3RZOI

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI02
2JS4A 3S1RI 3HOYI 4NBDA 5FLMI 2BJOA 4XX2A 1TWAI 3GTMS 4NBBA 2F4MA 4A3CI 1TWHI 4A3MI 3GTJI 2DE7A 1TWGI 1VLAA 3S1NI 4A93I 1ZB8A 5IP7I 1L1OC 5C44I 2NVYI 2NVQI 1USPA 4NBFA 3U50C 3K7AI 1I50I 3GTOI 3HOXI 1SFOI 1QYPA 1Y1VI 1TWCI 3H0GI 3S2HI 4X6AI 2P3YA 3GTLI 2K5RA 4Y7NI 1YUAA 2JA8I 1ML8A 3GTMI 1Y1VS 2R92I 4NB8A 4NBCA 4QTTA 1TWFI 2KPIA 4Y52I 1X3WA 3GTPI 2PK7A 4MH4A 2VUMI 3LUSA 1N2FA 5C4JI 3S1QI 4A3BI 3HOWI 1DL6A 1K83I 1WCMI 1R9TI 3S2DI 5CM2M 1WW9A 3S16I 2E2JI 3PO3I 4BBSI 3S1MI 3GCFA 4A3II 3Q87A 5C4XI 4A3FI 2RBLA 2E2HI 3PO3S 4A3DI 1TFIA 2JA6I 2J6AA 3S14I 3RZDI 3VB9A 4A3LI 2F4OA 3I07A 5C3EI 4NOZA 3M3YI 3GKQA 1Y1WI 2E2II 3H3VJ 1I6HI 2B63I 2NVTI 3GTQI 1X3ZA 3GTKI 2DE6A 1USPB 2HF1A 4A3JI 3S15I 2JA7I 3HOZI 4BXXI 3RZOI 3CQZI 4BY1I 3D6WA 4NBEA 3HOVI 4BY7I 2AKLA 2DE5A 2YU9I 3PO2I 3I4MI 4NBGA 1RLYA 3FKII 4BBRI 1NUIA 4NBAA 1PFTA 4A3EI 4A3KI 1RO4A 4QTUA 3GTGI 3EERA 3HOUI 3I4NI 3VMGA 3M4OI 4NBHA 2JA5I 3VMIA 1I3QI 3S17I 1ZB9A 2JNYA 2NVXI 2R7ZI 5IP9I 3VMHA 1LQLA 2R93I 4A3GI 3ESWA 2JR6A 4NB9A
chains in the Genus database with same CATH superfamily
2LIYA 3S1RI 1W2BZ 5FLMI 2BJOA 4XX2A 1TWAI 3CCJ1 3D2LA 3CCU1 1VQ41 1X0TA 1JWHC 1VQO1 2F4MA 3G6E1 1QVFY 3JAMb 1VQ61 2OTJZ 4RV9A 3GTJI 4A93I 5IP7I 1L1OC 3CCQ1 3CC2Z 3U50C 2RHBA 1I50I 1KQSY 3H0GI 3CCJZ 3CCUZ 1VQ4Z 2P3YA 2V8JA 4Y7NI 3NH4A 1VQOZ 3J81b 2IZ4A 1WIIA 3G6EZ 4E33A 3I551 1Y1VS 1VQ6Z 4E2YA 2KPIA 3CCM1 3CCQZ 2PK7A 2VUMI 1VQL1 1N2FA 5C4JI 1VQ81 3HOWI 1R9TI 2E9HA 2G2KA 2RT9A 3I55Z 3IFUA 5T6BA 3PO3I 1QF8A 3S1MI 3I561 3GCFA 3CCMZ 2GTHA 2E2HI 1KD11 2JMOA 2JIMA 1VQLZ 2J6AA 2JIPA 1VQ8Z 2V45A 3VTNA 4RVFA 5FLXf 4RVHA 3M3YI 2OZKA 3FQQA 1Y1WI 2NVTI 1X3ZA 4RVGA 3CCRZ 4RS4A 5IT9f 2DE6A 1Q861 2HF1A 3NDJA 3I56Z 4A3JI 3HOZI 4BXXI 3PO2I 3I4MI 4NBGA 5T64A 1RQFA 1PFTA 1RO4A 1S7MA 2PM9A 3J80b 2VUGA 4RVDA 1I3QI 2PMZA 1ZB9A 2JNYA 4MONA 2Q4ZA 5IP9I 3CD61 3VMHA 1LQLA 1YHQ1 2R93I 1JJ2Y 2R6MA 4A3GI 1VQP1 3HOYI 3G4S1 3CXCZ 2V8KA 5D1PA 1Z01A 3CME1 1TWHI 3FQMA 2DE7A 3CD6Z 1ZB8A 3CC4Z 2QRDB 3K7AI 1VQPZ 2VPYA 3OW2Z 2H85A 3G4SZ 3GTOI 1QYPA 1W2BY 4X6AI 1N8R2 5A2Qf 3CMEZ 2R92I 4E2WA 4NB8A 