2GU2A

Crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Aspa protein
total genus 92
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gu2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2gu2A01
2EK8A 1F2OA 2ZEGA 4ZY0A 1HDQA 4Q7AA 4TWEA 3LMSA 2O4HA 3PB6X 1TKJA 2J9AA 4DYOA 3PFOA 1Z2LA 4JZ0A 5LYLA 1ARMA 4MMOA 2EWBA 1M4LA 4P4BA 2AFWA 2Q4ZA 5LRJA 3B7IA 1YSJA 2PJAA 4OIDA 2G9DA 3D7GA 4UIBA 1R43A 2V8HA 1BAVA 4P4IA 1XBUA 2RB7A 1DTDA 3KASA 2ZEDA 3L2NA 4EWTA 5LYDA 2C6CA 3TX8A 6CPAA 1F57A 1HEEA 3IO1A 3WABA 4DJLA 5K8PA 1LOKA 1VIXA 4KSIA 5ELYA 3FH4A 5HVFA 1CX8A 2WYRA 3NFZA 3GLJA 2IJZA 4IHMA 1VHEA 4PQAA 3PB9X 4ZY1A 3JRUA 3K9TA 2CTBA 4P4JA 2PJ8A 2IQ6A 3B3SA 5D29A 3RBUA 1BPMA 3KR5A 4K3NA 4FAIA 2PJ1A 5F09A 3PB8X 3RZAA 1R3NA 4YWYA 3FEDA 4F9UA 3D7HA 3NH8A 3PBEA 8CPAA 2QJ8A 2AFXA 4LQGA 4R7MA 5LYFA 4OC5A 1BLLE 3B2YA 2HB6A 2OR4A 1LFWA 1F2PA 2CF4A 5CBMA 4TNUA 3BI1A 2PJ6A 2BOAA 3PFEA 3S9LA 3BI0A 5THWA 2PJ2A 1Z5RA 4NGPA 4P44A 2QYVA 3CT9A 3FX6A 4ONWA 1TKHA 3DGVA 4P4EA 2I3CA 1ELLP 4A37A 2V8DA 4MRIA 2VL1A 3IEHA 2ZELA 4R76A 3KR4A 4CPAA 1JQGA 3SI0A 2V77A 1CG2A 4MHPA 1Z8LA 1Y7EA 4EMEA 3QNVA 2AFUA 1RTQA 3NA6A 2BO9A 2PJCA 4NFRA 3LWUA 3FEEA 3IFEA 4MCPA 4OC0A 3IC1A 3FVLA 4NGNA 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 1ZG9A 3SJGA 2BCOA 4MCRA 4UEZA 3B3TA 3KZWA 1CPXA 4NJQA 2GLFA 2AFMA 3CPAA 2F7VA 5CPAA 3WC5A 4R8FA 3WC7A 2XEFA 3ISZA 2ZOFA 3D7DA 1VHOA 1CPSA 4NGRA 3GB0A 3WT4A 1CBXA 2ZEFA 5JGFA 5D8NA 3TC8A 4YU9A 4X2TA 4IK2A 2OOTA 4OC1A 2PCUA 4MCSA 4A94A 4WWVA 3VH9A 3BHXA 4EFDA 2NSMA 3B3WA 1EE3P 3D68A 1LAMA 2XEGA 4P10A 1GYTA 5K8OA 2NYQA 2AFSA 4NJRA 2CIJA 2XEJA 4W9YA 2PIZA 1OBRA 3KL9A 4A39A 4FUUA 2JBJA 2C6GA 2ABZA 3FECA 3SJXA 2V8VA 1Y0YA 7CPAA 5J1QA 4F8ZA 2WZNA 2RFHA 1AYEA 3V7ZA 2C1CA 4UIAA 4FWUA 1XRYA 3HUVA 3IIBA 3SJEA 2JBKA 1XJOA 5IB9A 2PJ4A 1ZLIA 2PVWA 3KQXA 4H2KA 3IJ3A 4UEEA 2ZEHA 1XFOA 3K2KA 5K8NA 3S9MA 1ARLA 2GLJA 1BPNA 1YLOA 5HVGA 1YMEA 3RAMA 2ZENA 1CP7A 5JH9A 1TF8A 3KHZA 2PJ7A 1IGBA 2PJ9A 3SI1A 2PIYA 1TKFA 3FF3A 4MHZA 3H8EA 4P6YA 4BD9A 4FBEA 2C6PA 1TXRA 2ZOGA 4OKOA 1YW4A 2PRQA 3SI2A 2Q43A 5HVHA 4GM5A 4OMEA 4OP4A 3B35A 2HC9A 3PRTA 2POKA 4UF4A 4OIWA 5HXDA 2ZEMA 3KHXA 1CP6A 3NH5A 2V8GA 4ZX8A 2F8HA 4MCQA 3ISXA 3DLJA 2PJ5A 3KGQA 4MXUA 4OC2A 3D4UA 3SJFA 4DUKA 4PPZA 4IAVA 4R6TA 2EK9A 4MHYA 5K8MA 3VARA 4OC4A 1YW6A 3WC6A 1ZG7A 1ZG8A 1LANA 1UWYA 2DEAA 2ANPA 4G1PA 4NGMA 5LYIA 3S9NA 4B6ZA 2QVPA 4WJBA 4NGQA 1Q7LA 4X8IA 3D67A 4AXVA 2ZEEA 4P4DA 4Z65A 4X3RA 5LRKA 1ZLHA 4F9VA 4P4FA 2JEWA 4UEFA 3D66A 1FNOA 2GU2A 3B3VA 3V38A 3T8WA 2O53A 3VATA 3PB4X 1LCPA 3FMCA 3PB7X 3GUXA 4NGTA 3PBBA 1VGYA 2Q51A 4ZYQA 3NH4A 4PXCA 4JYWA 2FVGA 2ZEPA 3HLPA 2GREA 2ZEOA 4MHNA 1PYTB 4ZX9A 2PE3A 2AFZA 3IWWA 3H8FA 4PXEA 1IY7A 3MN8A 3H8GA 1HDUA 3KQZA 3PEIA 4OC3A 5DS0A 4ZY2A 4NGSA 2PJ0A 2PJ3A 1TF9A 3FJUA 2IMOA 3D7FA 1XMBA 1FT7A 4PXDA 5LRGA 1LAPA 1NSAA 2PJBA 3BXMA 4O23A 4ZI6A 4PXBA 2AFOA 1KWMA 3N5FA 5I4MA 4P45A 2CTCA 3CDXA 3I1UA 4A38A 1Y0RA 3KI9A 5JM6A 4RUHA 3B3CA 3MRUA 1QQ9A 2XEIA 1ELMP 2PVVA
chains in the Genus database with same CATH superfamily
2VUMI 1QVGZ 2EK8A 4A3LI 2JNYA 2ZEGA 2Z0ZA 3IU2A 4TWEA 3LMSA 1TKJA 4DYOA 3PFOA 1Z2LA 3FYNA 2VPXA 3JAMb 5LRJA 4E2XA 2G9DA 4UIBA 4XX2A 1R43A 4P4IA 2E7ZA 1YHQZ 1DTDA 4UFVA 1NE9A 3I561 3CCR1 4QTUA 4U9ZA 2HF1A 1LOKA 1VIXA 2ZW5A 1RXTA 4NB8A 2OTL1 5ELYA 5HVFA 2Q4YA 1CX8A 2WYRA 3GLJA 4Y7NI 4XNHB 1I12A 4R3LA 3FKII 2QR1B 1L0CA 1Q822 4RVFA 1VHEA 1VQN1 1IU8A 2JLMA 4B11A 3JRUA 3CCJ1 4PSXA 4P4JA 3GTKI 1K731 1FY7A 4KOTA 4II9A 4I49A 2OTLZ 1YX0A 2IQ6A 3B3SA 5D29A 3RBUA 2P3YA 1NP6A 3KR5A 4PK2A 2E2II 4FAIA 4HKFA 3RZAA 1R3NA 1RO2A 4RI1A 3GTPI 4MBUA 1VQ51 4MFZA 5FVJA 2JDDA 1BLLE 2Q7BA 2J8RA 3PO3S 2IV2X 1W2BZ 1XOVA 1F2PA 3G4SZ 1JJ2Z 5THWA 2DPTA 3BG1B 4P44A 2QYVA 3CT9A 3FX6A 3GTGI 1FDIA 1KD12 4Y49C 3DGVA 4P4EA 5CNPA 1R9TI 3NE7A 2VL1A 3IEHA 3EO4A 4CYNA 2QRDB 3I551 3KR4A 1TWFI 1ML8A 1VKCA 4KVXA 2B3UA 3IR7A 3QNVA 4E0AA 2AFUA 3R9EA 4R3KA 4KSAA 1Y8CA 4RV9A 3CME1 3IFEA 4MCPA 3IC1A 3LD2A 1Y1WI 3CPXA 2OZKA 3SJGA 2CNMA 2Q04A 5IT9b 4UWJA 4RS4A 4NJQA 4NBEA 2F7VA 4FD4A 3WC5A 1MK4A 3QB8A 3S2DI 1KQSZ 1NJI1 5A2Qb 4NGRA 2ZEFA 2R6MA 5E96A 3A9LA 2JEVA 3F5BA 2V8IA 3P5JB 2R98A 4A3DI 3W6SA 4WWVA 1Q2DA 3B3WA 1EE3P 4YFJA 4CYQA 2PR8A 2PIZA 5T6BA 2BEIA 5J8CA 5C3EI 4FUUA 5IP9I 2JA8I 3KKWA 1M44A 5G22A 3BLNA 5AN9F 3I4MI 1P9NA 4F8ZA 2WZNA 2RFHA 4B10A 2C1CA 4UIAA 4CGMA 4KOUA 4UCPA 1XMTA 1QSNA 1YJN1 3VTNA 4CAEA 4XPLA 2PJ4A 3I3GA 3KQXA 2ZW6A 4QBJA 2AYDA 4U9YA 1RQFA 4UEEA 2FIAA 1YUKA 3D9XA 1QSRA 3PGPA 2GLJA 1BPNA 2J6AA 1P0HA 2ARHA 1OZPA 2RIQA 5F48A 1TF8A 1YJ9Z 2DXQA 3SI1A 2PIYA 2X7BA 4MHZA 3ESWA 4BD9A 3CC71 3CD6Z 1TXRA 2ZOGA 1Q811 5DWNA 4AB7A 3SI2A 3TOBA 3NDIA 1IB1E 1WJ2A 3CCS1 4KORA 1K9M2 4Q38A 3SHPA 1YVOA 4GM5A 1A2ZA 4BBRI 2FIWA 4KOVA 4OIWA 1P4NA 5HXDA 4JXQA 4MCQA 3ISXA 3C26A 3DLJA 4MXUA 3D4UA 3G6E1 4PPZA 2RHBA 4R6TA 4XNHC 4CAVA 4MHYA 2ZW4A 4A3BI 1WIIA 1ZG7A 4NGMA 1I1DA 4G1PA 1Q7LA 5C4XI 4Z65A 2F4MA 1IYKA 5LRKA 4F9VA 4NBGA 4A3MI 1S7NA 4RVGA 2JEWA 1Z8XA 5DWMA 3GTLI 5AGEA 2I79A 2CY2A 4HGYA 2YNCA 3T8WA 3P2FA 2VZYA 1V0CA 1QSTA 3VATA 4NBBA 3M4OI 2JUBA 1VQKZ 3PBBA 4QB9A 5JQ4A 1B87A 3RNZA 3NH4A 1YIJZ 4CS0B 2GREA 1PYTB 2PE3A 3K7AI 3W91A 3TO7A 3G8WA 1AUGA 1IY7A 3T90A 1TWCI 3MN8A 5KTAA 1HDUA 4NGSA 4JLYA 2PJ0A 4MH4A 1Y7RA 1QVFY 4PK3A 1XMBA 4QUSA 4NOZA 3HOXI 1NUIA 1VQOZ 2VBQA 3CDXA 3R1KA 1M4DA 4R9MA 1Y0RA 3KI9A 4RUHA 3B3CA 3S1QI 2XEIA 3CXQA 3GTMI 4Q7AA 4Q36A 3PB6X 2J9AA 3J81b 2GANA 2P6GA 1Q2YA 4MMOA 2EWBA 2Q4ZA 1W2BY 3R96A 1ZB8A 3S1MI 2P6EA 4AVBA 3HOWI 2FCKA 1WZNA 2V3VA 2HU9A 3MGDA 