3RZOI

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI02
1X3WA 2BJOA 1QYPA 4BBSI 4A3CI 3GTPI 5C4JI 3GTKI 4Y7NI 4A3KI 1USPB 2E2JI 3S14I 3HOUI 1K83I 2RBLA 4A3DI 4A3GI 1Y1VI 3HOVI 2JNYA 1I3QI 3LUSA 3S16I 3GKQA 5CM2M 1LQLA 2J6AA 1I6HI 4NBAA 1SFOI 4BBRI 4A3FI 4NBEA 5IP9I 5C3EI 3RZOI 3PO3I 4QTUA 4NBHA 2NVXI 1TFIA 1ZB8A 3I07A 4NOZA 1Y1VS 1N2FA 2R93I 2JA8I 2AKLA 3HOWI 1ML8A 1NUIA 2K5RA 3M3YI 4NB8A 3GTGI 4NB9A 1DL6A 4X6AI 2E2HI 3PO3S 2HF1A 1TWFI 2DE6A 3CQZI 5IP7I 2R7ZI 4NBDA 3S1MI 4BXXI 4NBGA 2NVTI 1YUAA 1TWAI 3VMIA 1VLAA 4A3EI 3ESWA 4NBFA 3S15I 1Y1WI 3PO2I 2JA6I 3S2HI 1TWHI 3H0GI 2DE5A 2F4MA 5C44I 2B63I 4A3JI 2P3YA 3EERA 3VB9A 2JA5I 3S1RI 1X3ZA 2KPIA 1TWCI 3S17I 3M4OI 4QTTA 3HOZI 3VMGA 1TWGI 3GTOI 3GTQI 2NVYI 2JA7I 3I4NI 4BY1I 3U50C 3GTMI 3GTJI 2E2II 2PK7A 1PFTA 4NBCA 4XX2A 3HOXI 2R92I 3I4MI 4MH4A 3H3VJ 3S2DI 4A3LI 4Y52I 3FKII 3GTLI 1I50I 1RLYA 1R9TI 3S1NI 1WW9A 2YU9I 2VUMI 1WCMI 1RO4A 2DE7A 4A3II 3HOYI 3GCFA 2JR6A 5FLMI 1USPA 2JS4A 4A93I 1L1OC 3GTMS 4A3MI 3RZDI 4NBBA 1ZB9A 3S1QI 2F4OA 2NVQI 3VMHA 3Q87A 4BY7I 3D6WA 5C4XI 4A3BI 3K7AI
chains in the Genus database with same CATH superfamily
1QYPA 1Q7Y2 2G2KA 1M1K1 1KQSY 5D1PA 4A3DI 4A3GI 3IR7A 2GTIA 1K732 1M1K2 1VQ41 1Q861 3CCV1 3CC7Z 1LQLA 3NDJA 2J6AA 2IZ4A 3CME1 4NBEA 3JAMb 3BG1B 3QWUA 1YIJZ 2Q51A 2AKLA 1K9M1 4DGLA 3M3YI 4E2XA 3GTGI 1YJNZ 2M48A 4X6AI 1VQPZ 1YJ91 5T6BA 5IP7I 4NBGA 4HGYA 5A2Qf 2RHBA 4RVGA 3CXCZ 1Y1WI 1QF8A 3S2HI 1Z01A 2DE5A 3CCSZ 1VQ91 4A3JI 2P3YA 3EERA 2OZKA 1X3ZA 2OTLZ 3M4OI 4QTTA 2WAQA 5IT9f 2M6NA 1YI2Z 4MRIA 3I4NI 4BY1I 3CCMZ 3CCUZ 2Y0SA 1VQKZ 3TE5B 3VTNA 1PFTA 4NBCA 1R9TI 2PMZA 1FDIA 1VQ71 2QEX1 4A3II 3HOYI 3GCFA 3G4SZ 1VQ61 1RNIA 4A93I 1L1OC 3RZDI 1ZB9A 1VQO1 3S1QI 4BY7I 2QRDB 2OTJZ 1Q16A 1X3WA 2E7ZA 1YHQZ 2VUGA 4RV9A 1RO2A 1S72Z 4Y7NI 3I55Z 4A3KI 2E2JI 1S7MA 4E31A 1VQ81 3S14I 2RBLA 1Y1VI 1VQ5Z 1VQMZ 3CCLZ 3FQQA 3S16I 3GKQA 3CD61 3CCE1 2QR1B 2QRCB 1SFOI 4MD9A 5IP9I 3PO3I 4RVHA 3JAMf 1TFIA 1AA6A 1WZNA 2JIOA 2YADA 1NP6A 2JA8I 3NDIA 2VPYA 3CCR1 3BG0B 3HKZA 1ML8A 1VQN1 2K5RA 2JMOA 3CCVZ 4HH4A 2DE6A 3CQZI 4BXXI 3CMEZ 4RVDA 3J81b 4AYBA 3VMIA 5FLXb 2K3RA 4A3EI 2VPZA 3ESWA 1YJW1 