  3GTL I;  3RZA A;  1S60 A;  1M4I A;  5DWN A;  4AVC A;  3CCL Z;  1R43 A;  2PSW A;  1YHQ Z;  4QVT A;  4BBH A;  2Q4Z A;  1LRZ A;  2Z3K A;  2BUE A;  4HNW B;  1CPX A;  1VIX A;  4TWE A;  3J81 b;  4CYQ A;  1Z2L A;  5G21 A;  4A3C I;  3D4U A;  5CPA A;  4E2Z A;  3DR6 A;  3PB8 X;  3KGQ A;  4P4J A;  5F48 A;  1VQ8 Z;  1VQL Z;  3F3P C;  3ISX A;  2Y0S A;  1S7M A;  2J8R A;  3DGV A;  1QSO A;  4YRH A;  3G71 1;  4HPS A;  1S72 Z;  2JDD A;  2JLM A;  3KIH A;  4YU9 A;  4A37 A;  4CYN A;  4NJQ A;  5K8O A;  2REE A;  1ML8 A;  1XMT A;  2DXQ A;  1TF9 A;  4B13 A;  3GTM S;  2PVW A;  1IYK A;  4J3G A;  1LOK A;  1BOB A;  3QAY A;  3IWW A;  1QSR A;  2OZG A;  3CT9 A;  1ARL A;  1B6B A;  4X8I A;  3IJ3 A;  4NB9 A;  1K73 2;  1LFW A;  1W2B Z;  3CXS A;  3ZZI A;  1YIJ Z;  2DPS A;  2NVY I;  2RB7 A;  2GFQ A;  1ON0 A;  3BG0 B;  2QJ8 A;  5K8N A;  3G4S Z;  2GRE A;  4FAI A;  3BI1 A;  2PJ6 A;  2RBL A;  3TO7 A;  1Q82 2;  3KAS A;  3EO4 A;  3P2H A;  4A3E I;  3VMI A;  2OTL 1;  1Y1V I;  2OZK A;  4X5K A;  4C2Z A;  2O28 A;  1YX0 A;  4A3K I;  2PIY A;  3R96 A;  2PJC A;  1I3Q I;  2G0B A;  3BJ8 A;  3IO1 A;  4HKF A;  3HOU I;  5D29 A;  2XEJ A;  1CX8 A;  1XEB A;  4ZY1 A;  3CCQ Z;  4NXY A;  1ZB8 A;  1ZLI A;  4P6Y A;  1HEE A;  3TE5 B;  4F6A A;  4XPK A;  5LRG A;  4P4F A;  5JGF A;  4KOR A;  3G4S 1;  1Z8T A;  2C1C A;  2PJ4 A;  1Y9W A;  1RO5 A;  4QTU A;  3GTG I;  4E2X A;  3CMA 1;  4RVD A;  4M6I A;  5HVF A;  2E2H I;  3ZJ0 A;  3W6X A;  2C6G A;  3RYO A;  4GM5 A;  2PR8 A;  4MD7 A;  3CC4 1;  1VQK Z;  2E7Z A;  1PFT A;  1QVG Z;  3CC7 Z;  3FJU A;  2NVT I;  2FXF A;  5IP9 I;  4MHN A;  5GCN A;  2PJ1 A;  2Q43 A;  1M90 2;  3FED A;  1AMP A;  2JBJ A;  4P45 A;  3CPW Z;  2VZY A;  3VWD A;  1ARM A;  3G8W A;  3HKZ A;  4NSQ A;  4OLL A;  3CCR 1;  4R9M A;  1XFO A;  1FY7 A;  1DTD A;  4P10 A;  3G3S A;  3NH4 A;  2JA7 I;  3PRT A;  2EVN A;  4R8F A;  2Q4V A;  2ODF A;  3FB3 A;  4NFR A;  4JWP A;  3LAC A;  4A2Z A;  3NE7 A;  4MJ8 A;  3J80 f;  4YWY A;  2V3V A;  1IU8 A;  2VI7 A;  5IT9 f;  4A3F I;  5JQ4 A;  2OR4 A;  3S17 I;  3SXN A;  3DNS A;  4ZY0 A;  1JWH C;  4U5Y A;  2ZEF A;  3W6S A;  1RO4 A;  4II9 A;  1RXT A;  5FLX b;  4OC3 A;  4RS4 A;  3T8W A;  5D1P A;  2OOY B;  