3RZOI

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI02
3HOUI 3LUSA 3S1QI 3GTJI 2F4OA 4BXXI 5C4JI 2PK7A 1N2FA 2DE5A 2NVTI 3PO3S 4A3II 3S1RI 1RO4A 3GTMS 3VMGA 3I4MI 3S14I 1Y1WI 3S17I 1I50I 1PFTA 2JR6A 3GTQI 4QTUA 1ML8A 2E2JI 3VB9A 2JA5I 2DE6A 1TWGI 3I4NI 1TWAI 4A93I 1R9TI 4Y52I 4Y7NI 1Y1VI 3HOWI 5C3EI 5C4XI 4NBCA 1ZB8A 4A3EI 4NBFA 4NOZA 3U50C 4NBDA 4X6AI 2R93I 3CQZI 1K83I 3GCFA 3VMHA 3M3YI 3PO3I 3ESWA 4QTTA 1TWFI 2AKLA 1I3QI 2K5RA 3HOZI 2VUMI 4BBRI 4BBSI 2JS4A 1TWHI 1NUIA 3I07A 5IP9I 1USPA 1QYPA 2P3YA 1WW9A 1Y1VS 4NB8A 3PO2I 2JA8I 1TFIA 5FLMI 2DE7A 2R92I 3H0GI 2B63I 2E2II 3HOVI 1SFOI 4BY7I 1L1OC 3S2DI 1DL6A 2R7ZI 3VMIA 4A3BI 2NVXI 3D6WA 1ZB9A 4MH4A 2HF1A 4A3MI 2JA6I 3GTLI 4A3DI 1LQLA 4NBHA 1USPB 4A3LI 3RZOI 3M4OI 3FKII 2RBLA 3S1NI 3GTKI 2YU9I 3H3VJ 1WCMI 1TWCI 2NVYI 4A3FI 3HOYI 4A3CI 4A3KI 3Q87A 2JNYA 3EERA 4A3JI 2E2HI 1I6HI 4A3GI 3HOXI 1RLYA 3S1MI 1X3ZA 1X3WA 3GTOI 2JA7I 4NBBA 3GTPI 4NB9A 4NBAA 4NBGA 2BJOA 5C44I 4XX2A 3GKQA 3K7AI 5IP7I 3GTMI 3S15I 3GTGI 4NBEA 2NVQI 1YUAA 1VLAA 5CM2M 2F4MA 2KPIA 3RZDI 4BY1I 3S16I 3S2HI 2J6AA
chains in the Genus database with same CATH superfamily
3S1QI 3GTJI 3J80b 1M1K1 3CCE1 3S1RI 1RO4A 3JAMf 2WAQA 1VQP1 3F3FC 1I50I 1PFTA 2JR6A 4MONA 2V45A 1ML8A 1VQ71 2QRCB 3VB9A 3NH8A 4HGZA 3IX0A 5D1PA 1R9TI 3P5JB 4Y7NI 1Y1VI 1VQ51 2GU2A 5A2Qb 4NBFA 3J81f 3F3PC 1KC81 1K83I 3GCFA 3M3YI 1M902 1K8A2 3PO3I 4QTTA 2V3VA 1Z02A 1NJI1 3CXCY 1S72Z 1WIIA 1Y1VS 1WJ2A 1NJI2 2M48A 4E31A 5FLMI 2M6NA 3D9XA 4TNUA 4BY7I 3G711 5T67A 1KD11 1FDIA 3S2DI 1AA6A 3CCLZ 1VQKZ 2AYDA 2NVXI 1ZB9A 1Z01A 4A3MI 4A3DI 1VQPZ 1LQLA 2I3CA 2H85A 2RBLA 3H3VJ 1WCMI 3G4S1 3T4NB 1RO2A 1YJ91 3MZLB 3QWUA 2OZKA 4A3CI 3CD6Z 2Q51A 3NDIA 3CC21 3NFZA 2PM9A 4MRIA 1K8A1 1M901 3HOXI 3CPWY 1QVGZ 3CCS1 2QA4Z 3MONA 2EGTA 3VTNA 4NBGA 1YJN1 2YADA 4NH1C 5C44I 4XX2A 3CCSZ 3K7AI 5IP7I 1S721 1K9M1 3GTMI 2QRDB 2NVQI 2F4MA 2IZ4A 2KPIA 5D1OB 3G71Z 3NH4A 2IZ3A 4BXXI 2PK7A 1N2FA 2DE5A 3PO3S 1W2BY 2VPZA 3VMGA 1VQ81 2QREB 1VQM1 4DGLA 1N8R1 1KQSY 3CC71 3S14I 1VQ7Z 3GTQI 1YITZ 3JAMb 2E2JI 1JWHC 3FQMA 2JA5I 2DE6A 2JIMA 3I4NI 4A93I 1YUKA 1YIT1 1Q7Y1 2JIQA 3BG0B 3HOWI 4NOZA 4E2YA 3D2LA 