2IZ3A 3CCQ1 1Q862 1TWHI 2F4MA 2V8JA 4EWCA 2VPWA 1YJ9Z 3G711 2KPIA 3HOZI 3CCJ1 1K9M2 3VMGA 2NVYI 5D1OA 3I561 4E2WA 2E9HA 3U50C 3CC71 1VQ9Z 2QREB 2E2II 2O4HA 2R92I 3S2DI 3GTLI 2W03A 1I50I 1YIT1 1WW9A 2YU9I 1RO4A 4HGZA 1N8R1 1Z03A 2JS4A 1VQL1 3KIFA 3GTMS 2QLVB 2F4OA 2IV2X 3CPWY 3D6WA 5T67A 3MZLB 2BJOA 1KQSZ 3GTPI 2RPRA 3T4NB 4NFRA 2JIMA 2QEXZ 4E2ZA 1VQ7Z 3GTKI 2RT9A 1P9NA 2W04A 1USPB 4E33A 1VQ6Z 1K83I 4S1TA 2V8IA 3MONA 5AN9F 1Q821 1VQOZ 3EEDA 1ZH1A 1Z02A 5D1OB 3LUSA 1SIWA 5CM2M 3KIHA 1NJI1 3D9XA 2PM9A 4NBAA 3G6E1 4BBRI 1QVFY 1ZB8A 3I07A 4NOZA 1VQ8Z 4MONA 3CMA1 1N2FA 3HOWI 5T64A 4MD8A 1QVGY 1W2BY 2VF1A 1NUIA 4NB8A 3J81f 3CD6Z 3CCEZ 2HF1A 1TWFI 2R7ZI 4NBDA 5FLXf 3FQMA 1Q811 1YUAA 1K8A1 4RS4A 1KRLA 4NBFA 3CC21 1M901 3PO2I 2JA6I 2V8KA 1KD11 4RVFA 1FDOA 2GU2A 3OW2Y 3H0GI 1KC81 2V3VA 1WIIA 3CCRZ 1VQNZ 2B63I 1KD12 3CXCY 2JIQA 1JWHC 1KC82 2JA5I 3VB9A 2GTHA 1VQ4Z 2LFUA 1TWCI 2LIYA 1YJWZ 3GTOI 3GTQI 2QA41 3J7A4 2RIQA 3CCQZ 4DQYB 3P5JB 1Q7Y1 3GTJI 2EGTA 3CC41 2PK7A 1JJ2Y 1YUKA 2P28A 4XX2A 3HOXI 4MH4A 1K731 3G71Z 1RLYA 3S1NI 2VUMI 2DE7A 3CCJZ 2JR6A 2HU9A 1USPA 3NH8A 3J80b 3I56Z 1QVFZ 4E32A 4NBBA 2R6MA 3Q87A 4MD7A 3IF8A 5C4XI 2VPXA 1WJ2A 1QVGZ 1W2BZ 3NH4A 1YITZ 4BBSI 3F3FC 4A3CI 5C4JI 2LEXA 3HOUI 1YIJ1 1VQLZ 2H85A 3IX0A 3HOVI 2JNYA 2QKDA 1I3QI 1YJN1 3OW2Z 1VQP1 2AYDA 1I6HI 1N8R2 4A3FI 5C3EI 3RZOI 4QTUA 4NBHA 2KI7B 2NVXI 1RQFA 4NH1C 1Y1VS 2R93I 4CL1A 3CCS1 2WB1A 3TDHB 4NB9A 1DL6A 2E2HI 3PO3S 4E2YA 2ZAEB 3S1MI 4DK1A 3G6EZ 1QXFA 1JJ2Z 2OTL1 2NVTI 1TWAI 1VLAA 2OOXB 2JIRA 1YI21 1Q822 3S15I 5A2Qb 3CMAZ 3CCM1 1NJI2 3CCU1 1Y8CA 1VQK1 4TNUA 5C44I 2I3CA 3S1RI 4MXUA 3S17I 3F3PC 3IFUA 1TWGI 2JUBA 2O53A 2OOYB 2NAPA 3G4S1 3CC2Z 5LL6f 2Q4ZA 2JA7I 5IT9b 3GTMI 1Q812 3NFZA 2OTJ1 3D2LA 1K8A2 4A3LI 4Y52I 3I4MI 3NH5A 3H3VJ 1YHQ1 3FKII 1M902 2JIPA 1WCMI 3J80f 2V45A 1S721 1RO0A 3I551 5FLMI 3CPWZ 2QA4Z 4A3MI 1X0TA 1VQ51 3MZKB 1VQM1 3CCL1 3VMHA 2NVQI 3CC4Z 4E30A 4A3BI 3K7AI
chains in the Genus database with same CATH topology