4M3S A;  5JM6 A;  4RVF A;  1YI2 Z;  3R1K A;  2V45 A;  4AG9 A;  4W9Y A;  3U50 C;  2AJ6 A;  3CC2 1;  1Y0Y A;  4K3N A;  4F8Z A;  1Q86 1;  1K8A 2;  3FEC A;  5G22 A;  5JH9 A;  2GE3 A;  2J8M A;  3IX0 A;  3SJX A;  2PM9 A;  2FE7 A;  2M6N A;  4A33 A;  5HH1 A;  3S9N A;  3S6H A;  3TT2 A;  1KD1 1;  2JA5 I;  1AYE A;  3GLJ A;  4ONW A;  1QF8 A;  2C27 A;  3J7A 4;  2V8D A;  1ZG9 A;  2BL1 A;  4RN7 A;  4L89 A;  4CRZ B;  3G6E Z;  2IL4 A;  1F2P A;  3SJF A;  3L2N A;  3I4M I;  1AUG A;  2R1I A;  3CCM 1;  2LIY A;  2W04 A;  4WJB A;  2CNT A;  1EE3 P;  3TTH A;  4E2W A;  1MK4 A;  2HUZ A;  1VQ7 Z;  4KSA A;  3NDI A;  2PJ7 A;  3D2M A;  1FNO A;  2J6A A;  4YGO A;  3PP9 A;  1A2Z A;  3CD6 Z;  4MHZ A;  2JA6 I;  2PRB A;  1YJW Z;  4XX2 A;  3BXM A;  3EER A;  3S1R I;  3S1Q I;  4A3D I;  3PZJ A;  2R7Z I;  5FVJ A;  1VHE A;  1N8R 1;  4AB7 A;  2HV2 A;  4AVB A;  3LOD A;  1RTQ A;  3PBB A;  4CGN A;  4MH4 A;  4NGQ A;  4A95 A;  3T90 A;  4FD4 A;  3LMS A;  2OTJ Z;  1B87 A;  1KC8 2;  1PYT B;  3N7Z A;  3T9Y A;  3B3S A;  1UWY A;  3V8I A;  3IU2 A;  2ZW6 A;  1IYL A;  5H84 A;  3S2H I;  3IIB A;  3CME 1;  1YIT 1;  4IK2 A;  3I56 1;  4X2T A;  5HMN A;  2G2K A;  4KSI A;  4OME A;  4MFP A;  1YUA A;  4E0A A;  4PPZ A;  4CGP A;  3CCU Z;  1X3Z A;  4KS9 A;  3CQZ I;  4MXU A;  4HNX B;  4B11 A;  1X12 A;  1M4L A;  2K5R A;  1XOV A;  2REF A;  1OBR A;  2PJB A;  4UCM A;  3CCJ Z;  4EME A;  2EGT A;  4KLW A;  2V8I A;  4ONU A;  3K9U A;  2WYR A;  4PSX A;  3FH4 A;  3GTP I;  4Y49 C;  5E96 A;  4YFJ A;  1VHS A;  2LEX A;  4NGP A;  3NFZ A;  3PO2 I;  1V0C A;  1NSA A;  3WC6 A;  2RHB A;  2VEZ A;  2PDO A;  4CGO A;  2HB6 A;  4DYO A;  1KWM A;  2PRQ A;  2QA4 Z;  2VL1 A;  4UCN A;  2IMO A;  4CGL A;  5J8F A;  2NVX I;  5D1O B;  1XE4 A;  3KIF A;  1OZP A;  4AXV A;  4A3L I;  3EC4 A;  4ZI6 A;  2ZEM A;  3I55 Z;  4A3B I;  1Q81 2;  1S5K A;  4NBH A;  4NGT A;  4NGN A;  2V8K A;  2DE6 A;  2ZEO A;  3IWE A;  3FF3 A;  5F47 A;  3FMC A;  5K8P A;  3CDX A;  4QUS A;  5C4X I;  1Y8C A;  2RC4 A;  3KZW A;  4OC5 A;  1Q7Y 2;  4MCR A;  2X7B A;  3F0A A;  2O4H A;  1NP6 A;  2M48 A;  5AG4 A;  3K9T A;  4MD8 A;  4XNH C;  1YR0 A;  2JIM A;  1NUI A;  5J1Q A;  1YJ9 1;  4E31 A;  3CZX A;  2Z3L A;  