3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
1VQ41 3G6E1 3OW2Z 3CMAZ 1YJ91 1NJI1 3CCLZ 3CMEZ 1YI21 1M901 1K9M1 3CCMZ 3CD6Z 2QEX1 1VQO1 1K731 3CPWZ 1M1K2 1Q7Y1 3CCS1 1N8R1 3OW2Y 1VQM1 1VQKZ 1K8A2 2QA4Z 3CXCZ 1YJNZ 2OTJ1 1VQ7Z 3I561 1VQ5Z 2OTLZ 3CC2Z 1VQLZ 1Q821 1NJI2 3CCJ1 3CCU1 3CPWY 1Q862 1M902 3CC41 1K9M2 3CMA1 3CC7Z 1YHQZ 1KD12 1K732 3CCL1 3CCRZ 3G71Z 3CCM1 3CD61 1Q7Y2 3CCVZ 1N8R2 1VQ81 1KC82 1VQ4Z 1VQPZ 1KQSZ 1Q812 3G6EZ 1VQ61 3G4S1 1W2BZ 1YJ9Z 2QA41 1YJN1 1YIJ1 3CCQZ 1QVFZ 1VQ9Z 1S72Z 1VQNZ 1VQOZ 2OTL1 1YITZ 3CCEZ 3I55Z 1KQSY 3CCSZ 3CXCY 1VQMZ 1W2BY 3CC71 3CME1 1YJWZ 2OTJZ 1YHQ1 3G711 1JJ2Z 3CCJZ 3CCUZ 1VQP1 1VQK1 3CC4Z 1QVGZ 1YI2Z 1Q822 1VQ71 3CCQ1 2QEXZ 1Q861 1VQ51 3CC21 1VQL1 1VQ91 1KD11 1S721 1JJ2Y 1VQN1 1VQ8Z 1YIT1 3CCE1 3I551 1VQ6Z 3G4SZ 1M1K1 1KC81 1QVGY 3CCR1 1YJW1 3I56Z 1YIJZ 1QVFY 1K8A1 1Q811 3CCV1
chains in the Genus database with same CATH superfamily
2I3CA 4A3MI 3G6E1 4A3II 4MD7A 3HOUI 4RS4A 1YI21 3TE5B 4AYBA 5IP9I 3CCMZ 2R6MA 2OZKA 3HOXI 3GTQI 3S1NI 2B63I 3VMHA 5IT9b 1X0TA 1Q7Y1 3IX0A 5C4XI 3S14I 5T6BA 2BJOA 1RLYA 2E9HA 3ESWA 3RZOI 1VQ7Z 3GTPI 3S16I 2J6AA 1VQLZ 1Q821 1NJI2 3CPWY 2E7ZA 1Q862 2QRDB 3CC41 1WJ2A 2NAPA 3P5JB 2F4MA 2QRCB 2E2II 1JWHC 3G71Z 4NBHA 4S1TA 1KC82 2K5RA 4TNUA 1VQPZ 4NB9A 4E2ZA 3J7A4 2RBLA 3S1RI 3S17I 3LUSA 5C3EI 1YJN1 2YADA 3FQMA 3IFUA 1Y8CA 1VQOZ 2GU2A 3S1MI 3S15I 4E31A 4XX2A 1VQMZ 3GTKI 3VB9A 3NH5A 3HOVI 1ZB9A 3CME1 1TWAI 5FLXf 2G2KA 3NH8A 2JR6A 1KRLA 5FLMI 4BBRI 4NBAA 3QWUA 4A3DI 1S7MA 1Q861 1N2FA 1TFIA 3NDJA 3CC21 3GTMS 4RVHA 1VQ91 1S721 3CQZI 1VQ6Z 4A3FI 1KC81 2Q4ZA 4A3CI 3GCFA 5T64A 4NH1C 1YIJZ 5FLXb 1NUIA 2JNYA 1VQ41 3GTOI 4NBBA 2R93I 2DE5A 3CMAZ 3D2LA 2NVTI 3CCLZ 1M901 2JIMA 1K9M1 3GTJI 3CPWZ 2LIYA 4A3JI 1N8R1 2DE7A 3CXCZ 1WCMI 5D1OB 2OTJ1 3D6WA 1LQLA 4A93I 2AKLA 3I561 4NBFA 4DGLA 1VQ5Z 1QXFA 3J80f 3CCJ1 3CCU1 4MXUA 2W04A 1TWGI 1X3ZA 3GKQA 3CC7Z 1K732 1Y1WI 3CCM1 2V8IA 1Z03A 2VUGA 1VQ81 1SFOI 2AYDA 1Q812 3G6EZ 3M4OI 2PMZA 2R7ZI 2VPZA 2H85A 1USPA 4RV9A 2W03A 2PM9A 2EGTA 3JAMb 3GTMI 3J80b 4CL1A 3VTNA 1YITZ 3I55Z 2YU9I 4BXXI 