4NBDA 3CD61 2LIYA 1JJ2Y 3CCUZ 2QKDA 3VMHA 2QA41 1KQSZ 2JMOA 3CCVZ 3CC41 3HOZI 4BBRI 4DK1A 2QEX1 1Z03A 4BBSI 2G2KA 1Q812 2Y0SA 5IP9I 1USPA 3PO2I 1TFIA 2QEXZ 3BG1B 2RT9A 4RVGA 1QVFY 3HKZA 3KIHA 4NFRA 1S7MA 5FLXf 1L1OC 2PMZA 3NH5A 4E30A 2W04A 4RV9A 3VMIA 3IFUA 3J80f 2HF1A 1K731 3IF8A 4MD9A 3RZOI 1YIJZ 4RVFA 3CME1 1Q7Y2 1VQ5Z 1YI21 5T64A 3HOYI 5IT9f 1KD12 1RO0A 3CXCZ 4A3JI 2E2HI 3CCV1 3CCQ1 3S1MI 2JUBA 2Q4ZA 3OW2Y 3NDJA 4NB9A 2BJOA 4E2XA 1Q16A 3GTGI 1YUAA 1YHQ1 3S16I 2JIPA 2J6AA 3HOUI 3LUSA 3CMA1 3OW2Z 2ZAEB 2NVTI 4A3II 1VQ91 3GTMS 5LL6f 1Y1WI 1VQ41 2NAPA 1WZNA 2VPWA 4CL1A 1K9M2 1VQ4Z 3IR7A 4NBCA 1ZB8A 3U50C 1QVGY 4X6AI 1RNIA 4MD8A 1TWFI 1I3QI 2VUMI 1KRLA 4HH4A 2JS4A 3CCJ1 1NUIA 1NP6A 3I07A 5FLXb 1WW9A 3I56Z 4RVHA 2OTJ1 3CCRZ 2R92I 3H0GI 1VQ6Z 1Q811 5D1OA 1Q822 1DL6A 2R7ZI 1W2BZ 1YHQZ 2JA6I 1VQMZ 4HGYA 4NBHA 3I55Z 4S1TA 4E2ZA 3FKII 3S1NI 3GTKI 3CCEZ 2V8KA 4A3FI 2GTIA 1Q862 1JJ2Z 3MZKB 1QXFA 3CCMZ 3CCQZ 2QLVB 2JNYA 3TDHB 3J7A4 2LFUA 1M1K2 2QR1B 5AN9F 4E32A 4RS4A 2OOYB 4AYBA 2GTHA 2JIOA 2WB1A 4MXUA 2OTJZ 2W03A 4E2WA 1VQO1 3GKQA 3CCJZ 2P28A 2LEXA 2OTLZ 2VPXA 3S15I 1Y8CA 2O53A 1VLAA 2O4HA 3RZDI 4BY1I 1VQ8Z 2F4OA 2HU9A 5C4JI 1P9NA 5T6BA 1YJWZ 3I4MI 3S17I 3CMEZ 1SIWA 1X0TA 4QTUA 3I551 3EEDA 4MD7A 3G6EZ 1TWGI 4E33A 3CC7Z 1TWAI 4Y52I 3FQQA 1QVFZ 5C3EI 5C4XI 2IV2X 1YI2Z 4A3EI 3CCU1 1Q861 2RPRA 2R93I 3CQZI 3CCM1 4EWCA 3ESWA 2AKLA 2R6MA 2K5RA 3CC2Z 1TWHI 2OOXB 3I561 1QYPA 2P3YA 4NB8A 2JA8I 2OTL1 1VQOZ 2DE7A 2E9HA 1Q821 2B63I 2E2II 3HOVI 1SFOI 3CMAZ 1VQL1 5IT9b 2K3RA 1K732 1VQN1 4A3BI 3KIFA 3D6WA 1VQNZ 4MH4A 1KC82 3GTLI 1QF8A 2RHBA 5A2Qf 3G6E1 1USPB 1ZH1A 4RVDA 1N8R2 4A3LI 1YJ9Z 3M4OI 1YJW1 2VF1A 2YU9I 2VUGA 3G4SZ 1YIJ1 1RQFA 1VQ9Z 4DQYB 1TWCI 2KI7B 2NVYI 1FDOA 2JIRA 4A3KI 3Q87A 2VPYA 3EERA 3CPWZ 3TE5B 1I6HI 4A3GI 1YJNZ 1RLYA 3CC4Z 1X3ZA 1X3WA 3GTOI 2JA7I 2V8JA 2E7ZA 4NBBA 3GTPI 4NBAA 1VQ61 3CCR1 2RIQA 3J81b 4NBEA 1VQLZ 5CM2M 3CCL1 3S2HI 1VQK1 2V8IA
chains in the Genus database with same CATH topology