5LYF A;  2PE3 A;  3IC1 A;  2ZEL A;  1K4J A;  5THW A;  1RO2 A;  1M1K 1;  2K3R A;  4OP4 A;  3PB6 X;  3PBE A;  1VQO 1;  4LQG A;  4ZY2 A;  4QC6 A;  4UIA A;  2JNY A;  1YME A;  3KKW A;  2CNS A;  2B4D B;  2ATR A;  3RBU A;  2Z3O A;  1J4J A;  5LRK A;  3QNV A;  2PC1 A;  2PJ5 A;  3S6K A;  3TFY A;  1JJ2 Z;  3QAH A;  1YJN Z;  1VQN Z;  1VHO A;  2V77 A;  3CCE 1;  4EWC A;  2HU9 A;  1VQ5 1;  3D8P A;  1I12 A;  4KVO E;  4BBR I;  1M4D A;  3S6F A;  5C44 I;  2ZEP A;  3BI0 A;  4F9V A;  4RUH A;  1AA6 A;  4A94 A;  1WII A;  2K5T A;  2PMZ A;  3HLP A;  1P0H A;  2R92 I;  4NJR A;  3B7I A;  1IB1 E;  3I07 A;  4FD7 A;  3TO6 A;  1Z8X A;  1QXF A;  3CCL 1;  3CXC Y;  1LAN A;  2GTH A;  3I1U A;  1YHQ 1;  3CCS Z;  2V8V A;  2WB1 A;  4NEX A;  4B5P A;  3B3V A;  3D7G A;  1TWA I;  3VMG A;  1ZLH A;  2OH1 A;  3OW2 Y;  4KOY A;  2D4P A;  3KQX A;  4IAV A;  4CPA A;  3F3F C;  2GIV A;  1Z8L A;  3JUW A;  3R9E A;  2I00 A;  1USP B;  4KOX A;  4Y49 B;  1VQ8 1;  1VQL 1;  2QYV A;  3H8E A;  3F8K A;  3D9X A;  4NBC A;  3CCV Z;  4C68 A;  2P28 A;  2B58 A;  4QB9 A;  2VPX A;  2KPI A;  4GS4 A;  4A3J I;  2ZOG A;  3BG1 B;  4JZ0 A;  1S72 1;  1XMB A;  1IIC A;  4PSW A;  2NYQ A;  2RFH A;  4MI4 A;  1FT7 A;  3WAB A;  2AKL A;  2F5I A;  5HVH A;  1R3N A;  1LAM A;  1VGY A;  2Q51 A;  1Z8W A;  2OOX B;  4F0Y A;  2VBQ A;  1DL6 A;  4UIB A;  1DE4 C;  3PB4 X;  1I6H I;  5A2Q f;  3GTJ I;  1GHE A;  4NGS A;  4XPD C;  4X6A I;  3FKI I;  3GKQ A;  1NSL A;  1Z03 A;  2JIO A;  2JR6 A;  2Z3M A;  4GXH A;  2Z3P A;  4L8A A;  4C2Y A;  4ORF A;  1NJI 1;  1TKH A;  2BSW A;  3WC5 A;  2AFW A;  1YIJ 1;  3PB7 X;  3S9L A;  2CY2 A;  3M4O I;  4EVY A;  4M6G A;  4CAV A;  3PO3 S;  1TWC I;  2QVP A;  2BO9 A;  2EWB A;  1ELM P;  2CNM A;  3KQZ A;  3FYN A;  3FIX A;  3PFE A;  2WUU A;  2YNC C;  2Q7B A;  1PU9 A;  4UEF A;  1U6M A;  2R7H A;  4AG7 A;  4ZBG A;  1WW9 A;  1XF8 A;  4B5P B;  1KRL A;  5A28 A;  4A93 I;  4Q7A A;  3D7H A;  2VPZ A;  2B63 I;  2ZEG A;  5EC4 A;  2ZEN A;  4JLY A;  3HUV A;  4KVX A;  4MBU A;  2Q4Y A;  4DJL A;  4DNC A;  2IZ4 A;  3CCQ 1;  5CNP A;  4OAE A;  1KUY A;  3DLJ A;  4A39 A;  3D2P A;  3D68 A;  1YVO A;  1VQ6 Z;  1Y9K A;  3EXN A;  2YND A;  4NBG A;  4PXE A;  3CPA A;  