4MONA 3CXCY 4NBEA 2RHBA 4NBGA 1YUAA 1W2BY 4HGZA 2O53A 5IP7I 3I4MI 3G711 5CM2M 2Q51A 2JA8I 1L1OC 5D1OA 3HOWI 4MH4A 1VQP1 1FDIA 2DE6A 2QR1B 1VQK1 4A3KI 3CC4Z 3D9XA 2VPWA 3HKZA 4QTTA 4BY1I 2QEXZ 1RNIA 1WW9A 1WIIA 1I3QI 2O4HA 2OOXB 1JJ2Y 1TWFI 4DK1A 4X6AI 3M3YI 1QVGY 3CCR1 1Q811 3CCV1 4NBCA 1Z02A 2LEXA 2VPXA 2JA5I 1ZH1A 3K7AI 1YJ91 1NP6A 1AA6A 1NJI1 3CMEZ 3CD6Z 2V8JA 3KIHA 4EWCA 1RO4A 1M1K2 3CCS1 2QLVB 3OW2Y 1K8A2 2QA4Z 1RO2A 3GTGI 4E2YA 2GTIA 2V8KA 1RO0A 3VMIA 2JIQA 1USPB 2JIPA 2QREB 2IV2X 2OTLZ 3J81f 3CC2Z 4E2XA 3GTLI 4MD8A 3PO2I 2IZ3A 2JUBA 3CMA1 1YHQZ 1KD12 3CCL1 1Q7Y2 4BBSI 4A3EI 1Z01A 1VQ4Z 3VMGA 4E2WA 3G4S1 1W2BZ 4E32A 2HU9A 3JAMf 3CCQZ 1X3WA 5C44I 3NH4A 4A3BI 5AN9F 3J81b 1VQNZ 4MRIA 2P3YA 4Y52I 3CCEZ 1KQSY 4DQYB 2NVYI 3CC71 4RVGA 1R9TI 1YJWZ 2OTJZ 2QKDA 3BG0B 5T67A 1JJ2Z 3F3PC 1WZNA 2WAQA 3CCJZ 2KI7B 3CCUZ 2JA7I 2LFUA 3NFZA 2V45A 4RVDA 1I50I 2PK7A 1QVGZ 1YI2Z 2IZ4A 1VQ71 1Y1VS 3S2HI 3RZDI 2NVQI 1VQL1 1KD11 1VQ8Z 2JMOA 1YIT1 3S2DI 1RQFA 3FQQA 1ZB8A 3I551 2Y0SA 3I07A 2RPRA 3MZKB 4Y7NI 4QTUA 3EERA 1Q16A 2F4OA 3HOZI 2JIOA 3OW2Z 4NB8A 5C4JI 1I6HI 2M6NA 4A3GI 3MONA 2QEX1 2NVXI 4E33A 1VQO1 1K731 2K3RA 4HH4A 2VF1A 3PO3S 4E30A 1SIWA 1VQM1 3Q87A 4NOZA 1VQKZ 1YJNZ 3TDHB 3S1QI 2V3VA 1DL6A 2KPIA 3IR7A 3EEDA 1ML8A 4MD9A 3NDIA 1M902 2JIRA 1K9M2 2JS4A 3CCRZ 5A2Qf 2VPYA 3CD61 3CCVZ 1VLAA 5LL6f 1N8R2 1KQSZ 1VQ61 1YJ9Z 2P28A 2QA41 1TWCI 3I4NI 1YIJ1 2JA6I 1Y1VI 2HF1A 1FDOA 4NFRA 4A3LI 1QVFZ 4HGYA 1VQ9Z 1QF8A 1S72Z 2OTL1 1TWHI 2M48A 3H3VJ 3CCSZ 2ZAEB 2E2HI 1QYPA 1YHQ1 2RIQA 5A2Qb 2WB1A 5D1PA 1K83I 3KIFA 2GTHA 3H0GI 3U50C 2R92I 1P9NA 2RT9A 3HOYI 4RVFA 1Q822 3CCQ1 1VQ51 2OOYB 1VQN1 3PO3I 3T4NB 5IT9f 3IF8A 4BY7I 4NBDA 3CCE1 3G4SZ 1M1K1 1PFTA 3MZLB 3BG1B 1YJW1 1YUKA 2E2JI 3I56Z 1QVFY 3FKII 1K8A1 2VUMI 3F3FC
chains in the Genus database with same CATH topology