2IZ3A 2RIQA 1TWFI 4QTTA 1K731 3D9XA 4A3BI 1DL6A 1NP6A 4MD9A 1KC81 3S16I 1Q821 1WJ2A 4HH4A 5AN9F 2JIRA 5T67A 4HGZA 3Q87A 2QKDA 5C4XI 4A3DI 3PO3S 2EGTA 1TFIA 2JA6I 3TE5B 3F3PC 2JUBA 3I07A 3GKQA 4AYBA 1K8A1 4MRIA 2B63I 2JIQA 4E2ZA 2JA7I 5LL6f 4BY1I 1VQ51 2AKLA 2O4HA 3HKZA 3IR7A 4DQYB 3TDHB 4BBRI 1NUIA 2QRCB 1S721 4A3EI 1WZNA 2P28A 1VQ5Z 1RNIA 3VMIA 5FLXb 3CC71 1M902 3S17I 2QEX1 3T4NB 2NVXI 2R7ZI 1Z02A 5IT9b 1S72Z 2W04A 2JR6A 2OOXB 3S1QI 1NJI2 2JS4A 4NBDA 2NAPA 1YIJ1 3CC7Z 3CCE1 2ZAEB 4HGYA 2QEXZ 4A3MI 1TWGI 2NVQI 1USPA 2M6NA 1QVGZ 1K9M1 2WB1A 3CMA1 1SFOI 1YIJZ 1P9NA 1TWCI 3S2HI 1N8R1 1AA6A 1ZH1A 3CXCY 2YADA 1YJ91 3BG0B 1M1K2 2QR1B 3MZLB 2V3VA 4Y52I 1X3WA 4MH4A 3CPWZ 1Q16A 3LUSA 1YJW1 3CMAZ 2RPRA 2LEXA 1YHQZ 5CM2M 1WW9A 2AYDA 1YIT1 4E31A 2OOYB 1YJ9Z 4BBSI 2VPXA 4TNUA 3F3FC 4NFRA 4A3II 1Q7Y2 2RBLA 5A2Qb 1YJWZ 3S14I 1YJN1 3RZDI 4A3LI 4NOZA 4DGLA 1YITZ 2E2II 4MXUA 3H3VJ 3GTQI 1USPB 3S15I 3CQZI 3IF8A 3G711 3CCS1 3NDIA 2YU9I 3FKII 3CC21 1YJNZ 2VPZA 3J7A4 4NBAA 4A3KI 2Y0SA 4QTUA 3GTGI 3JAMf 3I4NI 5D1OA 1RO2A 3M4OI 4NBHA 3G71Z 3CCSZ 4E30A 1M901 1Q812 1QVFZ 2M48A 3J81f 3P5JB 1NJI1 3ESWA 1KQSZ 3GTMS 4NBBA 2QLVB 1KRLA 3IX0A 1K732 4A3CI 1Y8CA 3MONA 1VLAA 3S1NI 4S1TA 3CCV1 5C44I 2NVYI 2OTL1 1KC82 4CL1A 4NBFA 3QWUA 2Q51A 3CCR1 1Q822 3HOXI 1Y1VI 3GTLI 2K5RA 2JA8I 1YUAA 1ML8A 3NH5A 3GTMI 3EEDA 1M1K1 2I3CA 4NBCA 2GU2A 4DK1A 3CCVZ 5D1OB 3GTPI 2OTLZ 1K8A2 2VPWA 4NH1C 1QVGY 4EWCA 1Z03A 1K83I 1WCMI 3S2DI 1VQN1 2E2JI 1RO0A 2O53A 2WAQA 1Q7Y1 3CCEZ 4A3FI 1VQ71 2QA41 3CPWY 1KD12 2HU9A 3J80f 3VB9A 2F4OA 5C3EI 1SIWA 1VQNZ 2LFUA 1I6HI 1FDIA 3GTKI 3OW2Y 4MD7A 1Q862 1YI21 3NFZA 3RZOI 1VQ91 3D6WA 4NBEA 3HOVI 4BY7I 2E7ZA 1VQ7Z 2DE5A 2QA4Z 4MD8A 1RLYA 3CC41 3NH8A 3CCL1 1VQM1 4E2XA 3BG1B 2K3RA 1VQK1 1JJ2Z 2QREB 2IV2X 3EERA 1YUKA 3HOUI 2GTIA 3VMGA 2VF1A 3MZKB 1YI2Z 2W03A 1VQ9Z 2JA5I 2V8IA 1QXFA 3KIFA 1Q811 3CCLZ 1VQMZ 2OTJ1 2KI7B 1K9M2 1VQKZ 1FDOA 4E32A 2JIOA 3KIHA 4NB9A
chains in the Genus database with same CATH topology