3S1QI 3GTJI 3J80b 1M1K1 3CCE1 3S1RI 1RO4A 3JAMf 2WAQA 1VQP1 3F3FC 1I50I 1PFTA 2JR6A 4MONA 1ML8A 1VQ71 2QRCB 3VB9A 3NH8A 4HGZA 3IX0A 5D1PA 1R9TI 3P5JB 4Y7NI 1Y1VI 1VQ51 2GU2A 5A2Qb 4NBFA 3J81f 3F3PC 1KC81 1K83I 3GCFA 3M3YI 1M902 1K8A2 3PO3I 4QTTA 1Z02A 1NJI1 3CXCY 1S72Z 1WIIA 1Y1VS 1NJI2 2M48A 4E31A 5FLMI 2M6NA 3D9XA 4TNUA 4BY7I 3G711 5T67A 1KD11 3S2DI 3CCLZ 1VQKZ 2NVXI 1ZB9A 1Z01A 4A3MI 4A3DI 1VQPZ 1LQLA 2I3CA 2H85A 2RBLA 3H3VJ 1WCMI 3G4S1 3T4NB 1RO2A 1YJ91 3MZLB 3QWUA 2OZKA 4A3CI 3CD6Z 2Q51A 3NDIA 3CC21 3NFZA 2PM9A 4MRIA 1K8A1 1M901 3HOXI 3CPWY 1QVGZ 3CCS1 2QA4Z 3MONA 2EGTA 3VTNA 4NBGA 1YJN1 2YADA 4NH1C 5C44I 4XX2A 3CCSZ 3K7AI 5IP7I 1S721 1K9M1 3GTMI 2QRDB 2NVQI 2F4MA 2IZ4A 2KPIA 5D1OB 3G71Z 3NH4A 2IZ3A 4BXXI 2PK7A 1N2FA 2DE5A 3PO3S 1W2BY 3VMGA 1VQ81 2QREB 1VQM1 4DGLA 1N8R1 1KQSY 3CC71 3S14I 1VQ7Z 3GTQI 1YITZ 3JAMb 2E2JI 1JWHC 3FQMA 2JA5I 2DE6A 3I4NI 4A93I 1YUKA 1YIT1 1Q7Y1 3BG0B 3HOWI 4NOZA 4E2YA 3CD61 4NBDA 2LIYA 1JJ2Y 3CCUZ 2QKDA 3VMHA 2QA41 1KQSZ 2JMOA 3CCVZ 3CC41 3HOZI 4BBRI 4DK1A 2QEX1 1Z03A 4BBSI 2G2KA 1Q812 2Y0SA 5IP9I 1USPA 3PO2I 1TFIA 2QEXZ 3BG1B 2RT9A 4RVGA 1QVFY 3HKZA 3KIHA 4NFRA 1S7MA 5FLXf 1L1OC 2PMZA 3NH5A 4E30A 2W04A 4RV9A 3VMIA 3IFUA 3J80f 2HF1A 1K731 3IF8A 4MD9A 3RZOI 1YIJZ 4RVFA 3CME1 1Q7Y2 1VQ5Z 1YI21 5T64A 3HOYI 5IT9f 1KD12 1RO0A 3CXCZ 4A3JI 2E2HI 3CCV1 3CCQ1 3S1MI 2JUBA 2Q4ZA 3OW2Y 3NDJA 4NB9A 2BJOA 4E2XA 3GTGI 1YUAA 1YHQ1 3S16I 2J6AA 3HOUI 3LUSA 3CMA1 3OW2Z 2ZAEB 2NVTI 4A3II 1VQ91 3GTMS 5LL6f 1Y1WI 1VQ41 4CL1A 1K9M2 1VQ4Z 4NBCA 1ZB8A 3U50C 1QVGY 4X6AI 1RNIA 4MD8A 1TWFI 1I3QI 2VUMI 1KRLA 4HH4A 2JS4A 3CCJ1 1NUIA 1NP6A 3I07A 5FLXb 1WW9A 3I56Z 4RVHA 2OTJ1 3CCRZ 2R92I 3H0GI 1VQ6Z 1Q811 5D1OA 1Q822 1DL6A 2R7ZI 1W2BZ 1YHQZ 2JA6I 1VQMZ 4HGYA 4NBHA 3I55Z 4S1TA 4E2ZA 3FKII 3S1NI 3GTKI 3CCEZ 2V8KA 4A3FI 2GTIA 1Q862 1JJ2Z 3MZKB 3CCMZ 3CCQZ 2QLVB 2JNYA 3TDHB 3J7A4 2LFUA 1M1K2 2QR1B 5AN9F 4E32A 4RS4A 2OOYB 4AYBA 2GTHA 2WB1A 4MXUA 2OTJZ 2W03A 4E2WA 1VQO1 3GKQA 3CCJZ 2P28A 2OTLZ 3S15I 2O53A 1VLAA 2O4HA 3RZDI 4BY1I 1VQ8Z 2F4OA 2HU9A 5C4JI 1P9NA 5T6BA 1YJWZ 3I4MI 3S17I 3CMEZ 1X0TA 4QTUA 3I551 3EEDA 4MD7A 3G6EZ 1TWGI 4E33A 3CC7Z 1TWAI 4Y52I 3FQQA 1QVFZ 5C3EI 5C4XI 1YI2Z 4A3EI 3CCU1 1Q861 2RPRA 2R93I 3CQZI 3CCM1 4EWCA 3ESWA 2AKLA 2R6MA 2K5RA 3CC2Z 1TWHI 2OOXB 3I561 1QYPA 2P3YA 4NB8A 2JA8I 2OTL1 