2DE7A 4KLVA 2RB7A 4J3GA 5LL6f 3KASA 3TO9A 6CPAA 3IO1A 5H84A 1TWGI 3WABA 5K8PA 5GCNA 2NVTI 2ATRA 1N8R1 1N71A 4IHMA 3NDJA 2QA41 4PQAA 3PB9X 3D2LA 4F0YA 2QRCB 2G2KA 3Q87A 2CTBA 1KC81 1VQ41 1YITZ 4K3NA 3S6KA 5F09A 2HUZA 3D7HA 4R57A 5C88A 1S721 3PBEA 2B3VA 2PM9A 2RC4A 4R7MA 4OC5A 2DF5A 4UCMA 2HB6A 1M4GA 2OR4A 3B2YA 2Y0SA 3I55Z 2PJ6A 2BOAA 2QEXZ 3FBUA 3PFEA 4OAEA 4BBHA 3BI0A 5HH1A 4BY1I 1VQMZ 2B4DB 2F5IA 3CCJZ 1QSMA 3EY5A 2JR6A 3HKZA 3JUWA 2W03A 2BSWA 4AYBA 4A37A 3JAMf 4NEXA 2IZ3A 4MRIA 4NBDA 2ZELA 5JPHA 4CPAA 2PQ8A 2V77A 4KUAA 4C7HA 2CXAA 4HPSA 4XPDC 2FL4A 1IYLA 3GY9A 1VQ91 1RTQA 1UFHA 4BY7I 1GHEA 2BO9A 3DDDA 1RO4A 2PJCA 1K9M1 1MJBA 3CXCY 4NF1A 3LWUA 3MZLB 3CCSZ 2JA5I 3FVLA 1VQO1 4NGNA 1H8LA 1DE4C 3LODA 3PZJA 2Z3OA 2BCOA 4MCRA 4YGOA 1ZO0A 3GTJI 3GTOI 1Q861 1KZFA 4IF5A 3S17I 1RO0A 2GLFA 2AFMA 5CPAA 3WC7A 2RT9A 3H0GI 4R8FA 3CCRZ 1IIDA 4JD6A 4QTTA 3D7DA 1CBXA 5JGFA 5D8NA 4MD7A 4ZBGA 4IK2A 5F49A 3CZXA 4OC1A 2PCUA 4A3CI 3DR6A 2VUGA 1PUAA 4NBCA 3CCV1 2V45A 2GTIA 1YREA 2K5TA 2E2HI 2JIRA 2D4OA 1M902 5EC4A 4P10A 2PC1A 2HV2A 2REFA 4NJRA 2AKLA 2ABZA 3FECA 3QAYA 2DE6A 4AVAA 2V8VA 2QMLA 7CPAA 5J1QA 2E9HA 1S5KA 3R9GA 3RYOA 4CAWA 4LX9A 4FWUA 5AG6A 4C2ZA 3CC4Z 3SJEA 2JBKA 2YGWA 5IB9A 4M6IA 3PO2I 2PVWA 3IJ3A 2ZXVA 2ZEHA 3EC4A 2GTHA 5K8NA 2OOXB 4A3EI 1YLOA 1YLEA 4C2XA 1CP7A 5JH9A 3I56Z 2Z3KA 5F47A 1TIQA 2VQYA 1TKFA 2ZPAA 4P6YA 4HNXB 1I6HI 2PRQA 2Q43A 4XPDB 1Q7Y2 2OZUA 3CCMZ 4OMEA 1Q812 1VQNZ 2NVQI 1RO5A 2HC9A 2POKA 2ZEMA 4KVME 3NH5A 4MY0A 4ZX8A 2F8HA 2LIYA 2WPWA 3PO3I 3KGQA 3LUSA 4OC2A 3SJFA 4C68A 2EK9A 1KUVA 3TDHB 4A95A 3WC6A 1VQ71 1XF8A 1ZG8A 2DEAA 2ANPA 1X10A 3S9NA 4MFJA 4NGQA 2YNCC 2ZEEA 1VQK1 2BJOA 4AG7A 4P4FA 2PMZA 4F6AA 1Q7Y1 3VWDA 2EVNA 2V8KA 2OTJZ 3T4NB 2O53A 1LCPA 3GUXA 4NGTA 4DQYB 5FLXb 2VZZA 3B8GA 2B63I 5IV0A 4ZYQA 3CCU1 4ZX9A 2H5MA 3H8FA 1WWZA 4AG9A 4HGZA 3DR8A 1Y9KA 3RZOI 5AG7A 5A27A 1K8A1 5EMIA 3H8GA 1PFTA 1YUAA 1YIT1 3CCQ1 2PJ3A 2IMOA 2VXKA 3D7FA 4CYPA 3TCVA 2K3RA 1I21A 4LUAA 3G6EZ 1M1K1 1KUXA 5LRGA 1LAPA 1NSAA 3BXMA 2P6FA 4IUSA 1KWMA 1USPB 4NBAA 1XEBA 4RN7A 5FLXf 4A38A 3CXSA 1X0TA 4XPKA 1AA6A 2QA4Z 4EVYA 4MFQA 1QYPA 3T9YA 1VLAA 4ZY0A 1HDQA 3I4NI 4H6UA 3CC7Z 2JDCA 3J7A4 4RVDA 4KLWA 3GKQA 3FQMA 1Q16A 5LYLA 3D2MA 5T67A 1M4LA 4P4BA 2B4BA 2WPXA 2PJAA 4DNCA 4NSQA 5EBVA 5IB0A 4OIDA 4UA3A 3V8IA 5G21A 2RBLA 1CJWA 1Z9UA 2V8HA 1X3ZA 1XBUA 5IX3A 3CPWZ 4EWTA 3BJ8A 3GTMS 2C6CA 3IWEA 3J80f 3TX8A 3UY5A 3QWUA 1YQEA 4E32A 4MFPA 3FB3A 4KSIA 3FH4A 4KVOE 1YI2Z 3FQQA 2PK7A 1NSLA 2IZ4A 4A3GI 3F3PC 1BO4A 2C27A 3M3YI 2JIOA 4FD5A 1VQP1 4ZY1A 1M901 5AG4A 3IU1A 2QEX1 2FE7A 1Z4EA 4BMHA 2IL4A 1BPMA 2OH1A 2OOYB 2PJ1A 1M1DA 4F9UA 1Z8TA 4PSWA 2OU2A 8CPAA 2QJ8A 3VMHA 2R7ZI 4LQGA 3TO6A 3EEDA 1M1K2 5LYFA 2O28A 1LFWA 3CPWY 3H3VJ 3WR7A 3F8KA 2CF4A 3HOUI 3BI1A 3S9LA 4B12A 4X5KA 2PJ2A 4NGPA 4ORFA 2REEA 2J8NA 3J81f 4ONWA 2I3CA 4BBSI 1ELLP 2V8DA 2K5RA 4RS2A 4NCZA 1JWHC 3CCUZ 1KUYA 4M6GA 3D8PA 2GE3A 1JQGA 1K4JA 3SI0A 1CG2A 4MHPA 2P28A 2Q7SA 2R7HA 2QLVB 4EMEA 1QVGY 2Z3LA 1LQLA 2I00A 3TTHA 5D1PA 1L1OC 1TWHI 5D1OA 3FEEA 4B5PB 4MFLA 1S7MA 3LACA 4OC0A 2Z3NA 3RZDI 1AMPA 1QMUA 4A3II 1S60A 4OADA 3CXPA 3FXTA 5IP7I 2ODFA 5ISVA 4GS4A 4K30A 3CCVZ 4KSFA 3CPAA 1YIJ1 1SIWA 3H5ZA 3ISZA 2ZW7A 2VF1A 1VHOA 1CPSA 4E2ZA 1VQM1 3GB0A 1Y1VS 3TC8A 2LEXA 4X2TA 2J8MA 4A94A 3GCFA 2NSMA 4A31A 1KQSY 3D68A 4LQ6A 1LAMA 3EFAA 4UCNA 2QIRA 2NYQA 3F3FC 2XEJA 4A2ZA 1OBRA 2AJ6A 1YJWZ 3KL9A 1VQ4Z 2JBJA 3VWEA 3SJXA 1X12A 4A3JI 1Z01A 4NBFA 2Q4VA 1AYEA 2OZGA 2KCWA 3I9SA 1Q821 3IIBA 2JMOA 1ZLIA 4KOSA 4JJXA 1VQ8Z 4QVTA 4HNYB 3I07A 4CGPA 1XFOA 1VQL1 3K2KA 3S9MA 5C82A 3RAMA 2ZENA 4BXXI 4QC6A 4H89A 2HQYA 2D4PA 2PJ9A 3FF3A 4MJ8A 3H8EA 3SXOA 4FBEA 5G20A 4JWPA 1YW4A 4NB9A 2KPIA 2NAPA 3FRMA 3G4S1 2AE6A 4OP4A 2M6NA 4HH4A 3FIXA 2G0BA 4KZTA 3KHXA 1CP6A 2JA7I 5AG5A 4KUBA 2V8GA 5KTCA 1VQ7Z 4MHDA 2BUEA 1N8R2 2PJ5A 2NMTA 2RPRA 4DUKA 1S3ZA 2GFQA 5K8MA 4OC4A 4EWCA 1UWYA 4NBHA 5LYIA 3TT2A 2QKDA 2QVPA 4FD7A 1QXFA 3HOZI 3IWGA 3ZJ0A 3MZKB 4X8IA 3D67A 4AXVA 4P4DA 1R57A 4U5YA 4A32A 3R95A 1ZLHA 3S2HI 1VQLZ 4JXRA 1Q2CA 1Q862 5HMNA 1Z02A 3IF8A 3D66A 1Z03A 1FNOA 2GU2A 3B3VA 3V38A 3GYAA 1YVKA 4CAFA 4UWIA 1VHSA 3PB4X 4CRZB 3FMCA 3PB7X 1Z4RA 3CC21 2Q51A 2Z3MA 4PXCA 2KI7B 4JYWA 2FVGA 2ZEPA 4MHNA 2AFZA 3IWWA 4PXEA 1IOIA 4E8OA 5H86A 2EO8A 2G3AA 1KD11 5DS0A 4OC3A 4ZY2A 3MONA 1RNIA 4MD8A 3CXCZ 1WCMI 1FT7A 1MJ9A 3D2PA 4B14A 3EERA 2AFOA 3H4QA 5I4MA 4P45A 2CTCA 3I1UA 1N2FA 1BOBA 3CCE1 3MRUA 1QQ9A 4M3SA 2GIVA 2Z3PA 1ZB9A 2E2JI 1ELMP 2PVVA 2PJ8A 3CCL1 1F2OA 3JVNA 1QSOA 5KTDA 1WW9A 2YU9I 2O4HA 1Y9WA 4B5OA 2CNTA 4JZ0A 4MFKA 1ARMA 2VI7A 4C7IA 3OW2Y 2AFWA 3CC2Z 1NJI2 5BWAB 3B7IA 4CAXA 1YSJA 4A3FI 2WB1A 1M4IA 3D7GA 3N7ZA 2WAQA 4A93I 1TFIA 4KOYA 4UFWA 1BAVA 1SFOI 3TOAA 2ZEDA 3L2NA 5C4JI 1ZH1A 4FD6A 5LYDA 2B5GB 2Q0YA 1F57A 1HEEA 4KS9A 4PV6A 4DJLA 1Z8WA 3DSBA 3JTKA 1RLYA 3NFZA 3G71Z 3CMAZ 2IJZA 2JS4A 3IFUA 4E30A 1YHQ1 3S6GA 4KOWA 1I3QI 4OLLA 2P0WA 4UBRA 3K9TA 2PDOA 2EBJA 5A2Qf 1S7FA 1YGHA 4DK1A 1MJAA 3BG0B 2Z10A 2Y0MA 3PB8X 3CCLZ 4YWYA 3FEDA 1YK3A 3P2HA 2R92I 3OW2Z 3OWCA 3NH8A 1S7LA 2AFXA 3TFYA 4ONUA 2B5GA 1QVFZ 5CBMA 4TNUA 4A3KI 3S6FA 1VQPZ 5FLMI 3VMIA 2WSAA 1Z5RA 1VQ6Z 1TKHA 1PU9A 2G3TA 4B13A 1X3WA 5T64A 2LFUA 4R76A 1Z8LA 3NE8A 1Y7EA 2R8VA 2OZHA 3SXNA 4CGOA 5CM2M 3NA6A 4MONA 1B6BA 4KOXA 4NFRA 3IGRA 3PP9A 2VPWA 3J80b 3CCQZ 3GIUA 2DE5A 2JIMA 2FXFA 3R9FA 1PCAA 4B5PA 1U6MA 1ZG9A 1IICA 3KIHA 2H85A 5F46A 4UEZA 3B3TA 3KZWA 1CPXA 5J8FA 3K9UA 2VPYA 4CGLA 2XEFA 2YNDA 2ZOFA 3F0AA 4BINA 3VB9A 3WT4A 2NVYI 3S16I 3BJ7A 4YU9A 3U50C 4YRHA 2OOTA 5D1OB 4MCSA 