2LIYA 3S1RI 1W2BZ 5FLMI 2BJOA 4XX2A 1TWAI 3CCJ1 3CCU1 1VQ41 1X0TA 1JWHC 1VQO1 2F4MA 3G6E1 1QVFY 3JAMb 1VQ61 2OTJZ 4RV9A 3GTJI 4A93I 5IP7I 1L1OC 3CCQ1 3CC2Z 3U50C 2RHBA 1I50I 1KQSY 3H0GI 3CCJZ 3CCUZ 1VQ4Z 2P3YA 2V8JA 4Y7NI 3NH4A 1VQOZ 3J81b 2IZ4A 1WIIA 3G6EZ 4E33A 3I551 1Y1VS 1VQ6Z 4E2YA 2KPIA 3CCM1 3CCQZ 2PK7A 2VUMI 1VQL1 1N2FA 5C4JI 1VQ81 3HOWI 1R9TI 2E9HA 2G2KA 2RT9A 3I55Z 3IFUA 5T6BA 3PO3I 1QF8A 3S1MI 3I561 3GCFA 3CCMZ 2GTHA 2E2HI 1KD11 2JMOA 1VQLZ 2J6AA 1VQ8Z 3VTNA 4RVFA 5FLXf 4RVHA 3M3YI 2OZKA 3FQQA 1Y1WI 2NVTI 1X3ZA 4RVGA 3CCRZ 4RS4A 5IT9f 2DE6A 1Q861 2HF1A 3NDJA 3I56Z 4A3JI 3HOZI 4BXXI 3PO2I 3I4MI 4NBGA 5T64A 1RQFA 1PFTA 1RO4A 1S7MA 2PM9A 3J80b 2VUGA 4RVDA 1I3QI 2PMZA 1ZB9A 2JNYA 4MONA 2Q4ZA 5IP9I 3CD61 3VMHA 1LQLA 1YHQ1 2R93I 1JJ2Y 2R6MA 4A3GI 1VQP1 3HOYI 3G4S1 3CXCZ 2V8KA 5D1PA 1Z01A 3CME1 1TWHI 3FQMA 2DE7A 3CD6Z 1ZB8A 3CC4Z 2QRDB 3K7AI 1VQPZ 3OW2Z 2H85A 3G4SZ 3GTOI 1QYPA 1W2BY 4X6AI 1N8R2 5A2Qf 3CMEZ 2R92I 4E2WA 4NB8A 2IZ3A 2RIQA 1TWFI 4QTTA 1K731 3D9XA 4A3BI 1DL6A 1NP6A 4MD9A 1KC81 3S16I 1Q821 4HH4A 5AN9F 5T67A 4HGZA 3Q87A 2QKDA 5C4XI 4A3DI 3PO3S 2EGTA 1TFIA 2JA6I 3TE5B 3F3PC 2JUBA 3I07A 3GKQA 4AYBA 1K8A1 4MRIA 2B63I 4E2ZA 2JA7I 5LL6f 4BY1I 1VQ51 2AKLA 2O4HA 3HKZA 4DQYB 3TDHB 4BBRI 1NUIA 2QRCB 1S721 4A3EI 2P28A 1VQ5Z 1RNIA 3VMIA 5FLXb 3CC71 1M902 3S17I 2QEX1 3T4NB 2NVXI 2R7ZI 1Z02A 5IT9b 1S72Z 2W04A 2JR6A 2OOXB 3S1QI 1NJI2 2JS4A 4NBDA 1YIJ1 3CC7Z 3CCE1 2ZAEB 4HGYA 2QEXZ 4A3MI 1TWGI 2NVQI 1USPA 2M6NA 1QVGZ 1K9M1 2WB1A 3CMA1 1SFOI 1YIJZ 1P9NA 1TWCI 3S2HI 1N8R1 1ZH1A 3CXCY 2YADA 1YJ91 3BG0B 1M1K2 2QR1B 3MZLB 4Y52I 1X3WA 4MH4A 3CPWZ 3LUSA 1YJW1 3CMAZ 2RPRA 1YHQZ 5CM2M 1WW9A 1YIT1 4E31A 2OOYB 1YJ9Z 4BBSI 4TNUA 4A3II 3F3FC 4NFRA 1Q7Y2 2RBLA 5A2Qb 1YJWZ 3S14I 1YJN1 3RZDI 4A3LI 4NOZA 4DGLA 1YITZ 2E2II 4MXUA 3H3VJ 3GTQI 1USPB 3S15I 3CQZI 3IF8A 3G711 3CCS1 3NDIA 2YU9I 3FKII 3CC21 1YJNZ 3J7A4 4NBAA 4A3KI 2Y0SA 4QTUA 3GTGI 3JAMf 3I4NI 5D1OA 1RO2A 3M4OI 4NBHA 3G71Z 3CCSZ 4E30A 1M901 1Q812 1QVFZ 2M48A 3J81f 3P5JB 1NJI1 3ESWA 1KQSZ 3GTMS 4NBBA 2QLVB 1KRLA 3IX0A 1K732 4A3CI 3MONA 1VLAA 3S1NI 4S1TA 3CCV1 5C44I 2NVYI 2OTL1 1KC82 4CL1A 4NBFA 3QWUA 2Q51A 3CCR1 1Q822 3HOXI 1Y1VI 3GTLI 2K5RA 2JA8I 1YUAA 1ML8A 3NH5A 3GTMI 3EEDA 1M1K1 2I3CA 4NBCA 2GU2A 4DK1A 3CCVZ 5D1OB 3GTPI 2OTLZ 1K8A2 4NH1C 1QVGY 4EWCA 1Z03A 