1VQOZ 2DE7A 2E9HA 1Q821 2B63I 2E2II 3HOVI 1SFOI 3CMAZ 1VQL1 5IT9b 2K3RA 1K732 1VQN1 4A3BI 3KIFA 3D6WA 1VQNZ 4MH4A 1KC82 3GTLI 1QF8A 2RHBA 5A2Qf 3G6E1 1USPB 1ZH1A 4RVDA 1N8R2 4A3LI 1YJ9Z 3M4OI 1YJW1 2VF1A 2YU9I 2VUGA 3G4SZ 1YIJ1 1RQFA 1VQ9Z 1TWCI 4DQYB 2KI7B 2NVYI 4A3KI 3Q87A 3EERA 3CPWZ 3TE5B 1I6HI 4A3GI 1YJNZ 1RLYA 3CC4Z 1X3ZA 1X3WA 3GTOI 2JA7I 2V8JA 4NBBA 3GTPI 4NBAA 1VQ61 3CCR1 2RIQA 3J81b 4NBEA 1VQLZ 5CM2M 3CCL1 3S2HI 1VQK1 2V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU I;  3LUS A;  3S1Q I;  3GTJ I;  2F4O A;  4BXX I;  5C4J I;  2PK7 A;  1N2F A;  2DE5 A;  2NVT I;  3PO3 S;  4A3I I;  3S1R I;  1RO4 A;  3GTM S;  3VMG A;  3I4M I;  3S14 I;  1Y1W I;  3S17 I;  1I50 I;  1PFT A;  2JR6 A;  3GTQ I;  4QTU A;  1ML8 A;  2E2J I;  3VB9 A;  2JA5 I;  2DE6 A;  1TWG I;  3I4N I;  1TWA I;  4A93 I;  1R9T I;  4Y52 I;  4Y7N I;  1Y1V I;  3HOW I;  5C3E I;  5C4X I;  4NBC A;  1ZB8 A;  4A3E I;  4NBF A;  4NOZ A;  3U50 C;  4NBD A;  4X6A I;  2R93 I;  3CQZ I;  1K83 I;  3GCF A;  3VMH A;  3M3Y I;  3PO3 I;  3ESW A;  4QTT A;  1TWF I;  2AKL A;  1I3Q I;  2K5R A;  3HOZ I;  2VUM I;  4BBR I;  4BBS I;  2JS4 A;  1TWH I;  1NUI A;  3I07 A;  5IP9 I;  1USP A;  1QYP A;  2P3Y A;  1WW9 A;  1Y1V S;  4NB8 A;  3PO2 I;  2JA8 I;  1TFI A;  5FLM I;  2DE7 A;  2R92 I;  3H0G I;  2B63 I;  2E2I I;  3HOV I;  1SFO I;  4BY7 I;  1L1O C;  3S2D I;  1DL6 A;  2R7Z I;  3VMI A;  4A3B I;  2NVX I;  3D6W A;  1ZB9 A;  4MH4 A;  2HF1 A;  4A3M I;  2JA6 I;  3GTL I;  4A3D I;  1LQL A;  4NBH A;  1USP B;  4A3L I;  3RZO I;  3M4O I;  3FKI I;  2RBL A;  3S1N I;  3GTK I;  2YU9 I;  3H3V J;  1WCM I;  1TWC I;  2NVY I;  4A3F I;  3HOY I;  4A3C I;  4A3K I;  3Q87 A;  2JNY A;  3EER A;  4A3J I;  2E2H I;  1I6H I;  4A3G I;  3HOX I;  1RLY A;  3S1M I;  1X3Z A;  1X3W A;  3GTO I;  2JA7 I;  4NBB A;  3GTP I;  4NB9 A;  4NBA A;  4NBG A;  2BJO A;  5C44 I;  4XX2 A;  3GKQ A;  3K7A I;  5IP7 I;  3GTM I;  3S15 I;  3GTG I;  4NBE A;  2NVQ I;  1YUA A;  1VLA A;  5CM2 M;  2F4M A;  2KPI A;  3RZD I;  4BY1 I;  3S16 I;  3S2H I;  2J6A A; 
#chains in the Genus database with same CATH topology