2I3CA 4A3MI 3G6E1 4A3II 4MD7A 3HOUI 4RS4A 1YI21 3TE5B 4AYBA 5IP9I 3CCMZ 2R6MA 2OZKA 3HOXI 3GTQI 3S1NI 2B63I 3VMHA 5IT9b 1X0TA 1Q7Y1 3IX0A 5C4XI 3S14I 5T6BA 2BJOA 1RLYA 2E9HA 3ESWA 3RZOI 1VQ7Z 3GTPI 3S16I 2J6AA 1VQLZ 1Q821 1NJI2 3CPWY 1Q862 2QRDB 3CC41 3P5JB 2F4MA 2QRCB 2E2II 1JWHC 3G71Z 4NBHA 4S1TA 1KC82 2K5RA 4TNUA 1VQPZ 4NB9A 4E2ZA 3J7A4 2RBLA 3S1RI 3S17I 3LUSA 5C3EI 1YJN1 2YADA 3FQMA 3IFUA 1VQOZ 2GU2A 3S1MI 3S15I 4E31A 4XX2A 1VQMZ 3GTKI 3VB9A 3NH5A 3HOVI 1ZB9A 3CME1 1TWAI 5FLXf 2G2KA 3NH8A 2JR6A 1KRLA 5FLMI 4BBRI 4NBAA 3QWUA 4A3DI 1S7MA 1Q861 1N2FA 1TFIA 3NDJA 3CC21 3GTMS 4RVHA 1VQ91 1S721 3CQZI 1VQ6Z 4A3FI 1KC81 2Q4ZA 4A3CI 3GCFA 5T64A 4NH1C 1YIJZ 5FLXb 1NUIA 2JNYA 1VQ41 3GTOI 4NBBA 2R93I 2DE5A 3CMAZ 2NVTI 3CCLZ 1M901 1K9M1 3GTJI 3CPWZ 2LIYA 4A3JI 1N8R1 2DE7A 3CXCZ 1WCMI 5D1OB 2OTJ1 3D6WA 1LQLA 4A93I 2AKLA 3I561 4NBFA 4DGLA 1VQ5Z 3J80f 3CCJ1 3CCU1 4MXUA 2W04A 1TWGI 1X3ZA 3GKQA 3CC7Z 1K732 1Y1WI 3CCM1 2V8IA 1Z03A 2VUGA 1VQ81 1SFOI 1Q812 3G6EZ 3M4OI 2PMZA 2R7ZI 2H85A 1USPA 2W03A 2PM9A 2EGTA 4RV9A 3JAMb 3GTMI 3J80b 4CL1A 3VTNA 1YITZ 3I55Z 2YU9I 4BXXI 4MONA 3CXCY 4NBEA 2RHBA 4NBGA 1YUAA 1W2BY 4HGZA 2O53A 5IP7I 3I4MI 3G711 5CM2M 2Q51A 2JA8I 1L1OC 5D1OA 3HOWI 4MH4A 1VQP1 2DE6A 2QR1B 1VQK1 4A3KI 3CC4Z 3D9XA 3HKZA 4QTTA 4BY1I 2QEXZ 1RNIA 1WW9A 1WIIA 1I3QI 2O4HA 2OOXB 1JJ2Y 1TWFI 4DK1A 4X6AI 3M3YI 1QVGY 3CCR1 1Q811 3CCV1 4NBCA 1Z02A 2JA5I 1ZH1A 3K7AI 1YJ91 1NP6A 1NJI1 3CMEZ 3CD6Z 2V8JA 3KIHA 4EWCA 1RO4A 1M1K2 3CCS1 2QLVB 3OW2Y 1K8A2 2QA4Z 1RO2A 3GTGI 4E2YA 2GTIA 2V8KA 1RO0A 3VMIA 1USPB 2QREB 2OTLZ 3J81f 3CC2Z 4E2XA 3GTLI 4MD8A 3PO2I 2IZ3A 2JUBA 3CMA1 1YHQZ 1KD12 3CCL1 1Q7Y2 4BBSI 4A3EI 1Z01A 1VQ4Z 3VMGA 4E2WA 3G4S1 1W2BZ 4E32A 2HU9A 3JAMf 3CCQZ 1X3WA 5C44I 3NH4A 4A3BI 5AN9F 3J81b 1VQNZ 4MRIA 2P3YA 4Y52I 3CCEZ 1KQSY 4DQYB 2NVYI 3CC71 4RVGA 1R9TI 1YJWZ 2OTJZ 2QKDA 3BG0B 5T67A 1JJ2Z 3F3PC 2WAQA 3CCJZ 2KI7B 3CCUZ 2JA7I 2LFUA 3NFZA 4RVDA 1I50I 2PK7A 1QVGZ 1YI2Z 2IZ4A 1VQ71 1Y1VS 3S2HI 3RZDI 2NVQI 1VQL1 1KD11 1VQ8Z 2JMOA 1YIT1 3S2DI 1RQFA 3FQQA 1ZB8A 3I551 2Y0SA 3I07A 2RPRA 3MZKB 4Y7NI 4QTUA 3EERA 2F4OA 3HOZI 3OW2Z 4NB8A 5C4JI 1I6HI 2M6NA 4A3GI 3MONA 2QEX1 2NVXI 4E33A 1VQO1 1K731 2K3RA 4HH4A 2VF1A 3PO3S 4E30A 1VQM1 3Q87A 4NOZA 1VQKZ 1YJNZ 3TDHB 3S1QI 1DL6A 2KPIA 3EEDA 1ML8A 4MD9A 3NDIA 1M902 1K9M2 2JS4A 3CCRZ 5A2Qf 3CD61 3CCVZ 