1K83I 1WCMI 3S2DI 1VQN1 2E2JI 1RO0A 2O53A 2WAQA 1Q7Y1 3CCEZ 4A3FI 1VQ71 2QA41 3CPWY 1KD12 2HU9A 3J80f 3VB9A 2F4OA 5C3EI 1VQNZ 2LFUA 1I6HI 3GTKI 3OW2Y 4MD7A 1Q862 1YI21 3NFZA 3RZOI 1VQ91 3D6WA 4NBEA 3HOVI 4BY7I 1VQ7Z 2DE5A 2QA4Z 4MD8A 1RLYA 3CC41 3NH8A 3CCL1 1VQM1 4E2XA 3BG1B 2K3RA 1VQK1 1JJ2Z 2QREB 3EERA 1YUKA 3HOUI 2GTIA 3VMGA 2VF1A 3MZKB 1YI2Z 2W03A 1VQ9Z 2JA5I 2V8IA 3KIFA 1Q811 3CCLZ 1VQMZ 2OTJ1 2KI7B 1K9M2 1VQKZ 4E32A 3KIHA 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS4 A;  3S1R I;  3HOY I;  4NBD A;  5FLM I;  2BJO A;  4XX2 A;  1TWA I;  3GTM S;  4NBB A;  2F4M A;  4A3C I;  1TWH I;  4A3M I;  3GTJ I;  2DE7 A;  1TWG I;  1VLA A;  3S1N I;  4A93 I;  1ZB8 A;  5IP7 I;  1L1O C;  5C44 I;  2NVY I;  2NVQ I;  1USP A;  4NBF A;  3U50 C;  3K7A I;  1I50 I;  3GTO I;  3HOX I;  1SFO I;  1QYP A;  1Y1V I;  1TWC I;  3H0G I;  3S2H I;  4X6A I;  2P3Y A;  3GTL I;  2K5R A;  4Y7N I;  1YUA A;  2JA8 I;  1ML8 A;  3GTM I;  1Y1V S;  2R92 I;  4NB8 A;  4NBC A;  4QTT A;  1TWF I;  2KPI A;  4Y52 I;  1X3W A;  3GTP I;  2PK7 A;  4MH4 A;  2VUM I;  3LUS A;  1N2F A;  5C4J I;  3S1Q I;  4A3B I;  3HOW I;  1DL6 A;  1K83 I;  1WCM I;  1R9T I;  3S2D I;  5CM2 M;  1WW9 A;  3S16 I;  2E2J I;  3PO3 I;  4BBS I;  3S1M I;  3GCF A;  4A3I I;  3Q87 A;  5C4X I;  4A3F I;  2RBL A;  2E2H I;  3PO3 S;  4A3D I;  1TFI A;  2JA6 I;  2J6A A;  3S14 I;  3RZD I;  3VB9 A;  4A3L I;  2F4O A;  3I07 A;  5C3E I;  4NOZ A;  3M3Y I;  3GKQ A;  1Y1W I;  2E2I I;  3H3V J;  1I6H I;  2B63 I;  2NVT I;  3GTQ I;  1X3Z A;  3GTK I;  2DE6 A;  1USP B;  2HF1 A;  4A3J I;  3S15 I;  2JA7 I;  3HOZ I;  4BXX I;  3RZO I;  3CQZ I;  4BY1 I;  3D6W A;  4NBE A;  3HOV I;  4BY7 I;  2AKL A;  2DE5 A;  2YU9 I;  3PO2 I;  3I4M I;  4NBG A;  1RLY A;  3FKI I;  4BBR I;  1NUI A;  4NBA A;  1PFT A;  4A3E I;  4A3K I;  1RO4 A;  4QTU A;  3GTG I;  3EER A;  3HOU I;  3I4N I;  3VMG A;  3M4O I;  4NBH A;  2JA5 I;  3VMI A;  1I3Q I;  3S17 I;  1ZB9 A;  2JNY A;  2NVX I;  2R7Z I;  5IP9 I;  3VMH A;  1LQL A;  2R93 I;  4A3G I;  3ESW A;  2JR6 A;  4NB9 A; 
#chains in the Genus database with same CATH topology