 3S1Q I;  3GTJ I;  3J80 b;  1M1K 1;  3CCE 1;  3S1R I;  1RO4 A;  3JAM f;  2WAQ A;  1VQP 1;  3F3F C;  1I50 I;  1PFT A;  2JR6 A;  4MON A;  2V45 A;  1ML8 A;  1VQ7 1;  2QRC B;  3VB9 A;  3NH8 A;  4HGZ A;  3IX0 A;  5D1P A;  1R9T I;  3P5J B;  4Y7N I;  1Y1V I;  1VQ5 1;  2GU2 A;  5A2Q b;  4NBF A;  3J81 f;  3F3P C;  1KC8 1;  1K83 I;  3GCF A;  3M3Y I;  1M90 2;  1K8A 2;  3PO3 I;  4QTT A;  2V3V A;  1Z02 A;  1NJI 1;  3CXC Y;  1S72 Z;  1WII A;  1Y1V S;  1WJ2 A;  1NJI 2;  2M48 A;  4E31 A;  5FLM I;  2M6N A;  3D9X A;  4TNU A;  4BY7 I;  3G71 1;  5T67 A;  1KD1 1;  1FDI A;  3S2D I;  1AA6 A;  3CCL Z;  1VQK Z;  2AYD A;  2NVX I;  1ZB9 A;  1Z01 A;  4A3M I;  4A3D I;  1VQP Z;  1LQL A;  2I3C A;  2H85 A;  2RBL A;  3H3V J;  1WCM I;  3G4S 1;  3T4N B;  1RO2 A;  1YJ9 1;  3MZL B;  3QWU A;  2OZK A;  4A3C I;  3CD6 Z;  2Q51 A;  3NDI A;  3CC2 1;  3NFZ A;  2PM9 A;  4MRI A;  1K8A 1;  1M90 1;  3HOX I;  3CPW Y;  1QVG Z;  3CCS 1;  2QA4 Z;  3MON A;  2EGT A;  3VTN A;  4NBG A;  1YJN 1;  2YAD A;  4NH1 C;  5C44 I;  4XX2 A;  3CCS Z;  3K7A I;  5IP7 I;  1S72 1;  1K9M 1;  3GTM I;  2QRD B;  2NVQ I;  2F4M A;  2IZ4 A;  2KPI A;  5D1O B;  3G71 Z;  3NH4 A;  2IZ3 A;  4BXX I;  2PK7 A;  1N2F A;  2DE5 A;  3PO3 S;  1W2B Y;  2VPZ A;  3VMG A;  1VQ8 1;  2QRE B;  1VQM 1;  4DGL A;  1N8R 1;  1KQS Y;  3CC7 1;  3S14 I;  1VQ7 Z;  3GTQ I;  1YIT Z;  3JAM b;  2E2J I;  1JWH C;  3FQM A;  2JA5 I;  2DE6 A;  2JIM A;  3I4N I;  4A93 I;  1YUK A;  1YIT 1;  1Q7Y 1;  2JIQ A;  3BG0 B;  3HOW I;  4NOZ A;  4E2Y A;  3D2L A;  4NBD A;  3CD6 1;  2LIY A;  1JJ2 Y;  3CCU Z;  2QKD A;  3VMH A;  2QA4 1;  1KQS Z;  2JMO A;  3CCV Z;  3CC4 1;  3HOZ I;  4BBR I;  4DK1 A;  2QEX 1;  1Z03 A;  4BBS I;  2G2K A;  1Q81 2;  2Y0S A;  5IP9 I;  1USP A;  3PO2 I;  1TFI A;  2QEX Z;  3BG1 B;  2RT9 A;  4RVG A;  1QVF Y;  3HKZ A;  3KIH A;  4NFR A;  1S7M A;  5FLX f;  1L1O C;  2PMZ A;  3NH5 A;  4E30 A;  2W04 A;  4RV9 A;  3VMI A;  3IFU A;  3J80 f;  2HF1 A;  1K73 1;  3IF8 A;  4MD9 A;  3RZO I;  1YIJ Z;  4RVF A;  3CME 1;  1Q7Y 2;  1VQ5 Z;  1YI2 1;  5T64 A;  3HOY I;  5IT9 f;  1KD1 2;  1RO0 A;  3CXC Z;  4A3J I;  2E2H I;  3CCV 1;  3CCQ 1;  3S1M I;  2JUB A;  2Q4Z A;  3OW2 Y;  3NDJ A;  4NB9 A;  2BJO A;  4E2X A;  1Q16 A;  3GTG I;  1YUA A;  