4UF4 A;  5C82 A;  4MCP A;  4BBS I;  3OW2 Z;  2F7V A;  2HC9 A;  4MY0 A;  4E33 A;  3B3C A;  2C6P A;  2AYD A;  1ZG7 A;  2Q44 A;  4NBE A;  4AYB A;  3FEE A;  1TWG I;  4FD5 A;  1YK3 A;  1QYP A;  2AFX A;  2YU9 I;  4UA3 A;  2ZOF A;  3R9G A;  4E2A A;  1WCM I;  1IID A;  4BIN A;  5AN9 F;  3MZL B;  3DDD A;  2A4N A;  1VQK 1;  3SI2 A;  1M44 A;  3K7A I;  2RIQ A;  2P6E A;  3VWE A;  3CC7 1;  1HDU A;  2EO8 A;  1NMT A;  2EK9 A;  1IGB A;  2VZZ A;  2YGW A;  3IU1 A;  5KTA A;  4NBB A;  4A30 A;  4QTT A;  3S6G A;  4KOT A;  3E0K A;  2QLV B;  4S1T A;  4XPD B;  3H3V J;  3N5F A;  4R57 A;  3J80 b;  2ABZ A;  3LWU A;  4K30 A;  1Y7R A;  2VF1 A;  5IT9 b;  3HOX I;  3PB9 X;  3GTO I;  1BAV A;  2CTB A;  2CTC A;  1Q86 2;  2PJ8 A;  1Z9U A;  1KZF A;  1CM0 A;  1LQL A;  4JYW A;  2VUM I;  2FCK A;  2ZAE B;  4RV9 A;  2PJ9 A;  2DPT A;  2ZXV A;  4R87 A;  1Q2C A;  3VAR A;  1KD1 2;  2BJO A;  3WT4 A;  4C7I A;  3D67 A;  4KOW A;  4IHM A;  4HH4 A;  4NOZ A;  4PXB A;  5F46 A;  3RZD I;  1ZB9 A;  3Q87 A;  1VQ9 Z;  2J9A A;  4Q38 A;  1QST A;  1XJO A;  2O53 A;  1YI2 1;  2EBJ A;  3JTK A;  1CP6 A;  5KTC A;  3BLN A;  3SI0 A;  1WZN A;  1XBU A;  3FBU A;  2V8J A;  3KR5 A;  3DSB A;  3VMH A;  5G1Z A;  4BXX I;  5D1O A;  2WPX A;  4B6Z A;  2JDC A;  3S14 I;  3HOZ I;  2PK7 A;  4TNU A;  1CG2 A;  4NF1 A;  2JIR A;  1PCA A;  1VQ4 Z;  4Y52 I;  3RO0 A;  2OB0 A;  2F8H A;  2D4O A;  2XEI A;  1RO0 A;  3BHX A;  4C2X A;  4RS2 A;  1N8R 2;  1F2O A;  1VQM Z;  1SIW A;  3D66 A;  5F09 A;  3DR8 A;  2ZPA A;  3G6E 1;  1ZG8 A;  3BJ7 A;  4EWT A;  2XEF A;  4CRY B;  2QEC A;  2QIR A;  2POK A;  3IGR A;  1VQ7 1;  2QR1 B;  2QEX Z;  2R98 A;  1IOI A;  2CF4 A;  1VKC A;  3IF8 A;  4DUK A;  3CD6 1;  4B10 A;  1S7N A;  1VQP Z;  2OOT A;  1YJW 1;  4OKO A;  2EK8 A;  4MY3 A;  4HGY A;  2PJ0 A;  2B4D A;  4A3G I;  2VQY A;  1N2F A;  4NBD A;  2B4B A;  4CS0 B;  2JA8 I;  3JAM f;  4U9Z A;  3S16 I;  1Z02 A;  2KI7 B;  3MZK B;  4NBA A;  2IQ6 A;  5IB0 A;  4KOV A;  4RVG A;  1BLL E;  4MCS A;  3VTN A;  4E30 A;  3QWU A;  2OTJ 1;  2NAP A;  3KI9 A;  4MHD A;  2H5M A;  3H0G I;  1I21 A;  4CYO A;  1MJ9 A;  2F4M A;  2Z10 A;  2RT9 A;  4KUB A;  2AFU A;  3HOV I;  4KUA A;  1PUA A;  3I9S A;  4KOS A;  