 2LIY A;  3S1R I;  1W2B Z;  5FLM I;  2BJO A;  4XX2 A;  1TWA I;  3CCJ 1;  3D2L A;  3CCU 1;  1VQ4 1;  1X0T A;  1JWH C;  1VQO 1;  2F4M A;  3G6E 1;  1QVF Y;  3JAM b;  1VQ6 1;  2OTJ Z;  4RV9 A;  3GTJ I;  4A93 I;  5IP7 I;  1L1O C;  3CCQ 1;  3CC2 Z;  3U50 C;  2RHB A;  1I50 I;  1KQS Y;  3H0G I;  3CCJ Z;  3CCU Z;  1VQ4 Z;  2P3Y A;  2V8J A;  4Y7N I;  3NH4 A;  1VQO Z;  3J81 b;  2IZ4 A;  1WII A;  3G6E Z;  4E33 A;  3I55 1;  1Y1V S;  1VQ6 Z;  4E2Y A;  2KPI A;  3CCM 1;  3CCQ Z;  2PK7 A;  2VUM I;  1VQL 1;  1N2F A;  5C4J I;  1VQ8 1;  3HOW I;  1R9T I;  2E9H A;  2G2K A;  2RT9 A;  3I55 Z;  3IFU A;  5T6B A;  3PO3 I;  1QF8 A;  3S1M I;  3I56 1;  3GCF A;  3CCM Z;  2GTH A;  2E2H I;  1KD1 1;  2JMO A;  2JIM A;  1VQL Z;  2J6A A;  2JIP A;  1VQ8 Z;  2V45 A;  3VTN A;  4RVF A;  5FLX f;  4RVH A;  3M3Y I;  2OZK A;  3FQQ A;  1Y1W I;  2NVT I;  1X3Z A;  4RVG A;  3CCR Z;  4RS4 A;  5IT9 f;  2DE6 A;  1Q86 1;  2HF1 A;  3NDJ A;  3I56 Z;  4A3J I;  3HOZ I;  4BXX I;  3PO2 I;  3I4M I;  4NBG A;  5T64 A;  1RQF A;  1PFT A;  1RO4 A;  1S7M A;  2PM9 A;  3J80 b;  2VUG A;  4RVD A;  1I3Q I;  2PMZ A;  1ZB9 A;  2JNY A;  4MON A;  2Q4Z A;  5IP9 I;  3CD6 1;  3VMH A;  1LQL A;  1YHQ 1;  2R93 I;  1JJ2 Y;  2R6M A;  4A3G I;  1VQP 1;  3HOY I;  3G4S 1;  3CXC Z;  2V8K A;  5D1P A;  1Z01 A;  3CME 1;  1TWH I;  3FQM A;  2DE7 A;  3CD6 Z;  1ZB8 A;  3CC4 Z;  2QRD B;  3K7A I;  1VQP Z;  2VPY A;  3OW2 Z;  2H85 A;  3G4S Z;  3GTO I;  1QYP A;  1W2B Y;  4X6A I;  1N8R 2;  5A2Q f;  3CME Z;  2R92 I;  4E2W A;  4NB8 A;  2IZ3 A;  2RIQ A;  1TWF I;  4QTT A;  1K73 1;  3D9X A;  4A3B I;  1DL6 A;  1NP6 A;  4MD9 A;  1KC8 1;  3S16 I;  1Q82 1;  1WJ2 A;  4HH4 A;  5AN9 F;  2JIR A;  5T67 A;  4HGZ A;  3Q87 A;  2QKD A;  5C4X I;  4A3D I;  3PO3 S;  2EGT A;  1TFI A;  2JA6 I;  3TE5 B;  3F3P C;  2JUB A;  3I07 A;  3GKQ A;  4AYB A;  1K8A 1;  4MRI A;  2B63 I;  2JIQ A;  4E2Z A;  2JA7 I;  5LL6 f;  4BY1 I;  1VQ5 1;  2AKL A;  2O4H A;  3HKZ A;  3IR7 A;  4DQY B;  3TDH B;  4BBR I;  1NUI A;  2QRC B;  1S72 1;  4A3E I;  1WZN A;  2P28 A;  1VQ5 Z;  1RNI A;  3VMI A;  5FLX b;  3CC7 1;  1M90 2;  3S17 I;  2QEX 1;  3T4N B;  2NVX I;  2R7Z I;  1Z02 A;  5IT9 b;  1S72 Z;  2W04 A;  2JR6 A;  2OOX B;  3S1Q I;  1NJI 2;  2JS4 A;  4NBD