2V8JA 1IOFA 2R93I 1K8A2 3G3SA 3VH9A 3BHXA 1YJNZ 4M85A 4EFDA 1JJ2Y 2B58A 4AVCA 1YJW1 2QREB 3E0KA 4H6ZA 4R87A 2XEGA 1GYTA 5K8OA 3CD61 2EUIA 5IT9f 2BL1A 2AFSA 2CIJA 4E31A 4W9YA 2EGTA 4A39A 2C6GA 1VQ5Z 3RO0A 3CCEZ 1Y0YA 2JA6I 3V7ZA 3S15I 1ON0A 4HNWB 4CYOA 1XRYA 5A28A 3HUVA 1XJOA 4A33A 2OB0A 4H2KA 2F4OA 3KIFA 3D6WA 3HOVI 1FDOA 3EXNA 1YI21 5C44I 2FS5A 1ARLA 3ZZIA 5HVGA 1VQ9Z 2FSRA 1YMEA 3S1RI 3DNSA 4Y49B 3KHZA 2PJ7A 1IGBA 3CMEZ 2M48A 3CC41 2C6PA 5I0CA 4OKOA 1YJ91 4X6AI 5HVHA 2CNSA 1TWAI 3TE5B 2JIPA 3CQZI 3B35A 2R1IA 1KRLA 1K732 1SQHA 2B4DA 3PRTA 4UF4A 4E2YA 4A30A 4S1TA 3VMGA 4IAVA 4MD9A 3VARA 1YW6A 3CCM1 2Q44A 1LANA 4C2YA 4E33A 4B6ZA 4NXYA 3HOYI 1K83I 4GXHA 4WJBA 3S1NI 2WUUA 4X3RA 1Y1VI 4M6HA 2FT0A 3IX0A 4UEFA 2DPSA 2PSWA 1J4JA 1CM0A 3GKRA 3S14I 4UFXA 2NVXI 2YNEA 3G711 3CMA1 1I50I 1LRZA 2PRBA 1S7KA 1WK4A 1VGYA 1NMTA 4CRYB 1XIXA 4ZGYB 2VEZA 3HLPA 4E2WA 3GTQI 2ZEOA 4L8AA 4RVHA 2YADA 2JIQA 2OTJ1 1USPA 3S6HA 3W6XA 4MI4A 3KQZA 3PEIA 2A4NA 1S72Z 1QF8A 1VQ81 3D3SA 1TF9A 2ZAEB 3FJUA 4MY3A 4CGNA 4E2AA 2Z11A 2W04A 4CL1A 4PXDA 4F0XA 2PJBA 4O23A 4ZI6A 2VPZA 4PXBA 2QECA 3N5FA 4L89A 3TE4A 5G1ZA 1XE4A 1DL6A 3FNCA 1YR0A 4Y52I 3QAHA 2PR1A 1JWQA 5JM6A 4DGLA 1KC82 4NH1C 1VQ61
chains in the Genus database with same CATH topology
1QYPA 2VUMI 3GTMI 3CCL1 1QVGZ 4A3LI 1VLAA 2JNYA 2EK8A 1F2OA 2ZEGA 4ZY0A 1HDQA 4Q7AA 3I4NI 4TWEA 3LMSA 3CC7Z 3WT4A 1WW9A 2YU9I 2O4HA 4RVDA 3J7A4 1TKJA 3PB6X 2J9AA 3GKQA 3J81b 4DYOA 3PFOA 3FQMA 1Z2LA 4JZ0A 5LYLA 1ARMA 5T67A 4MMOA 2EWBA 1M4LA 4P4BA 3OW2Y 2AFWA 2Q4ZA 3JAMb 1W2BY 3CC2Z 1NJI2 5LRJA 1ZB8A 3S1MI 4E2XA 3B7IA 1YSJA 2PJAA 4A3FI 4OIDA 2G9DA 2WB1A 3D7GA 2WAQA 3HOWI 4A93I 4UIBA 4XX2A 1TFIA 2RBLA 1R43A 2HU9A 2V8HA 1BAVA 1X3ZA 2DE7A 1SFOI 4P4IA 1XBUA 2RB7A 3CPWZ 1YHQZ 5LL6f 1DTDA 2ZEDA 3KASA 3L2NA 5C4JI 4EWTA 1ZH1A 5LYDA 3GTMS 2C6CA 3J80f 3I561 3TX8A 3QWUA 6CPAA 1F57A 1HEEA 3CCR1 3IO1A 4QTUA 4E32A 1TWGI 3WABA 4DJLA 5K8PA 2HF1A 1LOKA 1VIXA 4NB8A 2OTL1 4KSIA 5ELYA 3FH4A 5HVFA 1CX8A 2WYRA 1RLYA 1YI2Z 2NVTI 3NFZA 3FQQA 4Y7NI 2PK7A 3G71Z 3CMAZ 2IZ4A 3GLJA 2IJZA 2JS4A 4A3GI 3IFUA 3F3PC 3FKII 2QR1B 4E30A 1YHQ1 1N8R1 4IHMA 1I3QI 3NDJA 1Q822 2QA41 4RVFA 1VHEA 1VQN1 4PQAA 3M3YI 3PB9X 1VQP1 4ZY1A 1M901 2QRCB 3JRUA 3K9TA 2G2KA 3Q87A 3CCJ1 2CTBA 5A2Qf 1KC81 1VQ41 4DK1A 4P4JA 3GTKI 1K731 1YITZ 2QEX1 3BG0B 2OTLZ 2IQ6A 3B3SA 5D29A 3RBUA 2P3YA 1BPMA 1NP6A 3KR5A 4K3NA 2E2II 2OOYB 4FAIA 2PJ1A 5F09A 3PB8X 3RZAA 1R3NA 3CCLZ 4YWYA 1RO2A 3FEDA 4F9UA 3GTPI 3D7HA 2R92I 3OW2Z 3NH8A 1S721 1VQ51 3PBEA 2PM9A 8CPAA 2QJ8A 3VMHA 2R7ZI 2AFXA 4LQGA 4R7MA 3EEDA 1M1K2 5LYFA 4OC5A 1BLLE 1QVFZ 3PO3S 2HB6A 2OR4A 3B2YA 1W2BZ 1LFWA 3CPWY 2Y0SA 3H3VJ 1F2PA 2CF4A 5CBMA 4TNUA 3G4SZ 4A3KI 3HOUI 3I55Z 3BI1A 2PJ6A 2BOAA 2QEXZ 3PFEA 3S9LA 1JJ2Z 3BI0A 4BY1I 1VQPZ 1VQMZ 5THWA 5FLMI 3VMIA 2PJ2A 3BG1B 3CCJZ 1Z5RA 4NGPA 1VQ6Z 4P44A 2QYVA 3CT9A 3FX6A 3J81f 3GTGI 2JR6A 3HKZA 1KD12 4ONWA 1TKHA 2W03A 3DGVA 4AYBA 4P4EA 2I3CA 4BBSI 1ELLP 4A37A 3JAMf 2V8DA 2K5RA 2IZ3A 1R9TI 4MRIA 2VL1A 1X3WA 4NBDA 1JWHC 5T64A 3CCUZ 3IEHA 2ZELA 2QRDB 2LFUA 4R76A 3I551 3KR4A 1TWFI 4CPAA 1ML8A 1JQGA 2V77A 3SI0A 1CG2A 4MHPA 2P28A 1Z8LA 2QLVB 1Y7EA 4EMEA 3QNVA 1QVGY 5CM2M 2AFUA 1LQLA 1VQ91 1RTQA 4BY7I 3NA6A 2BO9A 4MONA 5D1PA 1RO4A 1L1OC 2PJCA 1TWHI 1K9M1 4NFRA 5D1OA 3CXCY 3LWUA 4RV9A 3CME1 3FEEA 3MZLB 3J80b 3CCSZ 3IFEA 4MCPA 1S7MA 3CCQZ 3IC1A 4OC0A 2JA5I 3FVLA 1VQO1 2DE5A 4NGNA 3RZDI 1Y1WI 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 4A3II 1ZG9A 2OZKA 3SJGA 2BCOA 4MCRA 3KIHA 2H85A 3GTJI 4UEZA 5IT9b 3GTOI 1Q861 3B3TA 3KZWA 5IP7I 1CPXA 3S17I 1RO0A 4RS4A 4NJQA 3CCVZ 2GLFA 4NBEA 2AFMA 3CPAA 2F7VA 1YIJ1 5CPAA 3WC5A 2RT9A 3H0GI 4R8FA 3WC7A 2XEFA 3CCRZ 3S2DI 1KQSZ 3ISZA 1NJI1 2ZOFA 5A2Qb 4QTTA 2VF1A 2PVVA 3D7DA 3VB9A 1VHOA 1CPSA 4E2ZA 1VQM1 3GB0A 2NVYI 2R6MA 1CBXA 2ZEFA 4NGRA 1Y1VS 3S16I 5D8NA 3TC8A 5JGFA 4YU9A 3U50C 4X2TA 4MD7A 4IK2A 2OOTA 2V8IA 3P5JB 5D1OB 4OC1A 2PCUA 4MCSA 2V8JA 4A3CI 4A94A 4A3DI 2R93I 4WWVA 2VUGA 1K8A2 3VH9A 4NBCA 3GCFA 3BHXA 3CCV1 2GTIA 1YJNZ 4EFDA 1JJ2Y 2NSMA 2E2HI 3B3WA 1YJW1 1EE3P 2QREB 1KQSY 1M902 3D68A 1LAMA 2XEGA 4P10A 1GYTA 5K8OA 3CD61 2NYQA 5IT9f 3F3FC 2AFSA 4NJRA 2CIJA 4E31A 2XEJA 4W9YA 2PIZA 5T6BA 1OBRA 5C3EI 2AKLA 2EGTA 1YJWZ 1VQ4Z 3KL9A 4FUUA 2JBJA 4A39A 5IP9I 2JA8I 2ABZA 2C6GA 1VQ5Z 3FECA 2DE6A 3SJXA 2V8VA 3CCEZ 1Y0YA 7CPAA 5J1QA 5AN9F 2E9HA 2JA6I 4A3JI 3I4MI 1Z01A 1P9NA 4NBFA 4F8ZA 2WZNA 2RFHA 1AYEA 3V7ZA 3S15I 2C1CA 4UIAA 4FWUA 1XRYA 1YJN1 1Q821 3CC4Z 3HUVA 3VTNA 3IIBA 3SJEA 2JBKA 1XJOA 2JMOA 5IB9A 2PJ4A 1ZLIA 3PO2I 2PVWA 3KQXA 4H2KA 2F4OA 3KIFA 1VQ8Z 3D6WA 3IJ3A 3I07A 3HOVI 1RQFA 4UEEA 2ZEHA 1XFOA 2GTHA 1VQL1 1YUKA 1YI21 5C44I 3D9XA 3K2KA 5K8NA 2OOXB 3S9MA 1ARLA 4A3EI 2GLJA 1BPNA 1YLOA 5HVGA 2J6AA 1VQ9Z 1YMEA 3RAMA 2RIQA 3S1RI 4BXXI 1CP7A 2ZENA 5JH9A 1TF8A 3I56Z 3KHZA 1YJ9Z 2PJ7A 1IGBA 3CMEZ 2PJ9A 3SI1A 2PIYA 1TKFA 3FF3A 4MHZA 2M48A 3H8EA 3ESWA 4P6YA 4BD9A 4FBEA 3CC71 3CD6Z 3CC41 2C6PA 1TXRA 2ZOGA 1I6HI 1Q811 4OKOA 1YW4A 2PRQA 1YJ91 3SI2A 2Q43A 4NB9A 3NDIA 4X6AI 5HVHA 2KPIA 1TWAI 3CCS1 3TE5B 1Q7Y2 1K9M2 3G4S1 3CQZI 4GM5A 3CCMZ 4OP4A 4OMEA 3B35A 1Q812 2M6NA 1VQNZ 2NVQI 1KRLA 4HH4A 1K732 2HC9A 3PRTA 4BBRI 2POKA 4UF4A 4OIWA 5HXDA 4E2YA 2ZEMA 3KHXA 1CP6A 3NH5A 2JA7I 2V8GA 4ZX8A 2F8HA 2LIYA 1VQ7Z 4MCQA 3ISXA 3DLJA 1N8R2 2PJ5A 3PO3I 3KGQA 3LUSA 4MXUA 2RPRA 4S1TA 3D4UA 4OC2A 3SJFA 3VMGA 4DUKA 3G6E1 4PPZA 4IAVA 2RHBA 4R6TA 2EK9A 4MHYA 4MD9A 3VARA 5K8MA 4OC4A 1YW6A 3WC6A 3CCM1 3TDHB 4EWCA 4A3BI 1WIIA 1ZG7A 1VQ71 1LANA 4NBHA 1UWYA 1ZG8A 2ANPA 2DEAA 2QKDA 