1VLAA 5LL6f 1N8R2 1KQSZ 1VQ61 1YJ9Z 2P28A 2QA41 1TWCI 3I4NI 1YIJ1 2JA6I 1Y1VI 2HF1A 4NFRA 4A3LI 1QVFZ 4HGYA 1VQ9Z 1QF8A 1S72Z 2OTL1 1TWHI 2M48A 3H3VJ 3CCSZ 2ZAEB 2E2HI 1QYPA 1YHQ1 2RIQA 5A2Qb 2WB1A 5D1PA 1K83I 3KIFA 2GTHA 3H0GI 3U50C 2R92I 1P9NA 2RT9A 3HOYI 4RVFA 1Q822 3CCQ1 1VQ51 2OOYB 1VQN1 3PO3I 3T4NB 5IT9f 3IF8A 4BY7I 4NBDA 3CCE1 3G4SZ 1M1K1 1PFTA 3MZLB 3BG1B 1YJW1 1YUKA 2E2JI 3I56Z 1QVFY 3FKII 1K8A1 2VUMI 3F3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 1;  3G6E 1;  3OW2 Z;  3CMA Z;  1YJ9 1;  1NJI 1;  3CCL Z;  3CME Z;  1YI2 1;  1M90 1;  1K9M 1;  3CCM Z;  3CD6 Z;  2QEX 1;  1VQO 1;  1K73 1;  3CPW Z;  1M1K 2;  1Q7Y 1;  3CCS 1;  1N8R 1;  3OW2 Y;  1VQM 1;  1VQK Z;  1K8A 2;  2QA4 Z;  3CXC Z;  1YJN Z;  2OTJ 1;  1VQ7 Z;  3I56 1;  1VQ5 Z;  2OTL Z;  3CC2 Z;  1VQL Z;  1Q82 1;  1NJI 2;  3CCJ 1;  3CCU 1;  3CPW Y;  1Q86 2;  1M90 2;  3CC4 1;  1K9M 2;  3CMA 1;  3CC7 Z;  1YHQ Z;  1KD1 2;  1K73 2;  3CCL 1;  3CCR Z;  3G71 Z;  3CCM 1;  3CD6 1;  1Q7Y 2;  3CCV Z;  1N8R 2;  1VQ8 1;  1KC8 2;  1VQ4 Z;  1VQP Z;  1KQS Z;  1Q81 2;  3G6E Z;  1VQ6 1;  3G4S 1;  1W2B Z;  1YJ9 Z;  2QA4 1;  1YJN 1;  1YIJ 1;  3CCQ Z;  1QVF Z;  1VQ9 Z;  1S72 Z;  1VQN Z;  1VQO Z;  2OTL 1;  1YIT Z;  3CCE Z;  3I55 Z;  1KQS Y;  3CCS Z;  3CXC Y;  1VQM Z;  1W2B Y;  3CC7 1;  3CME 1;  1YJW Z;  2OTJ Z;  1YHQ 1;  3G71 1;  1JJ2 Z;  3CCJ Z;  3CCU Z;  1VQP 1;  1VQK 1;  3CC4 Z;  1QVG Z;  1YI2 Z;  1Q82 2;  1VQ7 1;  3CCQ 1;  2QEX Z;  1Q86 1;  1VQ5 1;  3CC2 1;  1VQL 1;  1VQ9 1;  1KD1 1;  1S72 1;  1JJ2 Y;  1VQN 1;  1VQ8 Z;  1YIT 1;  3CCE 1;  3I55 1;  1VQ6 Z;  3G4S Z;  1M1K 1;  1KC8 1;  1QVG Y;  3CCR 1;  1YJW 1;  3I56 Z;  1YIJ Z;  1QVF Y;  1K8A 1;  1Q81 1;  3CCV 1; 
#chains in the Genus database with same CATH topology
 2I3C A;  4A3M I;  3G6E 1;  4A3I I;  4MD7 A;  3HOU I;  4RS4 A;  1YI2 1;  3TE5 B;  4AYB A;  5IP9 I;  3CCM Z;  2R6M A;  2OZK A;  3HOX I;  3GTQ I;  3S1N I;  2B63 I;  3VMH A;  5IT9 b;  1X0T A;  1Q7Y 1;  3IX0 A;  5C4X I;  3S14 I;  5T6B A;  2BJO A;  1RLY A;  2E9H A;  3ESW A;  3RZO I;  1VQ7 Z;  3GTP I;  3S16 I;  2J6A A;  1VQL Z;  