1YHQ 1;  3S16 I;  2JIP A;  2J6A A;  3HOU I;  3LUS A;  3CMA 1;  3OW2 Z;  2ZAE B;  2NVT I;  4A3I I;  1VQ9 1;  3GTM S;  5LL6 f;  1Y1W I;  1VQ4 1;  2NAP A;  1WZN A;  2VPW A;  4CL1 A;  1K9M 2;  1VQ4 Z;  3IR7 A;  4NBC A;  1ZB8 A;  3U50 C;  1QVG Y;  4X6A I;  1RNI A;  4MD8 A;  1TWF I;  1I3Q I;  2VUM I;  1KRL A;  4HH4 A;  2JS4 A;  3CCJ 1;  1NUI A;  1NP6 A;  3I07 A;  5FLX b;  1WW9 A;  3I56 Z;  4RVH A;  2OTJ 1;  3CCR Z;  2R92 I;  3H0G I;  1VQ6 Z;  1Q81 1;  5D1O A;  1Q82 2;  1DL6 A;  2R7Z I;  1W2B Z;  1YHQ Z;  2JA6 I;  1VQM Z;  4HGY A;  4NBH A;  3I55 Z;  4S1T A;  4E2Z A;  3FKI I;  3S1N I;  3GTK I;  3CCE Z;  2V8K A;  4A3F I;  2GTI A;  1Q86 2;  1JJ2 Z;  3MZK B;  1QXF A;  3CCM Z;  3CCQ Z;  2QLV B;  2JNY A;  3TDH B;  3J7A 4;  2LFU A;  1M1K 2;  2QR1 B;  5AN9 F;  4E32 A;  4RS4 A;  2OOY B;  4AYB A;  2GTH A;  2JIO A;  2WB1 A;  4MXU A;  2OTJ Z;  2W03 A;  4E2W A;  1VQO 1;  3GKQ A;  3CCJ Z;  2P28 A;  2LEX A;  2OTL Z;  2VPX A;  3S15 I;  1Y8C A;  2O53 A;  1VLA A;  2O4H A;  3RZD I;  4BY1 I;  1VQ8 Z;  2F4O A;  2HU9 A;  5C4J I;  1P9N A;  5T6B A;  1YJW Z;  3I4M I;  3S17 I;  3CME Z;  1SIW A;  1X0T A;  4QTU A;  3I55 1;  3EED A;  4MD7 A;  3G6E Z;  1TWG I;  4E33 A;  3CC7 Z;  1TWA I;  4Y52 I;  3FQQ A;  1QVF Z;  5C3E I;  5C4X I;  2IV2 X;  1YI2 Z;  4A3E I;  3CCU 1;  1Q86 1;  2RPR A;  2R93 I;  3CQZ I;  3CCM 1;  4EWC A;  3ESW A;  2AKL A;  2R6M A;  2K5R A;  3CC2 Z;  1TWH I;  2OOX B;  3I56 1;  1QYP A;  2P3Y A;  4NB8 A;  2JA8 I;  2OTL 1;  1VQO Z;  2DE7 A;  2E9H A;  1Q82 1;  2B63 I;  2E2I I;  3HOV I;  1SFO I;  3CMA Z;  1VQL 1;  5IT9 b;  2K3R A;  1K73 2;  1VQN 1;  4A3B I;  3KIF A;  3D6W A;  1VQN Z;  4MH4 A;  1KC8 2;  3GTL I;  1QF8 A;  2RHB A;  5A2Q f;  3G6E 1;  1USP B;  1ZH1 A;  4RVD A;  1N8R 2;  4A3L I;  1YJ9 Z;  3M4O I;  1YJW 1;  2VF1 A;  2YU9 I;  2VUG A;  3G4S Z;  1YIJ 1;  1RQF A;  1VQ9 Z;  4DQY B;  1TWC I;  2KI7 B;  2NVY I;  1FDO A;  2JIR A;  4A3K I;  3Q87 A;  2VPY A;  3EER A;  3CPW Z;  3TE5 B;  1I6H I;  4A3G I;  1YJN Z;  1RLY A;  3CC4 Z;  1X3Z A;  1X3W A;  3GTO I;  2JA7 I;  2V8J A;  2E7Z A;  4NBB A;  3GTP I;  4NBA A;  1VQ6 1;  3CCR 1;  2RIQ A;  3J81 b;  4NBE A;  1VQL Z;  5CM2 M;  3CCL 1;  3S2H I;  1VQK 1;  2V8I A; 