A;  2NAP A;  1YIJ 1;  3CC7 Z;  3CCE 1;  2ZAE B;  4HGY A;  2QEX Z;  4A3M I;  1TWG I;  2NVQ I;  1USP A;  2M6N A;  1QVG Z;  1K9M 1;  2WB1 A;  3CMA 1;  1SFO I;  1YIJ Z;  1P9N A;  1TWC I;  3S2H I;  1N8R 1;  1AA6 A;  1ZH1 A;  3CXC Y;  2YAD A;  1YJ9 1;  3BG0 B;  1M1K 2;  2QR1 B;  3MZL B;  2V3V A;  4Y52 I;  1X3W A;  4MH4 A;  3CPW Z;  1Q16 A;  3LUS A;  1YJW 1;  3CMA Z;  2RPR A;  2LEX A;  1YHQ Z;  5CM2 M;  1WW9 A;  2AYD A;  1YIT 1;  4E31 A;  2OOY B;  1YJ9 Z;  4BBS I;  2VPX A;  4TNU A;  3F3F C;  4NFR A;  4A3I I;  1Q7Y 2;  2RBL A;  5A2Q b;  1YJW Z;  3S14 I;  1YJN 1;  3RZD I;  4A3L I;  4NOZ A;  4DGL A;  1YIT Z;  2E2I I;  4MXU A;  3H3V J;  3GTQ I;  1USP B;  3S15 I;  3CQZ I;  3IF8 A;  3G71 1;  3CCS 1;  3NDI A;  2YU9 I;  3FKI I;  3CC2 1;  1YJN Z;  2VPZ A;  3J7A 4;  4NBA A;  4A3K I;  2Y0S A;  4QTU A;  3GTG I;  3JAM f;  3I4N I;  5D1O A;  1RO2 A;  3M4O I;  4NBH A;  3G71 Z;  3CCS Z;  4E30 A;  1M90 1;  1Q81 2;  1QVF Z;  2M48 A;  3J81 f;  3P5J B;  1NJI 1;  3ESW A;  1KQS Z;  3GTM S;  4NBB A;  2QLV B;  1KRL A;  3IX0 A;  1K73 2;  4A3C I;  1Y8C A;  3MON A;  1VLA A;  3S1N I;  4S1T A;  3CCV 1;  5C44 I;  2NVY I;  2OTL 1;  1KC8 2;  4CL1 A;  4NBF A;  3QWU A;  2Q51 A;  3CCR 1;  1Q82 2;  3HOX I;  1Y1V I;  3GTL I;  2K5R A;  2JA8 I;  1YUA A;  1ML8 A;  3NH5 A;  3GTM I;  3EED A;  1M1K 1;  2I3C A;  4NBC A;  2GU2 A;  4DK1 A;  3CCV Z;  5D1O B;  3GTP I;  2OTL Z;  1K8A 2;  2VPW A;  4NH1 C;  1QVG Y;  4EWC A;  1Z03 A;  1K83 I;  1WCM I;  3S2D I;  1VQN 1;  2E2J I;  1RO0 A;  2O53 A;  2WAQ A;  1Q7Y 1;  3CCE Z;  4A3F I;  1VQ7 1;  2QA4 1;  3CPW Y;  1KD1 2;  2HU9 A;  3J80 f;  3VB9 A;  2F4O A;  5C3E I;  1SIW A;  1VQN Z;  2LFU A;  1I6H I;  1FDI A;  3GTK I;  3OW2 Y;  4MD7 A;  1Q86 2;  1YI2 1;  3NFZ A;  3RZO I;  1VQ9 1;  3D6W A;  4NBE A;  3HOV I;  4BY7 I;  2E7Z A;  1VQ7 Z;  2DE5 A;  2QA4 Z;  4MD8 A;  1RLY A;  3CC4 1;  3NH8 A;  3CCL 1;  1VQM 1;  4E2X A;  3BG1 B;  2K3R A;  1VQK 1;  1JJ2 Z;  2QRE B;  2IV2 X;  3EER A;  1YUK A;  3HOU I;  2GTI A;  3VMG A;  2VF1 A;  3MZK B;  1YI2 Z;  2W03 A;  1VQ9 Z;  2JA5 I;  2V8I A;  1QXF A;  3KIF A;  1Q81 1;  3CCL Z;  1VQM Z;  2OTJ 1;  2KI7 B;  1K9M 2;  1VQK Z;  1FDO A;  4E32 A;  2JIO A;  3KIH A;  4NB9 A; 