1QYPA 1Q7Y2 2G2KA 1M1K1 1KQSY 5D1PA 4A3DI 4A3GI 2GTIA 1K732 1M1K2 1VQ41 1Q861 3CCV1 3CC7Z 1LQLA 3NDJA 2J6AA 2IZ4A 3CME1 4NBEA 3JAMb 3BG1B 3QWUA 1YIJZ 2Q51A 2AKLA 1K9M1 4DGLA 3M3YI 4E2XA 3GTGI 1YJNZ 2M48A 4X6AI 1VQPZ 1YJ91 5T6BA 5IP7I 4NBGA 4HGYA 5A2Qf 2RHBA 4RVGA 3CXCZ 1Y1WI 1QF8A 3S2HI 1Z01A 2DE5A 3CCSZ 1VQ91 4A3JI 2P3YA 3EERA 2OZKA 1X3ZA 2OTLZ 3M4OI 4QTTA 2WAQA 5IT9f 2M6NA 1YI2Z 4MRIA 3I4NI 4BY1I 3CCMZ 3CCUZ 2Y0SA 1VQKZ 3TE5B 3VTNA 1PFTA 4NBCA 1R9TI 2PMZA 1VQ71 2QEX1 4A3II 3HOYI 3GCFA 3G4SZ 1VQ61 1RNIA 4A93I 1L1OC 3RZDI 1ZB9A 1VQO1 3S1QI 4BY7I 2QRDB 2OTJZ 1X3WA 1YHQZ 2VUGA 4RV9A 1RO2A 1S72Z 4Y7NI 3I55Z 4A3KI 2E2JI 1S7MA 4E31A 1VQ81 3S14I 2RBLA 1Y1VI 1VQ5Z 1VQMZ 3CCLZ 3FQQA 3S16I 3GKQA 3CD61 3CCE1 2QR1B 2QRCB 1SFOI 4MD9A 5IP9I 3PO3I 4RVHA 3JAMf 1TFIA 2YADA 1NP6A 2JA8I 3NDIA 3CCR1 3BG0B 3HKZA 1ML8A 1VQN1 2K5RA 2JMOA 3CCVZ 4HH4A 2DE6A 3CQZI 4BXXI 3CMEZ 4RVDA 3J81b 4AYBA 3VMIA 5FLXb 2K3RA 4A3EI 3ESWA 1YJW1 2IZ3A 3CCQ1 1Q862 1TWHI 2F4MA 2V8JA 4EWCA 1YJ9Z 3G711 2KPIA 3HOZI 3CCJ1 1K9M2 3VMGA 2NVYI 5D1OA 3I561 4E2WA 2E9HA 3U50C 3CC71 1VQ9Z 2QREB 2E2II 2O4HA 2R92I 3S2DI 3GTLI 2W03A 1I50I 1YIT1 1WW9A 2YU9I 1RO4A 4HGZA 1N8R1 1Z03A 2JS4A 1VQL1 3KIFA 3GTMS 2QLVB 2F4OA 3CPWY 3D6WA 5T67A 3MZLB 2BJOA 1KQSZ 3GTPI 2RPRA 3T4NB 4NFRA 1VQ7Z 2QEXZ 4E2ZA 3GTKI 2RT9A 1P9NA 2W04A 1USPB 4E33A 1VQ6Z 1K83I 4S1TA 2V8IA 3MONA 5AN9F 1Q821 1VQOZ 3EEDA 1ZH1A 1Z02A 5D1OB 3LUSA 5CM2M 3KIHA 1NJI1 3D9XA 2PM9A 4NBAA 3G6E1 4BBRI 1QVFY 1ZB8A 3I07A 4NOZA 1VQ8Z 4MONA 3CMA1 1N2FA 3HOWI 5T64A 4MD8A 1QVGY 1W2BY 2VF1A 1NUIA 4NB8A 3J81f 3CD6Z 3CCEZ 2HF1A 1TWFI 2R7ZI 4NBDA 5FLXf 3FQMA 1Q811 1YUAA 1K8A1 4RS4A 1KRLA 4NBFA 3CC21 1M901 3PO2I 2JA6I 2V8KA 1KD11 4RVFA 2GU2A 3OW2Y 3H0GI 1KC81 1WIIA 3CCRZ 1VQNZ 2B63I 1KD12 3CXCY 1JWHC 1KC82 2JA5I 3VB9A 2GTHA 1VQ4Z 2LFUA 1TWCI 2LIYA 1YJWZ 3GTOI 3GTQI 2QA41 3J7A4 2RIQA 3CCQZ 4DQYB 3P5JB 1Q7Y1 3GTJI 2EGTA 3CC41 2PK7A 1JJ2Y 1YUKA 2P28A 4XX2A 3HOXI 4MH4A 1K731 3G71Z 1RLYA 3S1NI 2VUMI 2DE7A 3CCJZ 2JR6A 2HU9A 1USPA 3NH8A 3J80b 3I56Z 1QVFZ 4E32A 4NBBA 2R6MA 3Q87A 4MD7A 3IF8A 5C4XI 1QVGZ 1W2BZ 3NH4A 1YITZ 4BBSI 3F3FC 4A3CI 5C4JI 3HOUI 1YIJ1 1VQLZ 2H85A 3IX0A 3HOVI 2JNYA 2QKDA 1I3QI 1YJN1 3OW2Z 1VQP1 1I6HI 1N8R2 4A3FI 5C3EI 3RZOI 4QTUA 4NBHA 2KI7B 2NVXI 1RQFA 4NH1C 1Y1VS 2R93I 4CL1A 3CCS1 2WB1A 3TDHB 4NB9A 1DL6A 2E2HI 