4G1PA 4NGMA 5LYIA 3S9NA 4E33A 4B6ZA 2QVPA 3HOYI 1K83I 4WJBA 3HOZI 3S1NI 4NGQA 3MZKB 1Q7LA 4X8IA 3D67A 4AXVA 2ZEEA 4P4DA 5C4XI 1VQK1 4Z65A 2BJOA 2F4MA 4X3RA 5LRKA 1ZLHA 3S2HI 4F9VA 1Y1VI 2PMZA 4NBGA 1VQLZ 4A3MI 4P4FA 4RVGA 1Q7Y1 1Q862 2JEWA 1Z02A 3IX0A 4UEFA 3IF8A 3D66A 1Z03A 3GTLI 1FNOA 2GU2A 3B3VA 3V38A 4HGYA 3T8WA 2V8KA 3S14I 2OTJZ 3T4NB 2NVXI 2O53A 3G711 3CMA1 3VATA 1I50I 4NBBA 3PB4X 1LCPA 3FMCA 3PB7X 3GUXA 4NGTA 3M4OI 2JUBA 5FLXb 4DQYB 1VQKZ 3PBBA 1VGYA 3CC21 2Q51A 2B63I 4ZYQA 3NH4A 4PXCA 2KI7B 1YIJZ 4JYWA 2FVGA 2ZEPA 3HLPA 2GREA 4E2WA 3GTQI 1PYTB 2ZEOA 3CCU1 4MHNA 4ZX9A 2PE3A 3K7AI 2AFZA 3IWWA 3H8FA 4RVHA 2YADA 4PXEA 4HGZA 2OTJ1 1IY7A 3RZOI 1USPA 1K8A1 1KD11 1TWCI 3MN8A 3H8GA 1PFTA 1HDUA 1YUAA 3KQZA 3PEIA 4OC3A 1S72Z 5DS0A 4ZY2A 4NGSA 1YIT1 3MONA 3CCQ1 1RNIA 1QF8A 2PJ0A 4MD8A 3CXCZ 1VQ81 4MH4A 2PJ3A 1WCMI 1TF9A 2ZAEB 3FJUA 2IMOA 1QVFY 3D7FA 1FT7A 2W04A 2K3RA 4CL1A 1XMBA 3G6EZ 1M1K1 4PXDA 4NOZA 3HOXI 1NUIA 1LAPA 1NSAA 2PJBA 3BXMA 5LRGA 4O23A 4ZI6A 3EERA 1VQOZ 4PXBA 2AFOA 1KWMA 1USPB 4NBAA 3N5FA 5I4MA 4P45A 2CTCA 5FLXf 3CDXA 3I1UA 1N2FA 4A38A 1DL6A 1X0TA 1Y0RA 2QA4Z 3KI9A 4Y52I 5JM6A 3CCE1 4DGLA 4RUHA 1KC82 3B3CA 3MRUA 3S1QI 4NH1C 1QQ9A 2XEIA 1ZB9A 2E2JI 1ELMP 1VQ61 2PJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK8 A;  1F2O A;  2ZEG A;  4ZY0 A;  1HDQ A;  4Q7A A;  4TWE A;  3LMS A;  2O4H A;  3PB6 X;  1TKJ A;  2J9A A;  4DYO A;  3PFO A;  1Z2L A;  4JZ0 A;  5LYL A;  1ARM A;  4MMO A;  2EWB A;  1M4L A;  4P4B A;  2AFW A;  2Q4Z A;  5LRJ A;  3B7I A;  1YSJ A;  2PJA A;  4OID A;  2G9D A;  3D7G A;  4UIB A;  1R43 A;  2V8H A;  1BAV A;  4P4I A;  1XBU A;  2RB7 A;  1DTD A;  3KAS A;  2ZED A;  3L2N A;  4EWT A;  5LYD A;  2C6C A;  3TX8 A;  6CPA A;  1F57 A;  1HEE A;  3IO1 A;  3WAB A;  4DJL A;  5K8P A;  1LOK A;  1VIX A;  4KSI A;  5ELY A;  3FH4 A;  5HVF A;  1CX8 A;  2WYR A;  3NFZ A;  3GLJ A;  2IJZ A;  4IHM A;  1VHE A;  4PQA A;  3PB9 X;  4ZY1 A;  3JRU A;  3K9T A;  2CTB A;  4P4J A;  2PJ8 A;  2IQ6 A;  3B3S A;  5D29 A;  3RBU A;  1BPM A;  3KR5 A;  4K3N A;  4FAI A;  2PJ1 A;  5F09 A;  3PB8 X;  3RZA A;  1R3N A;  4YWY A;  3FED A;  4F9U A;  3D7H A;  3NH8 A;  3PBE A;  8CPA A;  2QJ8 A;  2AFX A;  4LQG A;  4R7M A;  5LYF A;  4OC5 A;  1BLL E;  3B2Y A;  2HB6 A;  2OR4 A;  1LFW A;  1F2P A;  2CF4 A;  5CBM A;  4TNU A;  3BI1 A;  2PJ6 A;  2BOA A;  3PFE A;  3S9L A;  3BI0 A;  5THW A;  2PJ2 A;  1Z5R A;  4NGP A;  4P44 A;  2QYV A;  3CT9 A;  3FX6 A;  4ONW A;  1TKH A;  3DGV A;  4P4E A;  2I3C A;  1ELL P;  4A37 A;  2V8D A;  4MRI A;  2VL1 A;  3IEH A;  2ZEL A;  4R76 A;  3KR4 A;  4CPA A;  1JQG A;  3SI0 A;  2V77 A;  1CG2 A;  4MHP A;  1Z8L A;  1Y7E A;  4EME A;  3QNV A;  2AFU A;  1RTQ A;  3NA6 A;  2BO9 A;  2PJC A;  4NFR A;  3LWU A;  3FEE A;  3IFE A;  4MCP A;  4OC0 A;  3IC1 A;  3FVL A;  4NGN A;  1AMP A;  1H8L A;  1PCA A;  1DE4 C;  3CPX A;  1QMU A;  1ZG9 A;  3SJG A;  2BCO A;  4MCR A;  4UEZ A;  3B3T A;  3KZW A;  1CPX A;  4NJQ A;  2GLF A;  2AFM A;  3CPA A;  2F7V A;  5CPA A;  3WC5 A;  4R8F A;  3WC7 A;  2XEF A;  3ISZ A;  2ZOF A;  3D7D A;  1VHO A;  1CPS A;  4NGR A;  3GB0 A;  3WT4 A;  1CBX A;  2ZEF A;  5JGF A;  5D8N A;  3TC8 A;  4YU9 A;  4X2T A;  4IK2 A;  2OOT A;  4OC1 A;  2PCU A;  4MCS A;  4A94 A;  4WWV A;  3VH9 A;  3BHX A;  4EFD A;  2NSM A;  3B3W A;  1EE3 P;  3D68 A;  1LAM A;  2XEG A;  4P10 A;  1GYT A;  5K8O A;  2NYQ A;  2AFS A;  4NJR A;  2CIJ A;  2XEJ A;  4W9Y A;  2PIZ A;  1OBR A;  3KL9 A;  4A39 A;  4FUU A;  2JBJ A;  2C6G A;  2ABZ A;  3FEC A;  3SJX A;  2V8V A;  1Y0Y A;  7CPA A;  5J1Q A;  4F8Z A;  2WZN A;  2RFH A;  1AYE A;  3V7Z A;  2C1C A;  4UIA A;  4FWU A;  1XRY A;  3HUV A;  3IIB A;  3SJE A;  2JBK A;  1XJO A;  5IB9 A;  2PJ4 A;  1ZLI A;  2PVW A;  3KQX A;  4H2K A;  3IJ3 A;  4UEE A;  2ZEH A;  1XFO A;  3K2K A;  5K8N A;  3S9M A;  1ARL A;  2GLJ A;  1BPN A;  1YLO A;  5HVG A;  1YME A;  3RAM A;  2ZEN A;  1CP7 A;  5JH9 A;  1TF8 A;  3KHZ A;  2PJ7 A;  1IGB A;  2PJ9 A;  3SI1 A;  2PIY A;  1TKF A;  3FF3 A;  4MHZ A;  3H8E A;  4P6Y A;  4BD9 A;  4FBE A;  2C6P A;  1TXR A;  2ZOG A;  4OKO A;  1YW4 A;  2PRQ A;  3SI2 A;  2Q43 A;  5HVH A;  4GM5 A;  4OME A;  4OP4 A;  3B35 A;  2HC9 A;  3PRT A;  2POK A;  4UF4 A;  4OIW A;  5HXD A;  2ZEM A;  3KHX A;  1CP6 A;  3NH5 A;  2V8G A;  4ZX8 A;  2F8H A;  4MCQ A;  3ISX A;  3DLJ A;  2PJ5 A;  3KGQ A;  4MXU A;  4OC2 A;  3D4U A;  3SJF A;  4DUK A;  4PPZ A;  4IAV A;  4R6T A;  2EK9 A;  4MHY A;  5K8M A;  3VAR A;  4OC4 A;  1YW6 A;  3WC6 A;  1ZG7 A;  1ZG8 A;  1LAN A;  1UWY A;  2DEA A;  2ANP A;  4G1P A;  4NGM A;  5LYI A;  3S9N A;  4B6Z A;  2QVP A;  4WJB A;  4NGQ A;  1Q7L A;  4X8I A;  3D67 A;  4AXV A;  2ZEE A;  4P4D A;  4Z65 A;  4X3R A;  5LRK A;  1ZLH A;  4F9V A;  4P4F A;  2JEW A;  4UEF A;  3D66 A;  1FNO A;  2GU2 A;  3B3V A;  3V38 A;  3T8W A;  2O53 A;  3VAT A;  3PB4 X;  1LCP A;  3FMC A;  3PB7 X;  3GUX A;  4NGT A;  3PBB A;  1VGY A;  2Q51 A;  4ZYQ A;  3NH4 A;  4PXC A;  4JYW A;  2FVG A;  2ZEP A;  3HLP A;  2GRE A;  2ZEO A;  4MHN A;  1PYT B;  4ZX9 A;  2PE3 A;  2AFZ A;  3IWW A;  3H8F A;  4PXE A;  1IY7 A;  3MN8 A;  3H8G A;  1HDU A;  3KQZ A;  3PEI A;  4OC3 A;  5DS0 A;  4ZY2 A;  4NGS A;  2PJ0 A;  2PJ3 A;  1TF9 A;  3FJU A;  2IMO A;  3D7F A;  1XMB A;  1FT7 A;  4PXD A;  5LRG A;  1LAP A;  1NSA A;  2PJB A;  3BXM A;  4O23 A;  4ZI6 A;  4PXB A;  2AFO A;  1KWM A;  3N5F A;  5I4M A;  4P45 A;  2CTC A;  3CDX A;  3I1U A;  4A38 A;  1Y0R A;  3KI9 A;  5JM6 A;  4RUH A;  3B3C A;  3MRU A;  1QQ9 A;  2XEI A;  1ELM P;  2PVV A; 
#chains in the Genus database with same CATH topology