1Z4E A;  1Q81 1;  4B5O A;  2CXA A;  1UFH A;  3MON A;  4RVH A;  2G3A A;  1GYT A;  2RPR A;  2G3T A;  3CCU 1;  1X0T A;  3ISZ A;  3I4N I;  1K9M 1;  4P44 A;  2B3V A;  2IJZ A;  1USP A;  5JPH A;  4NCZ A;  3J81 f;  3CCJ 1;  4P4D A;  2P6F A;  3G71 Z;  1LAP A;  3B35 A;  4CAF A;  3S2D I;  3TC8 A;  2WAQ A;  3UY5 A;  3KHZ A;  1FDI A;  2Q7S A;  1TXR A;  4H2K A;  1Q7L A;  5J8C A;  2GLJ A;  1Y1V S;  3SJE A;  5BWA B; 
#chains in the Genus database with same CATH homology
 5LYD A;  4P4E A;  4NGS A;  4X6A I;  3FKI I;  2QKD A;  5IT9 f;  4A3F I;  1CP7 A;  2OR4 A;  3S17 I;  1F57 A;  4ZY0 A;  2R6M A;  3RAM A;  3GKQ A;  1Z03 A;  1JWH C;  2JR6 A;  2ZEF A;  3B2Y A;  1RO4 A;  5HVG A;  2QA4 1;  3SI1 A;  5FLX b;  5IP7 I;  1VQ9 1;  1JJ2 Y;  4RS4 A;  2BOA A;  4OC3 A;  3T8W A;  5D1P A;  1NJI 1;  2H85 A;  1TKH A;  2OOY B;  3WC5 A;  2ZED A;  2AFW A;  4WWV A;  2VUG A;  1YIJ 1;  5JM6 A;  4RVF A;  3PB7 X;  4UEE A;  1YI2 Z;  1M1K 2;  1QQ9 A;  2E2J I;  3I55 1;  5T64 A;  1TWF I;  3K2K A;  3S9L A;  5T67 A;  4UEZ A;  3M4O I;  4W9Y A;  3U50 C;  4BD9 A;  2FVG A;  1ZH1 A;  3PO3 S;  3CC2 1;  3V38 A;  3NH5 A;  1Y0Y A;  2G9D A;  1TWC I;  3HOW I;  2V8H A;  4K3N A;  2QVP A;  2BO9 A;  4F8Z A;  2EWB A;  1Q86 1;  1ELM P;  1K8A 2;  3FEC A;  4PXC A;  3KQZ A;  5JH9 A;  5LYI A;  3PFE A;  2PJ3 A;  3IX0 A;  3SJX A;  2AFS A;  2CIJ A;  2PM9 A;  4NBF A;  1YUK A;  1VQ4 1;  4UEF A;  2M6N A;  2NVQ I;  5FLM I;  3PFO A;  3IFU A;  4DGL A;  3S9N A;  3GCF A;  2IZ3 A;  2OTL Z;  1WW9 A;  1KD1 1;  4P4B A;  1KRL A;  2JA5 I;  1AYE A;  1VQM 1;  4A93 I;  4Q7A A;  2QRC B;  3D7H A;  3GLJ A;  4ONW A;  1QF8 A;  2B63 I;  3J7A 4;  1H8L A;  2ZEG A;  4PQA A;  1TFI A;  1YJ9 Z;  1W2B Y;  3PEI A;  1X3W A;  1VLA A;  1QVG Y;  2V8D A;  4R76 A;  5LL6 f;  2ZEN A;  3KR4 A;  2ZEE A;  5T6B A;  1K73 1;  4Y7N I;  3HUV A;  3FQM A;  1RNI A;  1ZG9 A;  2AFM A;  5CM2 M;  1R9T I;  3G6E Z;  2XEG A;  3JRU A;  4DJL A;  2PJ2 A;  1YLO A;  1F2P A;  1SFO I;  3CPW Y;  3NH8 A;  5DS0 A;  3GTK I;  3TDH B;  3SJF A;  1VQO Z;  4R6T A;  2JMO A;  3S1N I;  2IZ4 A;  3I4M I;  3CCQ 1;  3FX6 A;  3L2N A;  2PCU A;  3S15 I;  5D8N A;  1P9N A;  3CCM 1;  2LIY A;  2W04 A;  4FBE A;  1LCP A;  4WJB A;  1EE3 P;  7CPA A;  4E2W A;  1L1O C;  3GTQ I;  2QEX 1;  1VQ7 Z;  1KQS Z;  3DLJ A;  4A39 A;  3NDI A;  3JAM b;  1TKJ A;  2PJ7 A;  3D68 A;  1VQ6 Z;  2YAD A;  1FNO A;  2J6A A;  1Q7Y 1;  2QRD B;  4NBG A;  2BCO A;  3CD6 Z;  4PXE A;  3HOY I;  2QRE B;  1VQP 1;  1Q82 1;  1YJN 1;  2E2I I;  2JA6 I;  4MHZ A;  3CPA A;  1VQN 1;  1YJW Z;  4UF4 A;  4XX2 A;  4R7M A;  2GTI A;  5ELY A;  3BXM A;  3EER A;  3S1R I;  3ESW A;  4A3M I;  1CBX A;  3B3W A;  4MCP A;  3CCE Z;  3OW2 Z;  3S1Q I;  4BBS I;  4A3D I;  2F7V A;  2HC9 A;  2R7Z I;  1VQ5 Z;  2DEA A;  1VHE A;  4E33 A;  4MHY A;  1N8R 1;  1RQF A;  4MRI A;  5C3E I;  2JEW A;  3B3C A;  1QMU A;  2AFO A;  1JQG A;  2C6P A;  3T4N B;  3SJG A;  2F4O A;  1ZG7 A;  3CMA Z;  1K9M 2;  1RTQ A;  2PVV A;  4NBE A;  2AFZ A;  3PBB A;  3IFE A;  4O23 A;  4MH4 A;  4AYB A;  3S9M A;  4NGQ A;  3VB9 A;  1YSJ A;  3FEE A;  2DE7 A;  4OID A;  4MCQ A;  4FUU A;  3LMS A;  1TWG I;  2OTJ Z;  5LRJ A;  1QYP A;  1KC8 2;  2YU9 I;  2AFX A;  1PYT B;  2ZOF A;  3LUS A;  4HGZ A;  3GTL I;  1WCM I;  3RZA A;  3B3S A;  5AN9 F;  3MZL B;  3CCL Z;  1R43 A;  1UWY A;  3CCS 1;  2DE5 A;  1VQK 1;  2I3C A;  3SI2 A;  1YHQ Z;  3CC4 Z;  3B3T A;  3K7A I;  3S1M I;  2Q4Z A;  2RIQ A;  3CPX A;  3S2H I;  3IIB A;  3CC7 1;  2JS4 A;  4MHP A;  3CME 1;  1YIT 1;  1QVF Y;  1HDU A;  4IK2 A;  1XRY A;  3I56 1;  4X2T A;  2G2K A;  4KSI A;  1CPX A;  2EK9 A;  4OME A;  1VIX A;  4TWE A;  1CPS A;  3J81 b;  1YUA A;  1IGB A;  5C4J I;  1Z2L A;  4NBB A;  4A3C I;  3D4U A;  4PPZ A;  5CPA A;  3NDJ A;  4E2Z A;  2C6C A;  3PB8 X;  3KGQ A;  8CPA A;  4QTT A;  4P4J A;  1VQ8 Z;  4E32 A;  3CCU Z;  1X3Z A;  1VQL Z;  1NJI 2;  3CQZ I;  4MXU A;  3CCV 1;  2PJA A;  2QLV B;  4S1T A;  3KHX A;  3H3V J;  3CCR Z;  4X3R A;  3F3P C;  3ISX A;  3N5F A;  2Y0S A;  1S7M A;  1RLY A;  1M4L A;  2K5R A;  3J80 b;  2ABZ A;  3LWU A;  3DGV A;  3VH9 A;  5A2Q b;  4OC0 A;  3GTM I;  2VF1 A;  1OBR A;  2PJB A;  3CCJ Z;  3G71 1;  1S72 Z;  5IT9 b;  4EME A;  3HOX I;  3PB9 X;  2EGT A;  3KIH A;  4ZX8 A;  1HDQ A;  3GTO I;  1BAV A;  2V8I A;  2CTB A;  2CTC A;  1Q86 2;  2PJ8 A;  4YU9 A;  4A37 A;  2E9H A;  4NJQ A;  5K8O A;  2WYR A;  2WZN A;  1LQL A;  1ML8 A;  2VUM I;  3FH4 