3PO3S 4E2YA 2ZAEB 3S1MI 4DK1A 3G6EZ 1JJ2Z 2OTL1 2NVTI 1TWAI 1VLAA 2OOXB 1YI21 1Q822 3S15I 5A2Qb 3CMAZ 3CCM1 1NJI2 3CCU1 1VQK1 4TNUA 5C44I 2I3CA 3S1RI 4MXUA 3S17I 3F3PC 3IFUA 1TWGI 2JUBA 2O53A 2OOYB 3G4S1 3CC2Z 5LL6f 2Q4ZA 2JA7I 5IT9b 3GTMI 1Q812 3NFZA 2OTJ1 1K8A2 4A3LI 4Y52I 3I4MI 3NH5A 3H3VJ 1YHQ1 3FKII 1M902 1WCMI 3J80f 1S721 1RO0A 3I551 5FLMI 3CPWZ 2QA4Z 4A3MI 1X0TA 1VQ51 3MZKB 1VQM1 3CCL1 3VMHA 2NVQI 3CC4Z 4E30A 4A3BI 3K7AI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3W A;  2BJO A;  1QYP A;  4BBS I;  4A3C I;  3GTP I;  5C4J I;  3GTK I;  4Y7N I;  4A3K I;  1USP B;  2E2J I;  3S14 I;  3HOU I;  1K83 I;  2RBL A;  4A3D I;  4A3G I;  1Y1V I;  3HOV I;  2JNY A;  1I3Q I;  3LUS A;  3S16 I;  3GKQ A;  5CM2 M;  1LQL A;  2J6A A;  1I6H I;  4NBA A;  1SFO I;  4BBR I;  4A3F I;  4NBE A;  5IP9 I;  5C3E I;  3RZO I;  3PO3 I;  4QTU A;  4NBH A;  2NVX I;  1TFI A;  1ZB8 A;  3I07 A;  4NOZ A;  1Y1V S;  1N2F A;  2R93 I;  2JA8 I;  2AKL A;  3HOW I;  1ML8 A;  1NUI A;  2K5R A;  3M3Y I;  4NB8 A;  3GTG I;  4NB9 A;  1DL6 A;  4X6A I;  2E2H I;  3PO3 S;  2HF1 A;  1TWF I;  2DE6 A;  3CQZ I;  5IP7 I;  2R7Z I;  4NBD A;  3S1M I;  4BXX I;  4NBG A;  2NVT I;  1YUA A;  1TWA I;  3VMI A;  1VLA A;  4A3E I;  3ESW A;  4NBF A;  3S15 I;  1Y1W I;  3PO2 I;  2JA6 I;  3S2H I;  1TWH I;  3H0G I;  2DE5 A;  2F4M A;  5C44 I;  2B63 I;  4A3J I;  2P3Y A;  3EER A;  3VB9 A;  2JA5 I;  3S1R I;  1X3Z A;  2KPI A;  1TWC I;  3S17 I;  3M4O I;  4QTT A;  3HOZ I;  3VMG A;  1TWG I;  3GTO I;  3GTQ I;  2NVY I;  2JA7 I;  3I4N I;  4BY1 I;  3U50 C;  3GTM I;  3GTJ I;  2E2I I;  2PK7 A;  1PFT A;  4NBC A;  4XX2 A;  3HOX I;  2R92 I;  3I4M I;  4MH4 A;  3H3V J;  3S2D I;  4A3L I;  4Y52 I;  3FKI I;  3GTL I;  1I50 I;  1RLY A;  1R9T I;  3S1N I;  1WW9 A;  2YU9 I;  2VUM I;  1WCM I;  1RO4 A;  2DE7 A;  4A3I I;  3HOY I;  3GCF A;  2JR6 A;  5FLM I;  1USP A;  2JS4 A;  4A93 I;  1L1O C;  3GTM S;  4A3M I;  3RZD I;  4NBB A;  1ZB9 A;  3S1Q I;  2F4O A;  2NVQ I;  3VMH A;  3Q87 A;  4BY7 I;  3D6W A;  5C4X I;  4A3B I;  3K7A I; 
#chains in the Genus database with same CATH topology