 2VUM I;  1QVG Z;  2EK8 A;  4A3L I;  2JNY A;  2ZEG A;  2Z0Z A;  3IU2 A;  4TWE A;  3LMS A;  1TKJ A;  4DYO A;  3PFO A;  1Z2L A;  3FYN A;  2VPX A;  3JAM b;  5LRJ A;  4E2X A;  2G9D A;  4UIB A;  4XX2 A;  1R43 A;  4P4I A;  2E7Z A;  1YHQ Z;  1DTD A;  4UFV A;  1NE9 A;  3I56 1;  3CCR 1;  4QTU A;  4U9Z A;  2HF1 A;  1LOK A;  1VIX A;  2ZW5 A;  1RXT A;  4NB8 A;  2OTL 1;  5ELY A;  5HVF A;  2Q4Y A;  1CX8 A;  2WYR A;  3GLJ A;  4Y7N I;  4XNH B;  1I12 A;  4R3L A;  3FKI I;  2QR1 B;  1L0C A;  1Q82 2;  4RVF A;  1VHE A;  1VQN 1;  1IU8 A;  2JLM A;  4B11 A;  3JRU A;  3CCJ 1;  4PSX A;  4P4J A;  3GTK I;  1K73 1;  1FY7 A;  4KOT A;  4II9 A;  4I49 A;  2OTL Z;  1YX0 A;  2IQ6 A;  3B3S A;  5D29 A;  3RBU A;  2P3Y A;  1NP6 A;  3KR5 A;  4PK2 A;  2E2I I;  4FAI A;  4HKF A;  3RZA A;  1R3N A;  1RO2 A;  4RI1 A;  3GTP I;  4MBU A;  1VQ5 1;  4MFZ A;  5FVJ A;  2JDD A;  1BLL E;  2Q7B A;  2J8R A;  3PO3 S;  2IV2 X;  1W2B Z;  1XOV A;  1F2P A;  3G4S Z;  1JJ2 Z;  5THW A;  2DPT A;  3BG1 B;  4P44 A;  2QYV A;  3CT9 A;  3FX6 A;  3GTG I;  1FDI A;  1KD1 2;  4Y49 C;  3DGV A;  4P4E A;  5CNP A;  1R9T I;  3NE7 A;  2VL1 A;  3IEH A;  3EO4 A;  4CYN A;  2QRD B;  3I55 1;  3KR4 A;  1TWF I;  1ML8 A;  1VKC A;  4KVX A;  2B3U A;  3IR7 A;  3QNV A;  4E0A A;  2AFU A;  3R9E A;  4R3K A;  4KSA A;  1Y8C A;  4RV9 A;  3CME 1;  3IFE A;  4MCP A;  3IC1 A;  3LD2 A;  1Y1W I;  3CPX A;  2OZK A;  3SJG A;  2CNM A;  2Q04 A;  5IT9 b;  4UWJ A;  4RS4 A;  4NJQ A;  4NBE A;  2F7V A;  4FD4 A;  3WC5 A;  1MK4 A;  3QB8 A;  3S2D I;  1KQS Z;  1NJI 1;  5A2Q b;  4NGR A;  2ZEF A;  2R6M A;  5E96 A;  3A9L A;  2JEV A;  3F5B A;  2V8I A;  3P5J B;  2R98 A;  4A3D I;  3W6S A;  4WWV A;  1Q2D A;  3B3W A;  1EE3 P;  4YFJ A;  4CYQ A;  2PR8 A;  2PIZ A;  5T6B A;  2BEI A;  5J8C A;  5C3E I;  4FUU A;  5IP9 I;  2JA8 I;  3KKW A;  1M44 A;  5G22 A;  3BLN A;  5AN9 F;  3I4M I;  1P9N A;  4F8Z A;  2WZN A;  2RFH A;  4B10 A;  2C1C A;  4UIA A;  4CGM A;  4KOU A;  4UCP A;  1XMT A;  1QSN A;  1YJN 1;  3VTN A;  4CAE A;  4XPL A;  2PJ4 A;  3I3G A;  3KQX A;  2ZW6 A;  4QBJ A;  2AYD A;  4U9Y A;  1RQF A;  4UEE A;  2FIA A;  1YUK A;  3D9X A;  1QSR A;  3PGP A;  2GLJ A;  1BPN A;  2J6A A;  1P0H A;  2ARH A;  1OZP A;  2RIQ A;  5F48 A;  1TF8 A;  1YJ9 Z;  2DXQ A;  3SI1 A;  2PIY A;  2X7B A;  4MHZ A;  3ESW A;  4BD9 A;  3CC7 1;  3CD6 Z;  1TXR A;  2ZOG A;  1Q81 1;  5DWN A;  4AB7 A;  3SI2 A;  3TOB A;  3NDI A;  1IB1 E;  1WJ2 A;  3CCS 1;  4KOR A;  1K9M 2;  4Q38 A;  3SHP A;  1YVO A;  4GM5 A;  1A2Z A;  4BBR I;  2FIW A;  4KOV A;  4OIW A;  1P4N A;  5HXD A;  4JXQ A;  4MCQ A;  3ISX A;  3C26 A;  3DLJ A;  4MXU A;  3D4U A;  3G6E 1;  4PPZ A;  2RHB A;  4R6T A;  4XNH C;  4CAV A;  4MHY A;  2ZW4 A;  4A3B I;  1WII A;  1ZG7 A;  4NGM A;  1I1D A;  4G1P A;  1Q7L A;  5C4X I;  4Z65 A;  2F4M A;  1IYK A;  5LRK A;  4F9V A;  4NBG A;  4A3M I;  1S7N A;  4RVG A;  2JEW A;  1Z8X A;  5DWM A;  3GTL I;  5AGE A;  2I79 A;  2CY2 A;  4HGY A;  2YNC A;  3T8W A;  3P2F A;  2VZY A;  1V0C A;  1QST A;  3VAT A;  4NBB A;  3M4O I;  2JUB A;  1VQK Z;  3PBB A;  4QB9 A;  5JQ4 A;  1B87 A;  3RNZ A;  3NH4 A;  1YIJ Z;  4CS0 B;  2GRE A;  1PYT B;  2PE3 A;  3K7A I;  3W91 A;  3TO7 A;  3G8W A;  1AUG A;  1IY7 A;  3T90 A;  1TWC I;  3MN8 A;  5KTA A;  1HDU A;  4NGS A;  4JLY A;  2PJ0 A;  4MH4 A;  1Y7R A;  1QVF Y;  4PK3 A;  1XMB A;  4QUS A;  4NOZ A;  3HOX I;  1NUI A;  1VQO Z;  2VBQ A;  3CDX A;  3R1K A;  1M4D A;  4R9M A;  1Y0R A;  3KI9 A;  4RUH A;  3B3C A;  3S1Q I;  2XEI A;  3CXQ A;  3GTM I;  4Q7A A;  4Q36 A;  3PB6 X;  2J9A A;  3J81 b;  2GAN A;  2P6G A;  1Q2Y A;  4MMO A;  2EWB A;  2Q4Z A;  1W2B Y;  3R96 A;  1ZB8 A;  3S1M I;  2P6E A;  4AVB A;  3HOW I;  2FCK A;  1WZN A;  2V3V A;  2HU9 A;  3MGD A;  2DE7 A;  4KLV A;  2RB7 A;  4J3G A;  5LL6 f;  3KAS A;  3TO9 A;  6CPA A;  3IO1 A;  5H84 A;  1TWG I;  3WAB A;  5K8P A;  5GCN A;  2NVT I;  2ATR A;  1N8R 1;  1N71 A;  4IHM A;  3NDJ A;  2QA4 1;  4PQA A;  3PB9 X;  3D2L A;  4F0Y A;  2QRC B;  2G2K A;  3Q87 A;  2CTB A;  1KC8 1;  1VQ4 1;  1YIT Z;  4K3N A;  3S6K A;  5F09 A;  2HUZ A;  3D7H A;  4R57 A;  5C88 A;  1S72 1;  3PBE A;  2B3V A;  2PM9 A;  2RC4 A;  4R7M A;  4OC5 A;  2DF5 A;  4UCM A;  2HB6 A;  1M4G A;  2OR4 A;  3B2Y A;  2Y0S A;  3I55 Z;  2PJ6 A;  2BOA A;  2QEX Z;  3FBU A;  3PFE A;  4OAE A;  4BBH A;  3BI0 A;  5HH1 A;  4BY1 I;  1VQM Z;  2B4D B;  2F5I A;  3CCJ Z;  1QSM A;  3EY5 A;  2JR6 A;  3HKZ A;  3JUW A;  2W03 A;  2BSW A;  4AYB A;  4A37 A;  3JAM f;  4NEX A;  2IZ3 A;  4MRI A;  4NBD A;  2ZEL A;  5JPH A;  4CPA A;  2PQ8 A;  2V77 A;  4KUA A;  4C7H A;  2CXA A;  4HPS A;  4XPD C;  2FL4 A;  1IYL A;  3GY9 A;  1VQ9 1;  1RTQ A;  1UFH A;  4BY7 I;  1GHE A;  2BO9 A;  3DDD A;  1RO4 A;  2PJC A;  1K9M 1;  1MJB A;  3CXC Y;  4NF1 A;  3LWU A;  3MZL B;  3CCS Z;  2JA5 I;  3FVL A;  1VQO 1;  4NGN A;  1H8L A;  1DE4 C;  3LOD A;  3PZJ A;  2Z3O A;  2BCO A;  4MCR A;  4YGO A;  1ZO0 A;  3GTJ I;  3GTO I;  1Q86 1;  1KZF A;  4IF5 A;  3S17 I;  1RO0 A;  2GLF A;  2AFM A;  5CPA A;  3WC7 A;  2RT9 A;  3H0G I;  4R8F A;  3CCR Z;  1IID A;  4JD6 A;  4QTT A;  3D7D A;  1CBX A;  5JGF A;  5D8N A;  4MD7 A;  4ZBG A;  4IK2 A;  5F49 A;  3CZX A;  4OC1 A;  2PCU A;  4A3C I;  3DR6 A;  2VUG A;  1PUA A;  4NBC A;  3CCV 1;  2V45 A;  2GTI A;  1YRE A;  2K5T A;  2E2H I;  2JIR A;  2D4O A;  1M90 2;  5EC4 A;  4P10 A;  2PC1 A;  2HV2 A;  2REF A;  4NJR A;  2AKL A;  2ABZ A;  3FEC A;  3QAY A;  2DE6 A;  4AVA A;  2V8V A;  2QML A;  7CPA A;  5J1Q A;  2E9H A;  1S5K A;  3R9G A;  3RYO A;  4CAW A;  4LX9 A;  4FWU A;  5AG6 A;  4C2Z A;  3CC4 Z;  3SJE A;  2JBK A;  2YGW A;  5IB9 A;  4M6I