1Q82 1;  1NJI 2;  3CPW Y;  2E7Z A;  1Q86 2;  2QRD B;  3CC4 1;  1WJ2 A;  2NAP A;  3P5J B;  2F4M A;  2QRC B;  2E2I I;  1JWH C;  3G71 Z;  4NBH A;  4S1T A;  1KC8 2;  2K5R A;  4TNU A;  1VQP Z;  4NB9 A;  4E2Z A;  3J7A 4;  2RBL A;  3S1R I;  3S17 I;  3LUS A;  5C3E I;  1YJN 1;  2YAD A;  3FQM A;  3IFU A;  1Y8C A;  1VQO Z;  2GU2 A;  3S1M I;  3S15 I;  4E31 A;  4XX2 A;  1VQM Z;  3GTK I;  3VB9 A;  3NH5 A;  3HOV I;  1ZB9 A;  3CME 1;  1TWA I;  5FLX f;  2G2K A;  3NH8 A;  2JR6 A;  1KRL A;  5FLM I;  4BBR I;  4NBA A;  3QWU A;  4A3D I;  1S7M A;  1Q86 1;  1N2F A;  1TFI A;  3NDJ A;  3CC2 1;  3GTM S;  4RVH A;  1VQ9 1;  1S72 1;  3CQZ I;  1VQ6 Z;  4A3F I;  1KC8 1;  2Q4Z A;  4A3C I;  3GCF A;  5T64 A;  4NH1 C;  1YIJ Z;  5FLX b;  1NUI A;  2JNY A;  1VQ4 1;  3GTO I;  4NBB A;  2R93 I;  2DE5 A;  3CMA Z;  3D2L A;  2NVT I;  3CCL Z;  1M90 1;  2JIM A;  1K9M 1;  3GTJ I;  3CPW Z;  2LIY A;  4A3J I;  1N8R 1;  2DE7 A;  3CXC Z;  1WCM I;  5D1O B;  2OTJ 1;  3D6W A;  1LQL A;  4A93 I;  2AKL A;  3I56 1;  4NBF A;  4DGL A;  1VQ5 Z;  1QXF A;  3J80 f;  3CCJ 1;  3CCU 1;  4MXU A;  2W04 A;  1TWG I;  1X3Z A;  3GKQ A;  3CC7 Z;  1K73 2;  1Y1W I;  3CCM 1;  2V8I A;  1Z03 A;  2VUG A;  1VQ8 1;  1SFO I;  2AYD A;  1Q81 2;  3G6E Z;  3M4O I;  2PMZ A;  2R7Z I;  2VPZ A;  2H85 A;  1USP A;  4RV9 A;  2W03 A;  2PM9 A;  2EGT A;  3JAM b;  3GTM I;  3J80 b;  4CL1 A;  3VTN A;  1YIT Z;  3I55 Z;  2YU9 I;  4BXX I;  4MON A;  3CXC Y;  4NBE A;  2RHB A;  4NBG A;  1YUA A;  1W2B Y;  4HGZ A;  2O53 A;  5IP7 I;  3I4M I;  3G71 1;  5CM2 M;  2Q51 A;  2JA8 I;  1L1O C;  5D1O A;  3HOW I;  4MH4 A;  1VQP 1;  1FDI A;  2DE6 A;  2QR1 B;  1VQK 1;  4A3K I;  3CC4 Z;  3D9X A;  2VPW A;  3HKZ A;  4QTT A;  4BY1 I;  2QEX Z;  1RNI A;  1WW9 A;  1WII A;  1I3Q I;  2O4H A;  2OOX B;  1JJ2 Y;  1TWF I;  4DK1 A;  4X6A I;  3M3Y I;  1QVG Y;  3CCR 1;  1Q81 1;  3CCV 1;  4NBC A;  1Z02 A;  2LEX A;  2VPX A;  2JA5 I;  1ZH1 A;  3K7A I;  1YJ9 1;  1NP6 A;  1AA6 A;  1NJI 1;  3CME Z;  3CD6 Z;  2V8J A;  3KIH A;  4EWC A;  1RO4 A;  1M1K 2;  3CCS 1;  2QLV B;  3OW2 Y;  1K8A 2;  2QA4 Z;  1RO2 A;  3GTG I;  4E2Y