#chains in the Genus database with same CATH homology
 2LIY A;  3S1R I;  1W2B Z;  5FLM I;  2BJO A;  4XX2 A;  1TWA I;  3CCJ 1;  3CCU 1;  1VQ4 1;  1X0T A;  1JWH C;  1VQO 1;  2F4M A;  3G6E 1;  1QVF Y;  3JAM b;  1VQ6 1;  2OTJ Z;  4RV9 A;  3GTJ I;  4A93 I;  5IP7 I;  1L1O C;  3CCQ 1;  3CC2 Z;  3U50 C;  2RHB A;  1I50 I;  1KQS Y;  3H0G I;  3CCJ Z;  3CCU Z;  1VQ4 Z;  2P3Y A;  2V8J A;  4Y7N I;  3NH4 A;  1VQO Z;  3J81 b;  2IZ4 A;  1WII A;  3G6E Z;  4E33 A;  3I55 1;  1Y1V S;  1VQ6 Z;  4E2Y A;  2KPI A;  3CCM 1;  3CCQ Z;  2PK7 A;  2VUM I;  1VQL 1;  1N2F A;  5C4J I;  1VQ8 1;  3HOW I;  1R9T I;  2E9H A;  2G2K A;  2RT9 A;  3I55 Z;  3IFU A;  5T6B A;  3PO3 I;  1QF8 A;  3S1M I;  3I56 1;  3GCF A;  3CCM Z;  2GTH A;  2E2H I;  1KD1 1;  2JMO A;  1VQL Z;  2J6A A;  1VQ8 Z;  3VTN A;  4RVF A;  5FLX f;  4RVH A;  3M3Y I;  2OZK A;  3FQQ A;  1Y1W I;  2NVT I;  1X3Z A;  4RVG A;  3CCR Z;  4RS4 A;  5IT9 f;  2DE6 A;  1Q86 1;  2HF1 A;  3NDJ A;  3I56 Z;  4A3J I;  3HOZ I;  4BXX I;  3PO2 I;  3I4M I;  4NBG A;  5T64 A;  1RQF A;  1PFT A;  1RO4 A;  1S7M A;  2PM9 A;  3J80 b;  2VUG A;  4RVD A;  1I3Q I;  2PMZ A;  1ZB9 A;  2JNY A;  4MON A;  2Q4Z A;  5IP9 I;  3CD6 1;  3VMH A;  1LQL A;  1YHQ 1;  2R93 I;  1JJ2 Y;  2R6M A;  4A3G I;  1VQP 1;  3HOY I;  3G4S 1;  3CXC Z;  2V8K A;  5D1P A;  1Z01 A;  3CME 1;  1TWH I;  3FQM A;  2DE7 A;  3CD6 Z;  1ZB8 A;  3CC4 Z;  2QRD B;  3K7A I;  1VQP Z;  3OW2 Z;  2H85 A;  3G4S Z;  3GTO I;  1QYP A;  1W2B Y;  4X6A I;  1N8R 2;  5A2Q f;  3CME Z;  2R92 I;  4E2W A;  4NB8 A;  2IZ3 A;  2RIQ A;  1TWF I;  4QTT A;  1K73 1;  3D9X A;  4A3B I;  1DL6 A;  1NP6 A;  4MD9 A;  1KC8 1;  3S16 I;  1Q82 1;  4HH4 A;  5AN9 F;  5T67 A;  4HGZ A;  3Q87 A;  2QKD A;  5C4X I;  4A3D I;  3PO3 S;  2EGT A;  1TFI A;  2JA6 I;  3TE5 B;  3F3P C;  2JUB A;  3I07 A;  3GKQ A;  4AYB A;  1K8A 1;  4MRI A;  2B63 I;  4E2Z A;  2JA7 I;  5LL6 f;  4BY1 I;  1VQ5 1;  2AKL A;  2O4H A;  3HKZ A;  4DQY B;  3TDH B;  4BBR I;  1NUI A;  2QRC B;  1S72 1;  4A3E I;  2P28 A;  1VQ5 Z;  1RNI A;  3VMI A;  5FLX b;  3CC7 1;  1M90 2;  3S17 I;  2QEX 1;  3T4N B;  2NVX I;  2R7Z I;  1Z02 A;  5IT9 b;  