A;  3PO2 I;  2PVW A;  3IJ3 A;  2ZXV A;  2ZEH A;  3EC4 A;  2GTH A;  5K8N A;  2OOX B;  4A3E I;  1YLO A;  1YLE A;  4C2X A;  1CP7 A;  5JH9 A;  3I56 Z;  2Z3K A;  5F47 A;  1TIQ A;  2VQY A;  1TKF A;  2ZPA A;  4P6Y A;  4HNX B;  1I6H I;  2PRQ A;  2Q43 A;  4XPD B;  1Q7Y 2;  2OZU A;  3CCM Z;  4OME A;  1Q81 2;  1VQN Z;  2NVQ I;  1RO5 A;  2HC9 A;  2POK A;  2ZEM A;  4KVM E;  3NH5 A;  4MY0 A;  4ZX8 A;  2F8H A;  2LIY A;  2WPW A;  3PO3 I;  3KGQ A;  3LUS A;  4OC2 A;  3SJF A;  4C68 A;  2EK9 A;  1KUV A;  3TDH B;  4A95 A;  3WC6 A;  1VQ7 1;  1XF8 A;  1ZG8 A;  2DEA A;  2ANP A;  1X10 A;  3S9N A;  4MFJ A;  4NGQ A;  2YNC C;  2ZEE A;  1VQK 1;  2BJO A;  4AG7 A;  4P4F A;  2PMZ A;  4F6A A;  1Q7Y 1;  3VWD A;  2EVN A;  2V8K A;  2OTJ Z;  3T4N B;  2O53 A;  1LCP A;  3GUX A;  4NGT A;  4DQY B;  5FLX b;  2VZZ A;  3B8G A;  2B63 I;  5IV0 A;  4ZYQ A;  3CCU 1;  4ZX9 A;  2H5M A;  3H8F A;  1WWZ A;  4AG9 A;  4HGZ A;  3DR8 A;  1Y9K A;  3RZO I;  5AG7 A;  5A27 A;  1K8A 1;  5EMI A;  3H8G A;  1PFT A;  1YUA A;  1YIT 1;  3CCQ 1;  2PJ3 A;  2IMO A;  2VXK A;  3D7F A;  4CYP A;  3TCV A;  2K3R A;  1I21 A;  4LUA A;  3G6E Z;  1M1K 1;  1KUX A;  5LRG A;  1LAP A;  1NSA A;  3BXM A;  2P6F A;  4IUS A;  1KWM A;  1USP B;  4NBA A;  1XEB A;  4RN7 A;  5FLX f;  4A38 A;  3CXS A;  1X0T A;  4XPK A;  1AA6 A;  2QA4 Z;  4EVY A;  4MFQ A;  1QYP A;  3T9Y A;  1VLA A;  4ZY0 A;  1HDQ A;  3I4N I;  4H6U A;  3CC7 Z;  2JDC A;  3J7A 4;  4RVD A;  4KLW A;  3GKQ A;  3FQM A;  1Q16 A;  5LYL A;  3D2M A;  5T67 A;  1M4L A;  4P4B A;  2B4B A;  2WPX A;  2PJA A;  4DNC A;  4NSQ A;  5EBV A;  5IB0 A;  4OID A;  4UA3 A;  3V8I A;  5G21 A;  2RBL A;  1CJW A;  1Z9U A;  2V8H A;  1X3Z A;  1XBU A;  5IX3 A;  3CPW Z;  4EWT A;  3BJ8 A;  3GTM S;  2C6C A;  3IWE A;  3J80 f;  3TX8 A;  3UY5 A;  3QWU A;  1YQE A;  4E32 A;  4MFP A;  3FB3 A;  4KSI A;  3FH4 A;  4KVO E;  1YI2 Z;  3FQQ A;  2PK7 A;  1NSL A;  2IZ4 A;  4A3G I;  3F3P C;  1BO4 A;  2C27 A;  3M3Y I;  2JIO A;  4FD5 A;  1VQP 1;  4ZY1 A;  1M90 1;  5AG4 A;  3IU1 A;  2QEX 1;  2FE7 A;  1Z4E A;  4BMH A;  2IL4 A;  1BPM A;  2OH1 A;  2OOY B;  2PJ1 A;  1M1D A;  4F9U A;  1Z8T A;  4PSW A;  2OU2 A;  8CPA A;  2QJ8 A;  3VMH A;  2R7Z I;  4LQG A;  3TO6 A;  3EED A;  1M1K 2;  5LYF A;  2O28 A;  1LFW A;  3CPW Y;  3H3V J;  3WR7 A;  3F8K A;  2CF4 A;  3HOU I;  3BI1 A;  3S9L A;  4B12 A;  4X5K A;  2PJ2 A;  4NGP A;  4ORF A;  2REE A;  2J8N A;  3J81 f;  4ONW A;  2I3C A;  4BBS I;  1ELL P;  2V8D A;  2K5R A;  4RS2 A;  4NCZ A;  1JWH C;  3CCU Z;  1KUY A;  4M6G A;  3D8P A;  2GE3 A;  1JQG A;  1K4J A;  3SI0 A;  1CG2 A;  4MHP A;  2P28 A;  2Q7S A;  2R7H A;  2QLV B;  4EME A;  1QVG Y;  2Z3L A;  1LQL A;  2I00 A;  3TTH A;  5D1P A;  1L1O C;  1TWH I;  5D1O A;  3FEE A;  4B5P B;  4MFL A;  1S7M A;  3LAC A;  4OC0 A;  2Z3N A;  3RZD I;  1AMP A;  1QMU A;  4A3I I;  1S60 A;  4OAD A;  3CXP A;  3FXT A;  5IP7 I;  2ODF A;  5ISV A;  4GS4 A;  4K30 A;  3CCV Z;  4KSF A;  3CPA A;  1YIJ 1;  1SIW A;  3H5Z A;  3ISZ A;  2ZW7 A;  2VF1 A;  1VHO A;  1CPS A;  4E2Z A;  1VQM 1;  3GB0 A;  1Y1V S;  3TC8 A;  2LEX A;  4X2T A;  2J8M A;  4A94 A;  3GCF A;  2NSM A;  4A31 A;  1KQS Y;  3D68 A;  4LQ6 A;  1LAM A;  3EFA A;  4UCN A;  2QIR A;  2NYQ A;  3F3F C;  2XEJ A;  4A2Z A;  1OBR A;  2AJ6 A;  1YJW Z;  3KL9 A;  1VQ4 Z;  2JBJ A;  3VWE A;  3SJX A;  1X12 A;  4A3J I;  1Z01 A;  4NBF A;  2Q4V A;  1AYE A;  2OZG A;  2KCW A;  3I9S A;  1Q82 1;  3IIB A;  2JMO A;  1ZLI A;  4KOS A;  4JJX A;  1VQ8 Z;  4QVT A;  4HNY B;  3I07 A;  4CGP A;  1XFO A;  1VQL 1;  3K2K A;  3S9M A;  5C82 A;  3RAM A;  2ZEN A;  4BXX I;  4QC6 A;  4H89 A;  2HQY A;  2D4P A;  2PJ9 A;  3FF3 A;  4MJ8 A;  3H8E A;  3SXO A;  4FBE A;  5G20 A;  4JWP A;  1YW4 A;  4NB9 A;  2KPI A;  2NAP A;  3FRM A;  3G4S 1;  2AE6 A;  4OP4 A;  2M6N A;  4HH4 A;  3FIX A;  2G0B A;  4KZT A;  3KHX A;  1CP6 A;  2JA7 I;  5AG5 A;  4KUB A;  2V8G A;  5KTC A;  1VQ7 Z;  4MHD A;  2BUE A;  1N8R 2;  2PJ5 A;  2NMT A;  2RPR A;  4DUK A;  1S3Z A;  2GFQ A;  5K8M A;  4OC4 A;  4EWC A;  1UWY A;  4NBH A;  5LYI A;  3TT2 A;  2QKD A;  2QVP A;  4FD7 A;  1QXF A;  3HOZ I;  3IWG A;  3ZJ0 A;  3MZK B;  4X8I A;  3D67 A;  4AXV A;  4P4D A;  1R57 A;  4U5Y A;  4A32 A;  3R95 A;  1ZLH A;  3S2H I;  1VQL Z;  4JXR A;  1Q2C A;  1Q86 2;  5HMN A;  1Z02 A;  3IF8 A;  3D66 A;  1Z03 A;  1FNO A;  2GU2 A;  3B3V A;  3V38 A;  3GYA A;  1YVK A;  4CAF A;  4UWI A;  1VHS A;  3PB4 X;  4CRZ B;  3FMC A;  3PB7 X;  1Z4R A;  3CC2 1;  2Q51 A;  2Z3M A;  4PXC A;  2KI7 B;  4JYW A;  2FVG A;  2ZEP A;  4MHN A;  2AFZ A;  3IWW A;  4PXE A;  1IOI A;  4E8O A;  5H86 A;  2EO8 A;  2G3A A;  1KD1 1;  5DS0 A;  4OC3 A;  4ZY2 A;  3MON A;  1RNI A;  4MD8 A;  3CXC Z;  1WCM I;  1FT7 A;  1MJ9 A;  3D2P A;  4B14 A;  3EER A;  2AFO A;  3H4Q A;  5I4M A;  4P45 A;  2CTC A;  3I1U A;  1N2F A;  1BOB A;  3CCE 1;  3MRU A;  1QQ9 A;  4M3S A;  2GIV A;  2Z3P A;  1ZB9 A;  2E2J I;  1ELM P;  2PVV A;  2PJ8 A;  3CCL 1;  1F2O A;  3JVN A;  1QSO A;  5KTD A;  1WW9 A;  2YU9 I;  2O4H A;  1Y9W A;  4B5O A;  2CNT A;  4JZ0 A;  4MFK A;  1ARM A;  2VI7 A;  4C7I A;  3OW2 Y;  2AFW A;  3CC2 Z;  1NJI 2;  5BWA B;  3B7I A;  4CAX A;  1YSJ A;  4A3F I;  2WB1 A;  1M4I A;  3D7G A;  3N7Z A;  2WAQ A;  4A93 I;  1TFI A;  4KOY A;  4UFW A;  1BAV A;  1SFO I;  3TOA A;  2ZED A;  3L2N A;  5C4J I;  1ZH1 A;  4FD6 A;  5LYD A;  2B5G B;  2Q0Y A;  1F57 A;  1HEE A;  4KS9 A;  4PV6 A;  4DJL A;  1Z8W A;  3DSB A;  3JTK A;  1RLY A;  3NFZ A;  3G71 Z;  3CMA Z;  2IJZ A;  2JS4 A;  3IFU A;  4E30 A;  1YHQ 1;  3S6G A;  4KOW A;  1I3Q I;  4OLL A;  2P0W A;  4UBR A;  3K9T A;  2PDO A;  2EBJ A;  5A2Q f;  1S7F A;  1YGH A;  4DK1 A;  1MJA A;  3BG0 B;  2Z10 A;  2Y0M A;  3PB8 X;  3CCL Z;  4YWY A;  3FED A;  1YK3 A;  3P2H A;  2R92 I;  3OW2 Z;  3OWC A;  3NH8 A;  1S7L A;  2AFX A;  3TFY A;  4ONU A;  2B5G A;  1QVF Z;  5CBM A;  4TNU A;  4A3K I;  3S6F A;  1VQP Z;  5FLM I;  3VMI A;  2WSA A;  1Z5R A;  1VQ6 Z;  1TKH A;  1PU9 A;  2G3T A;  4B13 A;  1X3W A;  5T64 A;  2LFU A;  4R76 A;  1Z8L A;  3NE8 A;  1Y7E A;  2R8V A;  2OZH A;  3SXN A;  4CGO A;  5CM2 M;  3NA6 A;  4MON A;  1B6B A;  4KOX A;  4NFR A;  3IGR A;  3PP9 A;  2VPW A;  3J80 b;  3CCQ Z;  3GIU A;  2DE5 A;  2JIM A;  2FXF A;  3R9F A;  1PCA A;  4B5P A;  1U6M A;  1ZG9 A;  1IIC A;  3KIH A;  2H85 A;  5F46 A;  4UEZ A;  3B3T A;  3KZW A;  1CPX A;  5J8F A;  3K9U A;  2VPY A;  4CGL A;  2XEF A;  2YND A;  2ZOF A;  3F0A A;  4BIN A;  3VB9 A;  3WT4 A;  2NVY I;  3S16 I;  3BJ7 A;  4YU9 A;  3U50 C;  4YRH A;  2OOT A;  5D1O B;  4MCS A;  2V8J A;  1IOF A;  2R93 I;  1K8A 2;  3G3S A;  3VH9 A;  3BHX A;  1YJN Z;  4M85 A;  4EFD A;  1JJ2 Y;  2B58 A;  4AVC A;  1YJW 1;  2QRE B;  3E0K A;  4H6Z A;  4R87 A;  2XEG A;  1GYT A;  5K8O A;  3CD6 1;  2EUI A;  5IT9 f;  2BL1 A;  2AFS A;  2CIJ A;  4E31 A;  4W9Y A;  2EGT A;  4A39 A;  2C6G A;  1VQ5 Z;  3RO0 A;  3CCE Z;  1Y0Y A;  2JA6 I;  3V7Z A;  3S15 I;  1ON0 A;  4HNW B;  4CYO A;  1XRY A;  5A28 A;  3HUV A;  1XJO A;  4A33 A;  2OB0 A;  4H2K A;  2F4O A;  3KIF A;  3D6W A;  3HOV I;  1FDO A;  3EXN A;  1YI2 1;  5C44 I;  2FS5 A;  1ARL A;  3ZZI A;  5HVG A;  1VQ9 Z;  2FSR A;  1YME A;  3S1R I;  3DNS A;  4Y49 B;  3KHZ A;  2PJ7 A;  1IGB A;  3CME Z;  2M48 A;  3CC4 1;  2C6P A;  5I0C A;  4OKO A;  1YJ9 1;  4X6A I;  5HVH A;  2CNS A;  1TWA I;  3TE5 B;  2JIP A;  3CQZ I;  3B35 A;  2R1I A;  1KRL A;  1K73 2;  1SQH A;  2B4D A;  3PRT A;  4UF4 A;  4E2Y A;  4A30 A;  4S1T A;  3VMG A;  4IAV A;  4MD9 A;  3VAR A;  1YW6 A;  3CCM 1;  2Q44 A;  1LAN A;  4C2Y A;  4E33 A;  4B6Z A;  4NXY A;  3HOY I;  1K83 I;  4GXH A;  4WJB A;  3S1N I;  2WUU A;  4X3R A;  1Y1V I;  4M6H A;  2FT0 A;  3IX0 A;  4UEF A;  2DPS A;  2PSW A;  1J4J A;  1CM0 A;  3GKR A;  3S14 I;  4UFX A;  2NVX I;  2YNE A;  3G71 1;  3CMA 1;  1I50 I;  1LRZ A;  2PRB A;  1S7K A;  1WK4 A;  1VGY A;  1NMT A;  4CRY B;  1XIX A;  4ZGY B;  2VEZ A;  3HLP A;  4E2W A;  3GTQ I;  2ZEO A;  4L8A A;  4RVH A;  2YAD A;  2JIQ A;  2OTJ 1;  1USP A;  3S6H A;  3W6X A;  4MI4 A;  3KQZ A;  3PEI A;  2A4N A;  1S72 Z;  1QF8 A;  1VQ8 1;  3D3S A;  1TF9 A;  2ZAE B;  3FJU A;  4MY3 A;  4CGN A;  4E2A A;  2Z11 A;  2W04 A;  4CL1 A;  4PXD A;  4F0X A;  2PJB A;  4O23 A;  4ZI6 A;  2VPZ A;  4PXB A;  2QEC A;  3N5F A;  4L89 A;  3TE4 A;  5G1Z A;  1XE4 A;  1DL6 A;  3FNC A;  1YR0 A;  4Y52 I;  3QAH A;  2PR1 A;  1JWQ A;  5JM6 A;  4DGL A;  1KC8 2;  4NH1 C;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 1QYP A;  2VUM I;  3GTM I;  3CCL 1;  1QVG Z;  4A3L I;  1VLA A;  2JNY A;  2EK8 A;  1F2O A;  2ZEG A;  4ZY0 A;  1HDQ A;  4Q7A A;  3I4N I;  4TWE A;  3LMS A;  3CC7 Z;  3WT4 A;  1WW9 A;  2YU9 I;  2O4H A;  4RVD A;  3J7A 4;  1TKJ A;  3PB6 X;  2J9A A;  3GKQ A;  3J81 b;  4DYO A;  3PFO A;  3FQM A;  1Z2L A;  4JZ0 A;  5LYL A;  1ARM A;  5T67 A;  4MMO A;  2EWB A;  1M4L A;  4P4B A;  3OW2 Y;  2AFW A;  2Q4Z A;  3JAM b;  1W2B Y;  3CC2 Z;  1NJI 2;  5LRJ A;  1ZB8 A;  3S1M I;  4E2X A;  3B7I A;  1YSJ A;  2PJA A;  4A3F I;  4OID A;  2G9D A;  2WB1 A;  3D7G A;  2WAQ A;  3HOW I;  4A93 I;  4UIB A;  4XX2 A;  1TFI A;  2RBL A;  1R43 A;  2HU9 A;  2V8H A;  1BAV A;  1X3Z A;  2DE7 A;  1SFO I;  4P4I A;  1XBU A;  2RB7 A;  3CPW Z;  1YHQ Z;  5LL6 f;  1DTD A;  2ZED A;  3KAS A;  3L2N A;  5C4J I;  4EWT A;  1ZH1 A;  5LYD A;  3GTM S;  2C6C A;  3J80 f;  3I56 1;  3TX8 A;  3QWU A;  6CPA A;  1F57 A;  1HEE A;  3CCR 1;  3IO1 A;  4QTU A;  4E32 A;  1TWG I;  3WAB A;  4DJL A;  5K8P A;  2HF1 A;  1LOK A;  1VIX A;  4NB8 A;  2OTL 1;  4KSI A;  5ELY A;  3FH4 A;  5HVF A;  1CX8 A;  2WYR A;  1RLY A;  1YI2 Z;  2NVT I;  3NFZ A;  3FQQ A;  4Y7N I;  2PK7 A;  3G71 Z;  3CMA Z;  2IZ4 A;  3GLJ A;  2IJZ A;  2JS4 A;  4A3G I;  3IFU A;  3F3P C;  3FKI I;  2QR1 B;  4E30 A;  1YHQ 1;  1N8R 1;  4IHM A;  1I3Q I;  3NDJ A;  1Q82 2;  2QA4 1;  4RVF A;  1VHE A;  1VQN 1;  4PQA A;  3M3Y I;  3PB9 X;  1VQP 1;  4ZY1 A;  1M90 1;  2QRC B;  3JRU A;  3K9T A;  2G2K A;  3Q87 A;  3CCJ 1;  2CTB A;  5A2Q f;  1KC8 1;  1VQ4 1;  4DK1 A;  4P4J A;  3GTK I;  1K73 1;  1YIT Z;  2QEX 1;  3BG0 B;  2OTL Z;  2IQ6 A;  3B3S A;  5D29 A;  3RBU A;  2P3Y A;  1BPM A;  1NP6 A;  3KR5 A;  4K3N A;  2E2I I;  2OOY B;  4FAI A;  2PJ1 A;  5F09 A;  3PB8 X;  3RZA A;  1R3N A;  3CCL Z;  4YWY A;  1RO2 A;  3FED A;  4F9U A;  3GTP I;  3D7H A;  2R92 I;  3OW2 Z;  3NH8 A;  1S72 1;  1VQ5 1;  3PBE A;  2PM9 A;  8CPA A;  2QJ8 A;  3VMH A;  2R7Z I;  2AFX A;  4LQG A;  4R7M A;  3EED A;  1M1K 2;  5LYF A;  4OC5 A;  1BLL E;  1QVF Z;  3PO3 S;  2HB6 A;  2OR4 A;  3B2Y A;  1W2B Z;  1LFW A;  3CPW Y;  2Y0S A;  3H3V J;  1F2P A;  2CF4 A;  5CBM A;  4TNU A;  3G4S Z;  4A3K I;  3HOU I;  3I55 Z;  3BI1 A;  2PJ6 A;  2BOA A;  2QEX Z;  3PFE A;  3S9L A;  1JJ2 Z;  3BI0 A;  4BY1 I;  1VQP Z;  1VQM Z;  5THW A;  5FLM I;  3VMI A;  2PJ2 A;  3BG1 B;  3CCJ Z;  1Z5R A;  4NGP A;  1VQ6 Z;  4P44 A;  2QYV A;  3CT9 A;  3FX6 A;  3J81 f;  3GTG I;  2JR6 A;  3HKZ A;  1KD1 2;  4ONW A;  1TKH A;  2W03 A;  3DGV A;  4AYB A;  4P4E A;  2I3C A;  4BBS I;  1ELL P;  4A37 A;  3JAM f;  2V8D A;  2K5R A;  2IZ3 A;  1R9T I;  4MRI A;  2VL1 A;  1X3W A;  4NBD A;  1JWH C;  5T64 A;  3CCU Z;  3IEH A;  2ZEL A;  2QRD B;  2LFU A;  4R76 A;  3I55 1;  3KR4 A;  1TWF I;  4CPA A;  1ML8 A;  1JQG A;  