A;  2GTI A;  2V8K A;  1RO0 A;  3VMI A;  2JIQ A;  1USP B;  2JIP A;  2QRE B;  2IV2 X;  2OTL Z;  3J81 f;  3CC2 Z;  4E2X A;  3GTL I;  4MD8 A;  3PO2 I;  2IZ3 A;  2JUB A;  3CMA 1;  1YHQ Z;  1KD1 2;  3CCL 1;  1Q7Y 2;  4BBS I;  4A3E I;  1Z01 A;  1VQ4 Z;  3VMG A;  4E2W A;  3G4S 1;  1W2B Z;  4E32 A;  2HU9 A;  3JAM f;  3CCQ Z;  1X3W A;  5C44 I;  3NH4 A;  4A3B I;  5AN9 F;  3J81 b;  1VQN Z;  4MRI A;  2P3Y A;  4Y52 I;  3CCE Z;  1KQS Y;  4DQY B;  2NVY I;  3CC7 1;  4RVG A;  1R9T I;  1YJW Z;  2OTJ Z;  2QKD A;  3BG0 B;  5T67 A;  1JJ2 Z;  3F3P C;  1WZN A;  2WAQ A;  3CCJ Z;  2KI7 B;  3CCU Z;  2JA7 I;  2LFU A;  3NFZ A;  2V45 A;  4RVD A;  1I50 I;  2PK7 A;  1QVG Z;  1YI2 Z;  2IZ4 A;  1VQ7 1;  1Y1V S;  3S2H I;  3RZD I;  2NVQ I;  1VQL 1;  1KD1 1;  1VQ8 Z;  2JMO A;  1YIT 1;  3S2D I;  1RQF A;  3FQQ A;  1ZB8 A;  3I55 1;  2Y0S A;  3I07 A;  2RPR A;  3MZK B;  4Y7N I;  4QTU A;  3EER A;  1Q16 A;  2F4O A;  3HOZ I;  2JIO A;  3OW2 Z;  4NB8 A;  5C4J I;  1I6H I;  2M6N A;  4A3G I;  3MON A;  2QEX 1;  2NVX I;  4E33 A;  1VQO 1;  1K73 1;  2K3R A;  4HH4 A;  2VF1 A;  3PO3 S;  4E30 A;  1SIW A;  1VQM 1;  3Q87 A;  4NOZ A;  1VQK Z;  1YJN Z;  3TDH B;  3S1Q I;  2V3V A;  1DL6 A;  2KPI A;  3IR7 A;  3EED A;  1ML8 A;  4MD9 A;  3NDI A;  1M90 2;  2JIR A;  1K9M 2;  2JS4 A;  3CCR Z;  5A2Q f;  2VPY A;  3CD6 1;  3CCV Z;  1VLA A;  5LL6 f;  1N8R 2;  1KQS Z;  1VQ6 1;  1YJ9 Z;  2P28 A;  2QA4 1;  1TWC I;  3I4N I;  1YIJ 1;  2JA6 I;  1Y1V I;  2HF1 A;  1FDO A;  4NFR A;  4A3L I;  1QVF Z;  4HGY A;  1VQ9 Z;  1QF8 A;  1S72 Z;  2OTL 1;  1TWH I;  2M48 A;  3H3V J;  3CCS Z;  2ZAE B;  2E2H I;  1QYP A;  1YHQ 1;  2RIQ A;  5A2Q b;  2WB1 A;  5D1P A;  1K83 I;  3KIF A;  2GTH A;  3H0G I;  3U50 C;  2R92 I;  1P9N A;  2RT9 A;  3HOY I;  4RVF A;  1Q82 2;  3CCQ 1;  1VQ5 1;  2OOY B;  1VQN 1;  3PO3 I;  3T4N B;  5IT9 f;  3IF8 A;  4BY7 I;  4NBD A;  3CCE 1;  3G4S Z;  1M1K 1;  1PFT A;  3MZL B;  3BG1 B;  1YJW 1;  1YUK A;  2E2J I;  3I56 Z;  1QVF Y;  3FKI I;  1K8A 1;  2VUM I;  3F3F C; 
#chains in the Genus database with same CATH homology