A;  2ZAE B;  2GLF A;  4JYW A;  4RV9 A;  1TF9 A;  2PJ9 A;  3GTP I;  4PXD A;  3GTM S;  2PVW A;  1I50 I;  6CPA A;  3VAR A;  1LOK A;  4NGP A;  4OC1 A;  1KD1 2;  3NFZ A;  3IWW A;  3PO2 I;  3CT9 A;  2BJO A;  1NSA A;  3WC6 A;  1M90 1;  2JUB A;  3WT4 A;  2RHB A;  3D67 A;  1ARL A;  4X8I A;  4IHM A;  4OIW A;  4HH4 A;  4NOZ A;  4NGM A;  3IJ3 A;  4A3I I;  2HB6 A;  3RZD I;  1KWM A;  1ZB9 A;  4NB9 A;  2PRQ A;  4PXB A;  4DYO A;  2QA4 Z;  2P3Y A;  2VL1 A;  3Q87 A;  1K73 2;  1VQ9 Z;  2IMO A;  2J9A A;  1LFW A;  3CXC Z;  1W2B Z;  5D1O B;  2NVX I;  2W03 A;  1XJO A;  2O53 A;  1YI2 1;  3KIF A;  1CP6 A;  1YIJ Z;  4AXV A;  4A3L I;  3SI0 A;  2NVY I;  4ZI6 A;  3I55 Z;  4A3B I;  1XBU A;  1Q81 2;  2ANP A;  4NBH A;  2ZEM A;  4MD9 A;  4NGT A;  2RB7 A;  4NGN A;  2V8K A;  2DE6 A;  2ZEO A;  2HF1 A;  3BG0 B;  2V8J A;  3KR5 A;  3FQQ A;  2QJ8 A;  3VMH A;  5K8N A;  3FF3 A;  3CC2 Z;  3G4S Z;  2GRE A;  3FMC A;  4BXX I;  5D1O A;  3CDX A;  5K8P A;  5FLX f;  4B6Z A;  5C4X I;  4FAI A;  3S14 I;  3HOZ I;  3KZW A;  2PK7 A;  4TNU A;  4OC5 A;  3BI1 A;  5CBM A;  1Q7Y 2;  1CG2 A;  2PJ6 A;  2RBL A;  4MCR A;  1PCA A;  1Q82 2;  3KAS A;  1Z5R A;  1VQ4 Z;  4Y52 I;  2JBK A;  2O4H A;  1NP6 A;  4NH1 C;  2M48 A;  4A3E I;  3K9T A;  3VMI A;  2OTL 1;  1Y1V I;  1Y0R A;  4E2Y A;  2F8H A;  4MD8 A;  2XEI A;  4ZYQ A;  1RO0 A;  3BHX A;  2OZK A;  1N8R 2;  1F2O A;  3P5J B;  1VQM Z;  1NUI A;  5J1Q A;  4EFD A;  1YJ9 1;  4E31 A;  3D66 A;  4A3K I;  2PIY A;  5F09 A;  5LYF A;  2PE3 A;  3IC1 A;  2PJC A;  1I3Q I;  2ZEL A;  5THW A;  3IO1 A;  1RO2 A;  3HOU I;  3G6E 1;  1M1K 1;  4G1P A;  1ZG8 A;  2K3R A;  4FWU A;  5D29 A;  4EWT A;  4OP4 A;  3EED A;  2XEJ A;  3PB6 X;  1CX8 A;  1VQO 1;  2XEF A;  3PBE A;  4LQG A;  4ZY2 A;  3KL9 A;  4UIA A;  2JNY A;  4ZY1 A;  3M3Y I;  3CCQ Z;  1YME A;  3CCM Z;  1ZB8 A;  2POK A;  1ZLI A;  3H8F A;  3PO3 I;  1VQ7 1;  3D7F A;  2QR1 B;  2QEX Z;  3RBU A;  4P6Y A;  1VQ6 1;  3FVL A;  1K8A 1;  2CF4 A;  4CL1 A;  3IF8 A;  4P4I A;  4DUK A;  5LRK A;  3CD6 1;  3QNV A;  1HEE A;  2PJ5 A;  4ZX9 A;  2LFU A;  3TE5 B;  1JJ2 Z;  2PIZ A;  1VQP Z;  4MMO A;  2OOT A;  1YJW 1;  1YJN Z;  4OKO A;  3NA6 A;  1VQN Z;  2EK8 A;  1VHO A;  4HGY