 1QYP A;  1Q7Y 2;  2G2K A;  1M1K 1;  1KQS Y;  5D1P A;  4A3D I;  4A3G I;  3IR7 A;  2GTI A;  1K73 2;  1M1K 2;  1VQ4 1;  1Q86 1;  3CCV 1;  3CC7 Z;  1LQL A;  3NDJ A;  2J6A A;  2IZ4 A;  3CME 1;  4NBE A;  3JAM b;  3BG1 B;  3QWU A;  1YIJ Z;  2Q51 A;  2AKL A;  1K9M 1;  4DGL A;  3M3Y I;  4E2X A;  3GTG I;  1YJN Z;  2M48 A;  4X6A I;  1VQP Z;  1YJ9 1;  5T6B A;  5IP7 I;  4NBG A;  4HGY A;  5A2Q f;  2RHB A;  4RVG A;  3CXC Z;  1Y1W I;  1QF8 A;  3S2H I;  1Z01 A;  2DE5 A;  3CCS Z;  1VQ9 1;  4A3J I;  2P3Y A;  3EER A;  2OZK A;  1X3Z A;  2OTL Z;  3M4O I;  4QTT A;  2WAQ A;  5IT9 f;  2M6N A;  1YI2 Z;  4MRI A;  3I4N I;  4BY1 I;  3CCM Z;  3CCU Z;  2Y0S A;  1VQK Z;  3TE5 B;  3VTN A;  1PFT A;  4NBC A;  1R9T I;  2PMZ A;  1FDI A;  1VQ7 1;  2QEX 1;  4A3I I;  3HOY I;  3GCF A;  3G4S Z;  1VQ6 1;  1RNI A;  4A93 I;  1L1O C;  3RZD I;  1ZB9 A;  1VQO 1;  3S1Q I;  4BY7 I;  2QRD B;  2OTJ Z;  1Q16 A;  1X3W A;  2E7Z A;  1YHQ Z;  2VUG A;  4RV9 A;  1RO2 A;  1S72 Z;  4Y7N I;  3I55 Z;  4A3K I;  2E2J I;  1S7M A;  4E31 A;  1VQ8 1;  3S14 I;  2RBL A;  1Y1V I;  1VQ5 Z;  1VQM Z;  3CCL Z;  3FQQ A;  3S16 I;  3GKQ A;  3CD6 1;  3CCE 1;  2QR1 B;  2QRC B;  1SFO I;  4MD9 A;  5IP9 I;  3PO3 I;  4RVH A;  3JAM f;  1TFI A;  1AA6 A;  1WZN A;  2JIO A;  2YAD A;  1NP6 A;  2JA8 I;  3NDI A;  2VPY A;  3CCR 1;  3BG0 B;  3HKZ A;  1ML8 A;  1VQN 1;  2K5R A;  2JMO A;  3CCV Z;  4HH4 A;  2DE6 A;  3CQZ I;  4BXX I;  3CME Z;  4RVD A;  3J81 b;  4AYB A;  3VMI A;  5FLX b;  2K3R A;  4A3E I;  2VPZ A;  3ESW A;  1YJW 1;  2IZ3 A;  3CCQ 1;  1Q86 2;  1TWH I;  2F4M A;  2V8J A;  4EWC A;  2VPW A;  1YJ9 Z;  3G71 1;  2KPI A;  3HOZ I;  3CCJ 1;  1K9M 2;  3VMG A;  2NVY I;  5D1O A;  3I56 1;  4E2W A;  2E9H A;  3U50 C;  3CC7 1;  1VQ9 Z;  2QRE B;  2E2I I;  2O4H A;  2R92 I;  3S2D I;  3GTL I;  2W03 A;  1I50 I;  1YIT 1;  1WW9 A;  2YU9 I;  1RO4 A;  4HGZ A;  1N8R 1;  1Z03 A;  2JS4 A;  1VQL 1;  3KIF A;  3GTM S;  2QLV B;  2F4O A;  2IV2 X;  3CPW Y;  3D6W A;  5T67 A;  3MZL B;  2BJO A;  1KQS Z;  3GTP I;  2RPR A;  3T4N B;  4NFR A;  2JIM A;  2QEX Z;  4E2Z A;  1VQ7 Z;  3GTK I;  2RT9 A;  1P9N A;  2W04 A;  1USP B;  4E33 A;  1VQ6 Z;  1K83 I;  4S1T A;  2V8I A;  3MON A;  5AN9 F;  1Q82 1;  1VQO Z;  3EED A;  1ZH1 A;  1Z02 A;  