#chains in the Genus database with same CATH homology
 3S1Q I;  3GTJ I;  3J80 b;  1M1K 1;  3CCE 1;  3S1R I;  1RO4 A;  3JAM f;  2WAQ A;  1VQP 1;  3F3F C;  1I50 I;  1PFT A;  2JR6 A;  4MON A;  1ML8 A;  1VQ7 1;  2QRC B;  3VB9 A;  3NH8 A;  4HGZ A;  3IX0 A;  5D1P A;  1R9T I;  3P5J B;  4Y7N I;  1Y1V I;  1VQ5 1;  2GU2 A;  5A2Q b;  4NBF A;  3J81 f;  3F3P C;  1KC8 1;  1K83 I;  3GCF A;  3M3Y I;  1M90 2;  1K8A 2;  3PO3 I;  4QTT A;  1Z02 A;  1NJI 1;  3CXC Y;  1S72 Z;  1WII A;  1Y1V S;  1NJI 2;  2M48 A;  4E31 A;  5FLM I;  2M6N A;  3D9X A;  4TNU A;  4BY7 I;  3G71 1;  5T67 A;  1KD1 1;  3S2D I;  3CCL Z;  1VQK Z;  2NVX I;  1ZB9 A;  1Z01 A;  4A3M I;  4A3D I;  1VQP Z;  1LQL A;  2I3C A;  2H85 A;  2RBL A;  3H3V J;  1WCM I;  3G4S 1;  3T4N B;  1RO2 A;  1YJ9 1;  3MZL B;  3QWU A;  2OZK A;  4A3C I;  3CD6 Z;  2Q51 A;  3NDI A;  3CC2 1;  3NFZ A;  2PM9 A;  4MRI A;  1K8A 1;  1M90 1;  3HOX I;  3CPW Y;  1QVG Z;  3CCS 1;  2QA4 Z;  3MON A;  2EGT A;  3VTN A;  4NBG A;  1YJN 1;  2YAD A;  4NH1 C;  5C44 I;  4XX2 A;  3CCS Z;  3K7A I;  5IP7 I;  1S72 1;  1K9M 1;  3GTM I;  2QRD B;  2NVQ I;  2F4M A;  2IZ4 A;  2KPI A;  5D1O B;  3G71 Z;  3NH4 A;  2IZ3 A;  4BXX I;  2PK7 A;  1N2F A;  2DE5 A;  3PO3 S;  1W2B Y;  3VMG A;  1VQ8 1;  2QRE B;  1VQM 1;  4DGL A;  1N8R 1;  1KQS Y;  3CC7 1;  3S14 I;  1VQ7 Z;  3GTQ I;  1YIT Z;  3JAM b;  2E2J I;  1JWH C;  3FQM A;  2JA5 I;  2DE6 A;  3I4N I;  4A93 I;  1YUK A;  1YIT 1;  1Q7Y 1;  3BG0 B;  3HOW I;  4NOZ A;  4E2Y A;  3CD6 1;  4NBD A;  2LIY A;  1JJ2 Y;  3CCU Z;  2QKD A;  3VMH A;  2QA4 1;  1KQS Z;  2JMO A;  3CCV Z;  3CC4 1;  3HOZ I;  4BBR I;  4DK1 A;  2QEX 1;  1Z03 A;  4BBS I;  2G2K A;  1Q81 2;  2Y0S A;  5IP9 I;  1USP A;  3PO2 I;  1TFI A;  2QEX Z;  3BG1 B;  2RT9 A;  4RVG A;  1QVF Y;  3HKZ A;  3KIH A;  4NFR A;  1S7M A;  5FLX f;  1L1O C;  2PMZ A;  3NH5 A;  4E30 A;  2W04 A;  4RV9 A;  3VMI A;  3IFU A;  3J80 f;  2HF1 A;  1K73 1;  3IF8 A;  4MD9 A;  3RZO I;  1YIJ Z;  4RVF A;  3CME 1;  1Q7Y 2;  1VQ5 Z;  1YI2 1;  5T64 A;  3HOY I;  5IT9 f;  1KD1 2;  1RO0 A;  3CXC Z;  4A3J I;  2E2H I;  3CCV 1;  3CCQ 1;  3S1M I;  2JUB A;  2Q4Z A;  3OW2 