1S72 Z;  2W04 A;  2JR6 A;  2OOX B;  3S1Q I;  1NJI 2;  2JS4 A;  4NBD A;  1YIJ 1;  3CC7 Z;  3CCE 1;  2ZAE B;  4HGY A;  2QEX Z;  4A3M I;  1TWG I;  2NVQ I;  1USP A;  2M6N A;  1QVG Z;  1K9M 1;  2WB1 A;  3CMA 1;  1SFO I;  1YIJ Z;  1P9N A;  1TWC I;  3S2H I;  1N8R 1;  1ZH1 A;  3CXC Y;  2YAD A;  1YJ9 1;  3BG0 B;  1M1K 2;  2QR1 B;  3MZL B;  4Y52 I;  1X3W A;  4MH4 A;  3CPW Z;  3LUS A;  1YJW 1;  3CMA Z;  2RPR A;  1YHQ Z;  5CM2 M;  1WW9 A;  1YIT 1;  4E31 A;  2OOY B;  1YJ9 Z;  4BBS I;  4TNU A;  4A3I I;  3F3F C;  4NFR A;  1Q7Y 2;  2RBL A;  5A2Q b;  1YJW Z;  3S14 I;  1YJN 1;  3RZD I;  4A3L I;  4NOZ A;  4DGL A;  1YIT Z;  2E2I I;  4MXU A;  3H3V J;  3GTQ I;  1USP B;  3S15 I;  3CQZ I;  3IF8 A;  3G71 1;  3CCS 1;  3NDI A;  2YU9 I;  3FKI I;  3CC2 1;  1YJN Z;  3J7A 4;  4NBA A;  4A3K I;  2Y0S A;  4QTU A;  3GTG I;  3JAM f;  3I4N I;  5D1O A;  1RO2 A;  3M4O I;  4NBH A;  3G71 Z;  3CCS Z;  4E30 A;  1M90 1;  1Q81 2;  1QVF Z;  2M48 A;  3J81 f;  3P5J B;  1NJI 1;  3ESW A;  1KQS Z;  3GTM S;  4NBB A;  2QLV B;  1KRL A;  3IX0 A;  1K73 2;  4A3C I;  3MON A;  1VLA A;  3S1N I;  4S1T A;  3CCV 1;  5C44 I;  2NVY I;  2OTL 1;  1KC8 2;  4CL1 A;  4NBF A;  3QWU A;  2Q51 A;  3CCR 1;  1Q82 2;  3HOX I;  1Y1V I;  3GTL I;  2K5R A;  2JA8 I;  1YUA A;  1ML8 A;  3NH5 A;  3GTM I;  3EED A;  1M1K 1;  2I3C A;  4NBC A;  2GU2 A;  4DK1 A;  3CCV Z;  5D1O B;  3GTP I;  2OTL Z;  1K8A 2;  4NH1 C;  1QVG Y;  4EWC A;  1Z03 A;  1K83 I;  1WCM I;  3S2D I;  1VQN 1;  2E2J I;  1RO0 A;  2O53 A;  2WAQ A;  1Q7Y 1;  3CCE Z;  4A3F I;  1VQ7 1;  2QA4 1;  3CPW Y;  1KD1 2;  2HU9 A;  3J80 f;  3VB9 A;  2F4O A;  5C3E I;  1VQN Z;  2LFU A;  1I6H I;  3GTK I;  3OW2 Y;  4MD7 A;  1Q86 2;  1YI2 1;  3NFZ A;  3RZO I;  1VQ9 1;  3D6W A;  4NBE A;  3HOV I;  4BY7 I;  1VQ7 Z;  2DE5 A;  2QA4 Z;  4MD8 A;  1RLY A;  3CC4 1;  3NH8 A;  3CCL 1;  1VQM 1;  4E2X A;  3BG1 B;  2K3R A;  1VQK 1;  1JJ2 Z;  2QRE B;  3EER A;  1YUK A;  3HOU I;  2GTI A;  3VMG A;  2VF1 A;  3MZK B;  1YI2 Z;  2W03 A;  1VQ9 Z;  2JA5 I;  2V8I A;  3KIF A;  1Q81 1;  3CCL Z;  1VQM Z;  2OTJ 1;  2KI7 B;  1K9M 2;  1VQK Z;  4E32 A;  3KIH A;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...