5D1O B;  3LUS A;  1SIW A;  5CM2 M;  3KIH A;  1NJI 1;  3D9X A;  2PM9 A;  4NBA A;  3G6E 1;  4BBR I;  1QVF Y;  1ZB8 A;  3I07 A;  4NOZ A;  1VQ8 Z;  4MON A;  3CMA 1;  1N2F A;  3HOW I;  5T64 A;  4MD8 A;  1QVG Y;  1W2B Y;  2VF1 A;  1NUI A;  4NB8 A;  3J81 f;  3CD6 Z;  3CCE Z;  2HF1 A;  1TWF I;  2R7Z I;  4NBD A;  5FLX f;  3FQM A;  1Q81 1;  1YUA A;  1K8A 1;  4RS4 A;  1KRL A;  4NBF A;  3CC2 1;  1M90 1;  3PO2 I;  2JA6 I;  2V8K A;  1KD1 1;  4RVF A;  1FDO A;  2GU2 A;  3OW2 Y;  3H0G I;  1KC8 1;  2V3V A;  1WII A;  3CCR Z;  1VQN Z;  2B63 I;  1KD1 2;  3CXC Y;  2JIQ A;  1JWH C;  1KC8 2;  2JA5 I;  3VB9 A;  2GTH A;  1VQ4 Z;  2LFU A;  1TWC I;  2LIY A;  1YJW Z;  3GTO I;  3GTQ I;  2QA4 1;  3J7A 4;  2RIQ A;  3CCQ Z;  4DQY B;  3P5J B;  1Q7Y 1;  3GTJ I;  2EGT A;  3CC4 1;  2PK7 A;  1JJ2 Y;  1YUK A;  2P28 A;  4XX2 A;  3HOX I;  4MH4 A;  1K73 1;  3G71 Z;  1RLY A;  3S1N I;  2VUM I;  2DE7 A;  3CCJ Z;  2JR6 A;  2HU9 A;  1USP A;  3NH8 A;  3J80 b;  3I56 Z;  1QVF Z;  4E32 A;  4NBB A;  2R6M A;  3Q87 A;  4MD7 A;  3IF8 A;  5C4X I;  2VPX A;  1WJ2 A;  1QVG Z;  1W2B Z;  3NH4 A;  1YIT Z;  4BBS I;  3F3F C;  4A3C I;  5C4J I;  2LEX A;  3HOU I;  1YIJ 1;  1VQL Z;  2H85 A;  3IX0 A;  3HOV I;  2JNY A;  2QKD A;  1I3Q I;  1YJN 1;  3OW2 Z;  1VQP 1;  2AYD A;  1I6H I;  1N8R 2;  4A3F I;  5C3E I;  3RZO I;  4QTU A;  4NBH A;  2KI7 B;  2NVX I;  1RQF A;  4NH1 C;  1Y1V S;  2R93 I;  4CL1 A;  3CCS 1;  2WB1 A;  3TDH B;  4NB9 A;  1DL6 A;  2E2H I;  3PO3 S;  4E2Y A;  2ZAE B;  3S1M I;  4DK1 A;  3G6E Z;  1QXF A;  1JJ2 Z;  2OTL 1;  2NVT I;  1TWA I;  1VLA A;  2OOX B;  2JIR A;  1YI2 1;  1Q82 2;  3S15 I;  5A2Q b;  3CMA Z;  3CCM 1;  1NJI 2;  3CCU 1;  1Y8C A;  1VQK 1;  4TNU A;  5C44 I;  2I3C A;  3S1R I;  4MXU A;  3S17 I;  3F3P C;  3IFU A;  1TWG I;  2JUB A;  2O53 A;  2OOY B;  2NAP A;  3G4S 1;  3CC2 Z;  5LL6 f;  2Q4Z A;  2JA7 I;  5IT9 b;  3GTM I;  1Q81 2;  3NFZ A;  2OTJ 1;  3D2L A;  1K8A 2;  4A3L I;  4Y52 I;  3I4M I;  3NH5 A;  3H3V J;  1YHQ 1;  3FKI I;  1M90 2;  2JIP A;  1WCM I;  3J80 f;  2V45 A;  1S72 1;  1RO0 A;  3I55 1;  5FLM I;  3CPW Z;  2QA4 Z;  4A3M I;  1X0T A;  1VQ5 1;  3MZK B;  1VQM 1;  3CCL 1;  3VMH A;  2NVQ I;  3CC4 Z;  4E30 A;  4A3B I;  3K7A I; 