Y;  3NDJ A;  4NB9 A;  2BJO A;  4E2X A;  3GTG I;  1YUA A;  1YHQ 1;  3S16 I;  2J6A A;  3HOU I;  3LUS A;  3CMA 1;  3OW2 Z;  2ZAE B;  2NVT I;  4A3I I;  1VQ9 1;  3GTM S;  5LL6 f;  1Y1W I;  1VQ4 1;  4CL1 A;  1K9M 2;  1VQ4 Z;  4NBC A;  1ZB8 A;  3U50 C;  1QVG Y;  4X6A I;  1RNI A;  4MD8 A;  1TWF I;  1I3Q I;  2VUM I;  1KRL A;  4HH4 A;  2JS4 A;  3CCJ 1;  1NUI A;  1NP6 A;  3I07 A;  5FLX b;  1WW9 A;  3I56 Z;  4RVH A;  2OTJ 1;  3CCR Z;  2R92 I;  3H0G I;  1VQ6 Z;  1Q81 1;  5D1O A;  1Q82 2;  1DL6 A;  2R7Z I;  1W2B Z;  1YHQ Z;  2JA6 I;  1VQM Z;  4HGY A;  4NBH A;  3I55 Z;  4S1T A;  4E2Z A;  3FKI I;  3S1N I;  3GTK I;  3CCE Z;  2V8K A;  4A3F I;  2GTI A;  1Q86 2;  1JJ2 Z;  3MZK B;  3CCM Z;  3CCQ Z;  2QLV B;  2JNY A;  3TDH B;  3J7A 4;  2LFU A;  1M1K 2;  2QR1 B;  5AN9 F;  4E32 A;  4RS4 A;  2OOY B;  4AYB A;  2GTH A;  2WB1 A;  4MXU A;  2OTJ Z;  2W03 A;  4E2W A;  1VQO 1;  3GKQ A;  3CCJ Z;  2P28 A;  2OTL Z;  3S15 I;  2O53 A;  1VLA A;  2O4H A;  3RZD I;  4BY1 I;  1VQ8 Z;  2F4O A;  2HU9 A;  5C4J I;  1P9N A;  5T6B A;  1YJW Z;  3I4M I;  3S17 I;  3CME Z;  1X0T A;  4QTU A;  3I55 1;  3EED A;  4MD7 A;  3G6E Z;  1TWG I;  4E33 A;  3CC7 Z;  1TWA I;  4Y52 I;  3FQQ A;  1QVF Z;  5C3E I;  5C4X I;  1YI2 Z;  4A3E I;  3CCU 1;  1Q86 1;  2RPR A;  2R93 I;  3CQZ I;  3CCM 1;  4EWC A;  3ESW A;  2AKL A;  2R6M A;  2K5R A;  3CC2 Z;  1TWH I;  2OOX B;  3I56 1;  1QYP A;  2P3Y A;  4NB8 A;  2JA8 I;  2OTL 1;  1VQO Z;  2DE7 A;  2E9H A;  1Q82 1;  2B63 I;  2E2I I;  3HOV I;  1SFO I;  3CMA Z;  1VQL 1;  5IT9 b;  2K3R A;  1K73 2;  1VQN 1;  4A3B I;  3KIF A;  3D6W A;  1VQN Z;  4MH4 A;  1KC8 2;  3GTL I;  1QF8 A;  2RHB A;  5A2Q f;  3G6E 1;  1USP B;  1ZH1 A;  4RVD A;  1N8R 2;  4A3L I;  1YJ9 Z;  3M4O I;  1YJW 1;  2VF1 A;  2YU9 I;  2VUG A;  3G4S Z;  1YIJ 1;  1RQF A;  1VQ9 Z;  1TWC I;  4DQY B;  2KI7 B;  2NVY I;  4A3K I;  3Q87 A;  3EER A;  3CPW Z;  3TE5 B;  1I6H I;  4A3G I;  1YJN Z;  1RLY A;  3CC4 Z;  1X3Z A;  1X3W A;  3GTO I;  2JA7 I;  2V8J A;  4NBB A;  3GTP I;  4NBA A;  1VQ6 1;  3CCR 1;  2RIQ A;  3J81 b;  4NBE A;  1VQL Z;  5CM2 M;  3CCL 1;  3S2H I;  1VQK 1;  2V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...