 2I3C A;  4A3M I;  3G6E 1;  4A3I I;  4MD7 A;  3HOU I;  4RS4 A;  1YI2 1;  3TE5 B;  4AYB A;  5IP9 I;  3CCM Z;  2R6M A;  2OZK A;  3HOX I;  3GTQ I;  3S1N I;  2B63 I;  3VMH A;  5IT9 b;  1X0T A;  1Q7Y 1;  3IX0 A;  5C4X I;  3S14 I;  5T6B A;  2BJO A;  1RLY A;  2E9H A;  3ESW A;  3RZO I;  1VQ7 Z;  3GTP I;  3S16 I;  2J6A A;  1VQL Z;  1Q82 1;  1NJI 2;  3CPW Y;  1Q86 2;  2QRD B;  3CC4 1;  3P5J B;  2F4M A;  2QRC B;  2E2I I;  1JWH C;  3G71 Z;  4NBH A;  4S1T A;  1KC8 2;  2K5R A;  4TNU A;  1VQP Z;  4NB9 A;  4E2Z A;  3J7A 4;  2RBL A;  3S1R I;  3S17 I;  3LUS A;  5C3E I;  1YJN 1;  2YAD A;  3FQM A;  3IFU A;  1VQO Z;  2GU2 A;  3S1M I;  3S15 I;  4E31 A;  4XX2 A;  1VQM Z;  3GTK I;  3VB9 A;  3NH5 A;  3HOV I;  1ZB9 A;  3CME 1;  1TWA I;  5FLX f;  2G2K A;  3NH8 A;  2JR6 A;  1KRL A;  5FLM I;  4BBR I;  4NBA A;  3QWU A;  4A3D I;  1S7M A;  1Q86 1;  1N2F A;  1TFI A;  3NDJ A;  3CC2 1;  3GTM S;  4RVH A;  1VQ9 1;  1S72 1;  3CQZ I;  1VQ6 Z;  4A3F I;  1KC8 1;  2Q4Z A;  4A3C I;  3GCF A;  5T64 A;  4NH1 C;  1YIJ Z;  5FLX b;  1NUI A;  2JNY A;  1VQ4 1;  3GTO I;  4NBB A;  2R93 I;  2DE5 A;  3CMA Z;  2NVT I;  3CCL Z;  1M90 1;  1K9M 1;  3GTJ I;  3CPW Z;  2LIY A;  4A3J I;  1N8R 1;  2DE7 A;  3CXC Z;  1WCM I;  5D1O B;  2OTJ 1;  3D6W A;  1LQL A;  4A93 I;  2AKL A;  3I56 1;  4NBF A;  4DGL A;  1VQ5 Z;  3J80 f;  3CCJ 1;  3CCU 1;  4MXU A;  2W04 A;  1TWG I;  1X3Z A;  3GKQ A;  3CC7 Z;  1K73 2;  1Y1W I;  3CCM 1;  2V8I A;  1Z03 A;  2VUG A;  1VQ8 1;  1SFO I;  1Q81 2;  3G6E Z;  3M4O I;  2PMZ A;  2R7Z I;  2H85 A;  1USP A;  2W03 A;  2PM9 A;  2EGT A;  4RV9 A;  3JAM b;  3GTM I;  3J80 b;  4CL1 A;  3VTN A;  1YIT Z;  3I55 Z;  2YU9 I;  4BXX I;  4MON A;  3CXC Y;  4NBE A;  2RHB A;  4NBG A;  1YUA A;  1W2B Y;  4HGZ A;  2O53 A;  5IP7 I;  3I4M I;  3G71 1;  5CM2 M;  2Q51 A;  2JA8 I;  1L1O C;  5D1O A;  3HOW I;  4MH4 A;  1VQP 1;  2DE6 A;  2QR1 B;  1VQK 1;  4A3K I;  3CC4 Z;  3D9X A;  3HKZ A;  4QTT A;  4BY1 I;  2QEX Z;  1RNI A;  1WW9 A;  1WII A;  1I3Q I;  2O4H A;  2OOX B;  1JJ2 Y;  1TWF I;  4DK1 A;  4X6A I;  3M3Y I;  1QVG Y;  3CCR 1;  1Q81 1;  3CCV 1;  4NBC A;  1Z02 A;  2JA5 I;  1ZH1 A;  3K7A I;  