#chains in the Genus database with same CATH homology
 1QYP A;  1Q7Y 2;  2G2K A;  1M1K 1;  1KQS Y;  5D1P A;  4A3D I;  4A3G I;  2GTI A;  1K73 2;  1M1K 2;  1VQ4 1;  1Q86 1;  3CCV 1;  3CC7 Z;  1LQL A;  3NDJ A;  2J6A A;  2IZ4 A;  3CME 1;  4NBE A;  3JAM b;  3BG1 B;  3QWU A;  1YIJ Z;  2Q51 A;  2AKL A;  1K9M 1;  4DGL A;  3M3Y I;  4E2X A;  3GTG I;  1YJN Z;  2M48 A;  4X6A I;  1VQP Z;  1YJ9 1;  5T6B A;  5IP7 I;  4NBG A;  4HGY A;  5A2Q f;  2RHB A;  4RVG A;  3CXC Z;  1Y1W I;  1QF8 A;  3S2H I;  1Z01 A;  2DE5 A;  3CCS Z;  1VQ9 1;  4A3J I;  2P3Y A;  3EER A;  2OZK A;  1X3Z A;  2OTL Z;  3M4O I;  4QTT A;  2WAQ A;  5IT9 f;  2M6N A;  1YI2 Z;  4MRI A;  3I4N I;  4BY1 I;  3CCM Z;  3CCU Z;  2Y0S A;  1VQK Z;  3TE5 B;  3VTN A;  1PFT A;  4NBC A;  1R9T I;  2PMZ A;  1VQ7 1;  2QEX 1;  4A3I I;  3HOY I;  3GCF A;  3G4S Z;  1VQ6 1;  1RNI A;  4A93 I;  1L1O C;  3RZD I;  1ZB9 A;  1VQO 1;  3S1Q I;  4BY7 I;  2QRD B;  2OTJ Z;  1X3W A;  1YHQ Z;  2VUG A;  4RV9 A;  1RO2 A;  1S72 Z;  4Y7N I;  3I55 Z;  4A3K I;  2E2J I;  1S7M A;  4E31 A;  1VQ8 1;  3S14 I;  2RBL A;  1Y1V I;  1VQ5 Z;  1VQM Z;  3CCL Z;  3FQQ A;  3S16 I;  3GKQ A;  3CD6 1;  3CCE 1;  2QR1 B;  2QRC B;  1SFO I;  4MD9 A;  5IP9 I;  3PO3 I;  4RVH A;  3JAM f;  1TFI A;  2YAD A;  1NP6 A;  2JA8 I;  3NDI A;  3CCR 1;  3BG0 B;  3HKZ A;  1ML8 A;  1VQN 1;  2K5R A;  2JMO A;  3CCV Z;  4HH4 A;  2DE6 A;  3CQZ I;  4BXX I;  3CME Z;  4RVD A;  3J81 b;  4AYB A;  3VMI A;  5FLX b;  2K3R A;  4A3E I;  3ESW A;  1YJW 1;  2IZ3 A;  3CCQ 1;  1Q86 2;  1TWH I;  2F4M A;  2V8J A;  4EWC A;  1YJ9 Z;  3G71 1;  2KPI A;  3HOZ I;  3CCJ 1;  1K9M 2;  3VMG A;  2NVY I;  5D1O A;  3I56 1;  4E2W A;  2E9H A;  3U50 C;  3CC7 1;  1VQ9 Z;  2QRE B;  2E2I I;  2O4H A;  2R92 I;  3S2D I;  3GTL I;  2W03 A;  1I50 I;  1YIT 1;  1WW9 A;  2YU9 I;  1RO4 A;  4HGZ A;  1N8R 1;  1Z03 A;  2JS4 A;  1VQL 1;  3KIF A;  3GTM S;  2QLV B;  2F4O A;  3CPW Y;  3D6W A;  5T67 A;  3MZL B;  2BJO A;  1KQS Z;  3GTP I;  2RPR A;  3T4N B;  4NFR A;  1VQ7 Z;  2QEX Z;  4E2Z A;  3GTK I;  2RT9 A;  1P9N A;  2W04 A;  1USP B;  4E33 A;  1VQ6 Z;  1K83 I;  4S1T A;  2V8I A;  3MON A;  5AN9 F;  