A;  1QVF Z;  2PJ0 A;  2V77 A;  5LRG A;  3CCE 1;  4EWC A;  4A3G I;  5IB9 A;  4P4F A;  2HU9 A;  3D6W A;  5JGF A;  1Y1W I;  1VQ5 1;  3G4S 1;  1YW4 A;  2C1C A;  2PJ4 A;  1N2F A;  1TWH I;  4BBR I;  1IY7 A;  4NBD A;  5C44 I;  2R93 I;  2ZEP A;  3BI0 A;  2JA8 I;  3JAM f;  4F9V A;  4RUH A;  4QTU A;  3GTG I;  4E2X A;  3S16 I;  3CMA 1;  4RVD A;  1Z02 A;  2KI7 B;  3MZK B;  4A94 A;  4NBA A;  3RZO I;  5HVF A;  5K8M A;  2IQ6 A;  1WII A;  4RVG A;  2E2H I;  1BLL E;  4MCS A;  2PMZ A;  3VTN A;  4E30 A;  3QWU A;  4BY1 I;  3HLP A;  2OTJ 1;  4OC4 A;  1YW6 A;  2R92 I;  4NJR A;  3KI9 A;  3B7I A;  3WC7 A;  2C6G A;  1KQS Y;  1ELL P;  3H0G I;  3GB0 A;  3I07 A;  3CCL 1;  3CXC Y;  4GM5 A;  1LAN A;  2GTH A;  3I1U A;  2V8G A;  4MD7 A;  3CC4 1;  1YHQ 1;  4NGR A;  2F4M A;  3CCS Z;  1VQK Z;  2V8V A;  2RT9 A;  3MN8 A;  2WB1 A;  2AFU A;  3HOV I;  1PFT A;  3B3V A;  3D7G A;  1QVG Z;  1TWA I;  2GU2 A;  3VMG A;  3CC7 Z;  3FJU A;  1ZLH A;  3V7Z A;  3CME Z;  1YIT Z;  2NVT I;  3OW2 Y;  4DK1 A;  3I56 Z;  1Q81 1;  1BPN A;  3VAT A;  5IP9 I;  4MHN A;  2PJ1 A;  2Q43 A;  3KQX A;  4IAV A;  4CPA A;  3F3F C;  1M90 2;  1Z8L A;  3FED A;  1AMP A;  2JBJ A;  1USP B;  4P45 A;  3MON A;  4RVH A;  3IEH A;  1BPM A;  3CPW Z;  2RPR A;  1GYT A;  3GUX A;  3H8G A;  1ARM A;  1VQ8 1;  1VQL 1;  3CCU 1;  2QYV A;  3H8E A;  1X0T A;  3ISZ A;  1Z01 A;  3D9X A;  3HKZ A;  4NBC A;  1TKF A;  3I4N I;  3CCV Z;  3CCR 1;  1TF8 A;  1XFO A;  1K9M 1;  2P28 A;  4P44 A;  4F9U A;  2IJZ A;  4A38 A;  2KPI A;  1USP A;  4A3J I;  1DTD A;  2ZOG A;  3TX8 A;  3BG1 B;  4P10 A;  3J81 f;  4BY7 I;  3CCJ 1;  4JZ0 A;  3NH4 A;  1Y7E A;  1S72 1;  1XMB A;  2ZEH A;  3MRU A;  4P4D A;  2JA7 I;  3G71 Z;  1LAP A;  3B35 A;  3PRT A;  1KC8 1;  3S2D I;  2NYQ A;  4NB8 A;  2RFH A;  3TC8 A;  1FT7 A;  5HXD A;  3WAB A;  2WAQ A;  4R8F A;  2AKL A;  5HVH A;  1R3N A;  1LAM A;  1VGY A;  4NFR A;  3KHZ A;  2Q51 A;  1TXR A;  1K83 I;  4MON A;  3D7D A;  2OOX B;  4H2K A;  1DL6 A;  3J80 f;  4UIB A;  1DE4 C;  3PB4 X;  2NSM A;  1Q7L A;  1I6H I;  5I4M A;  4YWY A;  4DQY B;  5A2Q f;  4OC2 A;  4Z65 A;  2GLJ A;  5LYL A;  1Y1V S;  3GTJ I;  3SJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...