2V77 A;  3SI0 A;  1CG2 A;  4MHP A;  2P28 A;  1Z8L A;  2QLV B;  1Y7E A;  4EME A;  3QNV A;  1QVG Y;  5CM2 M;  2AFU A;  1LQL A;  1VQ9 1;  1RTQ A;  4BY7 I;  3NA6 A;  2BO9 A;  4MON A;  5D1P A;  1RO4 A;  1L1O C;  2PJC A;  1TWH I;  1K9M 1;  4NFR A;  5D1O A;  3CXC Y;  3LWU A;  4RV9 A;  3CME 1;  3FEE A;  3MZL B;  3J80 b;  3CCS Z;  3IFE A;  4MCP A;  1S7M A;  3CCQ Z;  3IC1 A;  4OC0 A;  2JA5 I;  3FVL A;  1VQO 1;  2DE5 A;  4NGN A;  3RZD I;  1Y1W I;  1AMP A;  1H8L A;  1PCA A;  1DE4 C;  3CPX A;  1QMU A;  4A3I I;  1ZG9 A;  2OZK A;  3SJG A;  2BCO A;  4MCR A;  3KIH A;  2H85 A;  3GTJ I;  4UEZ A;  5IT9 b;  3GTO I;  1Q86 1;  3B3T A;  3KZW A;  5IP7 I;  1CPX A;  3S17 I;  1RO0 A;  4RS4 A;  4NJQ A;  3CCV Z;  2GLF A;  4NBE A;  2AFM A;  3CPA A;  2F7V A;  1YIJ 1;  5CPA A;  3WC5 A;  2RT9 A;  3H0G I;  4R8F A;  3WC7 A;  2XEF A;  3CCR Z;  3S2D I;  1KQS Z;  3ISZ A;  1NJI 1;  2ZOF A;  5A2Q b;  4QTT A;  2VF1 A;  2PVV A;  3D7D A;  3VB9 A;  1VHO A;  1CPS A;  4E2Z A;  1VQM 1;  3GB0 A;  2NVY I;  2R6M A;  1CBX A;  2ZEF A;  4NGR A;  1Y1V S;  3S16 I;  5D8N A;  3TC8 A;  5JGF A;  4YU9 A;  3U50 C;  4X2T A;  4MD7 A;  4IK2 A;  2OOT A;  2V8I A;  3P5J B;  5D1O B;  4OC1 A;  2PCU A;  4MCS A;  2V8J A;  4A3C I;  4A94 A;  4A3D I;  2R93 I;  4WWV A;  2VUG A;  1K8A 2;  3VH9 A;  4NBC A;  3GCF A;  3BHX A;  3CCV 1;  2GTI A;  1YJN Z;  4EFD A;  1JJ2 Y;  2NSM A;  2E2H I;  3B3W A;  1YJW 1;  1EE3 P;  2QRE B;  1KQS Y;  1M90 2;  3D68 A;  1LAM A;  2XEG A;  4P10 A;  1GYT A;  5K8O A;  3CD6 1;  2NYQ A;  5IT9 f;  3F3F C;  2AFS A;  4NJR A;  2CIJ A;  4E31 A;  2XEJ A;  4W9Y A;  2PIZ A;  5T6B A;  1OBR A;  5C3E I;  2AKL A;  2EGT A;  1YJW Z;  1VQ4 Z;  3KL9 A;  4FUU A;  2JBJ A;  4A39 A;  5IP9 I;  2JA8 I;  2ABZ A;  2C6G A;  1VQ5 Z;  3FEC A;  2DE6 A;  3SJX A;  2V8V A;  3CCE Z;  1Y0Y A;  7CPA A;  5J1Q A;  5AN9 F;  2E9H A;  2JA6 I;  4A3J I;  3I4M I;  1Z01 A;  1P9N A;  4NBF A;  4F8Z A;  2WZN A;  2RFH A;  1AYE A;  3V7Z A;  3S15 I;  2C1C A;  4UIA A;  4FWU A;  1XRY A;  1YJN 1;  1Q82 1;  3CC4 Z;  3HUV A;  3VTN A;  3IIB A;  3SJE A;  2JBK A;  1XJO A;  2JMO A;  5IB9 A;  2PJ4 A;  1ZLI A;  3PO2 I;  2PVW A;  3KQX A;  4H2K A;  2F4O A;  3KIF A;  1VQ8 Z;  3D6W A;  3IJ3 A;  3I07 A;  3HOV I;  1RQF A;  4UEE A;  2ZEH A;  1XFO A;  2GTH A;  1VQL 1;  1YUK A;  1YI2 1;  5C44 I;  3D9X A;  3K2K A;  5K8N A;  2OOX B;  3S9M A;  1ARL A;  4A3E I;  2GLJ A;  1BPN A;  1YLO A;  5HVG A;  2J6A A;  1VQ9 Z;  1YME A;  3RAM A;  2RIQ A;  3S1R I;  4BXX I;  1CP7 A;  2ZEN A;  5JH9 A;  1TF8 A;  3I56 Z;  3KHZ A;  1YJ9 Z;  2PJ7 A;  1IGB A;  3CME Z;  2PJ9 A;  3SI1 A;  2PIY A;  1TKF A;  3FF3 A;  4MHZ A;  2M48 A;  3H8E A;  3ESW A;  4P6Y A;  4BD9 A;  4FBE A;  3CC7 1;  3CD6 Z;  3CC4 1;  2C6P A;  1TXR A;  2ZOG A;  1I6H I;  1Q81 1;  4OKO A;  1YW4 A;  2PRQ A;  1YJ9 1;  3SI2 A;  2Q43 A;  4NB9 A;  3NDI A;  4X6A I;  5HVH A;  2KPI A;  1TWA I;  3CCS 1;  3TE5 B;  1Q7Y 2;  1K9M 2;  3G4S 1;  3CQZ I;  4GM5 A;  3CCM Z;  4OP4 A;  4OME A;  3B35 A;  1Q81 2;  2M6N A;  1VQN Z;  2NVQ I;  1KRL A;  4HH4 A;  1K73 2;  2HC9 A;  3PRT A;  4BBR I;  2POK A;  4UF4 A;  4OIW A;  5HXD A;  4E2Y A;  2ZEM A;  3KHX A;  1CP6 A;  3NH5 A;  2JA7 I;  2V8G A;  4ZX8 A;  2F8H A;  2LIY A;  1VQ7 Z;  4MCQ A;  3ISX A;  3DLJ A;  1N8R 2;  2PJ5 A;  3PO3 I;  3KGQ A;  3LUS A;  4MXU A;  2RPR A;  4S1T A;  3D4U A;  4OC2 A;  3SJF A;  3VMG A;  4DUK A;  3G6E 1;  4PPZ A;  4IAV A;  2RHB A;  4R6T A;  2EK9 A;  4MHY A;  4MD9 A;  3VAR A;  5K8M A;  4OC4 A;  1YW6 A;  3WC6 A;  3CCM 1;  3TDH B;  4EWC A;  4A3B I;  1WII A;  1ZG7 A;  1VQ7 1;  1LAN A;  4NBH A;  1UWY A;  1ZG8 A;  2ANP A;  2DEA A;  2QKD A;  4G1P A;  4NGM A;  5LYI A;  3S9N A;  4E33 A;  4B6Z A;  2QVP A;  3HOY I;  1K83 I;  4WJB A;  3HOZ I;  3S1N I;  4NGQ A;  3MZK B;  1Q7L A;  4X8I A;  3D67 A;  4AXV A;  2ZEE A;  4P4D A;  5C4X I;  1VQK 1;  4Z65 A;  2BJO A;  2F4M A;  4X3R A;  5LRK A;  1ZLH A;  3S2H I;  4F9V A;  1Y1V I;  2PMZ A;  4NBG A;  1VQL Z;  4A3M I;  4P4F A;  4RVG A;  1Q7Y 1;  1Q86 2;  2JEW A;  1Z02 A;  3IX0 A;  4UEF A;  3IF8 A;  3D66 A;  1Z03 A;  3GTL I;  1FNO A;  2GU2 A;  3B3V A;  3V38 A;  4HGY A;  3T8W A;  2V8K A;  3S14 I;  2OTJ Z;  3T4N B;  2NVX I;  2O53 A;  3G71 1;  3CMA 1;  3VAT A;  1I50 I;  4NBB A;  3PB4 X;  1LCP A;  3FMC A;  3PB7 X;  3GUX A;  4NGT A;  3M4O I;  2JUB A;  5FLX b;  4DQY B;  1VQK Z;  3PBB A;  1VGY A;  3CC2 1;  2Q51 A;  2B63 I;  4ZYQ A;  3NH4 A;  4PXC A;  2KI7 B;  1YIJ Z;  4JYW A;  2FVG A;  2ZEP A;  3HLP A;  2GRE A;  4E2W A;  3GTQ I;  1PYT B;  2ZEO A;  3CCU 1;  4MHN A;  4ZX9 A;  2PE3 A;  3K7A I;  2AFZ A;  3IWW A;  3H8F A;  4RVH A;  2YAD A;  4PXE A;  4HGZ A;  2OTJ 1;  1IY7 A;  3RZO I;  1USP A;  1K8A 1;  1KD1 1;  1TWC I;  3MN8 A;  3H8G A;  1PFT A;  1HDU A;  1YUA A;  3KQZ A;  3PEI A;  4OC3 A;  1S72 Z;  5DS0 A;  4ZY2 A;  4NGS A;  1YIT 1;  3MON A;  3CCQ 1;  1RNI A;  1QF8 A;  2PJ0 A;  4MD8 A;  3CXC Z;  1VQ8 1;  4MH4 A;  2PJ3 A;  1WCM I;  1TF9 A;  2ZAE B;  3FJU A;  2IMO A;  1QVF Y;  3D7F A;  1FT7 A;  2W04 A;  2K3R A;  4CL1 A;  1XMB A;  3G6E Z;  1M1K 1;  4PXD A;  4NOZ A;  3HOX I;  1NUI A;  1LAP A;  1NSA A;  2PJB A;  3BXM A;  5LRG A;  4O23 A;  4ZI6 A;  3EER A;  1VQO Z;  4PXB A;  2AFO A;  1KWM A;  1USP B;  4NBA A;  3N5F A;  5I4M A;  4P45 A;  2CTC A;  5FLX f;  3CDX A;  3I1U A;  1N2F A;  4A38 A;  1DL6 A;  1X0T A;  1Y0R A;  2QA4 Z;  3KI9 A;  4Y52 I;  5JM6 A;  3CCE 1;  4DGL A;  4RUH A;  1KC8 2;  3B3C A;  3MRU A;  3S1Q I;  4NH1 C;  1QQ9 A;  2XEI A;  1ZB9 A;  2E2J I;  1ELM P;  1VQ6 1;  2PJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...