1Q82 1;  1VQO Z;  3EED A;  1ZH1 A;  1Z02 A;  5D1O B;  3LUS A;  5CM2 M;  3KIH A;  1NJI 1;  3D9X A;  2PM9 A;  4NBA A;  3G6E 1;  4BBR I;  1QVF Y;  1ZB8 A;  3I07 A;  4NOZ A;  1VQ8 Z;  4MON A;  3CMA 1;  1N2F A;  3HOW I;  5T64 A;  4MD8 A;  1QVG Y;  1W2B Y;  2VF1 A;  1NUI A;  4NB8 A;  3J81 f;  3CD6 Z;  3CCE Z;  2HF1 A;  1TWF I;  2R7Z I;  4NBD A;  5FLX f;  3FQM A;  1Q81 1;  1YUA A;  1K8A 1;  4RS4 A;  1KRL A;  4NBF A;  3CC2 1;  1M90 1;  3PO2 I;  2JA6 I;  2V8K A;  1KD1 1;  4RVF A;  2GU2 A;  3OW2 Y;  3H0G I;  1KC8 1;  1WII A;  3CCR Z;  1VQN Z;  2B63 I;  1KD1 2;  3CXC Y;  1JWH C;  1KC8 2;  2JA5 I;  3VB9 A;  2GTH A;  1VQ4 Z;  2LFU A;  1TWC I;  2LIY A;  1YJW Z;  3GTO I;  3GTQ I;  2QA4 1;  3J7A 4;  2RIQ A;  3CCQ Z;  4DQY B;  3P5J B;  1Q7Y 1;  3GTJ I;  2EGT A;  3CC4 1;  2PK7 A;  1JJ2 Y;  1YUK A;  2P28 A;  4XX2 A;  3HOX I;  4MH4 A;  1K73 1;  3G71 Z;  1RLY A;  3S1N I;  2VUM I;  2DE7 A;  3CCJ Z;  2JR6 A;  2HU9 A;  1USP A;  3NH8 A;  3J80 b;  3I56 Z;  1QVF Z;  4E32 A;  4NBB A;  2R6M A;  3Q87 A;  4MD7 A;  3IF8 A;  5C4X I;  1QVG Z;  1W2B Z;  3NH4 A;  1YIT Z;  4BBS I;  3F3F C;  4A3C I;  5C4J I;  3HOU I;  1YIJ 1;  1VQL Z;  2H85 A;  3IX0 A;  3HOV I;  2JNY A;  2QKD A;  1I3Q I;  1YJN 1;  3OW2 Z;  1VQP 1;  1I6H I;  1N8R 2;  4A3F I;  5C3E I;  3RZO I;  4QTU A;  4NBH A;  2KI7 B;  2NVX I;  1RQF A;  4NH1 C;  1Y1V S;  2R93 I;  4CL1 A;  3CCS 1;  2WB1 A;  3TDH B;  4NB9 A;  1DL6 A;  2E2H I;  3PO3 S;  4E2Y A;  2ZAE B;  3S1M I;  4DK1 A;  3G6E Z;  1JJ2 Z;  2OTL 1;  2NVT I;  1TWA I;  1VLA A;  2OOX B;  1YI2 1;  1Q82 2;  3S15 I;  5A2Q b;  3CMA Z;  3CCM 1;  1NJI 2;  3CCU 1;  1VQK 1;  4TNU A;  5C44 I;  2I3C A;  3S1R I;  4MXU A;  3S17 I;  3F3P C;  3IFU A;  1TWG I;  2JUB A;  2O53 A;  2OOY B;  3G4S 1;  3CC2 Z;  5LL6 f;  2Q4Z A;  2JA7 I;  5IT9 b;  3GTM I;  1Q81 2;  3NFZ A;  2OTJ 1;  1K8A 2;  4A3L I;  4Y52 I;  3I4M I;  3NH5 A;  3H3V J;  1YHQ 1;  3FKI I;  1M90 2;  1WCM I;  3J80 f;  1S72 1;  1RO0 A;  3I55 1;  5FLM I;  3CPW Z;  2QA4 Z;  4A3M I;  1X0T A;  1VQ5 1;  3MZK B;  1VQM 1;  3CCL 1;  3VMH A;  2NVQ I;  3CC4 Z;  4E30 A;  4A3B I;  3K7A I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...