1YJ9 1;  1NP6 A;  1NJI 1;  3CME Z;  3CD6 Z;  2V8J A;  3KIH A;  4EWC A;  1RO4 A;  1M1K 2;  3CCS 1;  2QLV B;  3OW2 Y;  1K8A 2;  2QA4 Z;  1RO2 A;  3GTG I;  4E2Y A;  2GTI A;  2V8K A;  1RO0 A;  3VMI A;  1USP B;  2QRE B;  2OTL Z;  3J81 f;  3CC2 Z;  4E2X A;  3GTL I;  4MD8 A;  3PO2 I;  2IZ3 A;  2JUB A;  3CMA 1;  1YHQ Z;  1KD1 2;  3CCL 1;  1Q7Y 2;  4BBS I;  4A3E I;  1Z01 A;  1VQ4 Z;  3VMG A;  4E2W A;  3G4S 1;  1W2B Z;  4E32 A;  2HU9 A;  3JAM f;  3CCQ Z;  1X3W A;  5C44 I;  3NH4 A;  4A3B I;  5AN9 F;  3J81 b;  1VQN Z;  4MRI A;  2P3Y A;  4Y52 I;  3CCE Z;  1KQS Y;  4DQY B;  2NVY I;  3CC7 1;  4RVG A;  1R9T I;  1YJW Z;  2OTJ Z;  2QKD A;  3BG0 B;  5T67 A;  1JJ2 Z;  3F3P C;  2WAQ A;  3CCJ Z;  2KI7 B;  3CCU Z;  2JA7 I;  2LFU A;  3NFZ A;  4RVD A;  1I50 I;  2PK7 A;  1QVG Z;  1YI2 Z;  2IZ4 A;  1VQ7 1;  1Y1V S;  3S2H I;  3RZD I;  2NVQ I;  1VQL 1;  1KD1 1;  1VQ8 Z;  2JMO A;  1YIT 1;  3S2D I;  1RQF A;  3FQQ A;  1ZB8 A;  3I55 1;  2Y0S A;  3I07 A;  2RPR A;  3MZK B;  4Y7N I;  4QTU A;  3EER A;  2F4O A;  3HOZ I;  3OW2 Z;  4NB8 A;  5C4J I;  1I6H I;  2M6N A;  4A3G I;  3MON A;  2QEX 1;  2NVX I;  4E33 A;  1VQO 1;  1K73 1;  2K3R A;  4HH4 A;  2VF1 A;  3PO3 S;  4E30 A;  1VQM 1;  3Q87 A;  4NOZ A;  1VQK Z;  1YJN Z;  3TDH B;  3S1Q I;  1DL6 A;  2KPI A;  3EED A;  1ML8 A;  4MD9 A;  3NDI A;  1M90 2;  1K9M 2;  2JS4 A;  3CCR Z;  5A2Q f;  3CD6 1;  3CCV Z;  1VLA A;  5LL6 f;  1N8R 2;  1KQS Z;  1VQ6 1;  1YJ9 Z;  2P28 A;  2QA4 1;  1TWC I;  3I4N I;  1YIJ 1;  2JA6 I;  1Y1V I;  2HF1 A;  4NFR A;  4A3L I;  1QVF Z;  4HGY A;  1VQ9 Z;  1QF8 A;  1S72 Z;  2OTL 1;  1TWH I;  2M48 A;  3H3V J;  3CCS Z;  2ZAE B;  2E2H I;  1QYP A;  1YHQ 1;  2RIQ A;  5A2Q b;  2WB1 A;  5D1P A;  1K83 I;  3KIF A;  2GTH A;  3H0G I;  3U50 C;  2R92 I;  1P9N A;  2RT9 A;  3HOY I;  4RVF A;  1Q82 2;  3CCQ 1;  1VQ5 1;  2OOY B;  1VQN 1;  3PO3 I;  3T4N B;  5IT9 f;  3IF8 A;  4BY7 I;  4NBD A;  3CCE 1;  3G4S Z;  1M1K 1;  1PFT A;  3MZL B;  3BG1 B;  1YJW 1;  1YUK A;  2E2J I;  3I56 Z;  1QVF Y;  3FKI I;  1K8A 1;  2VUM I;  3F3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...