3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
3CMEZ 1VQ71 3I551 1VQ5Z 3OW2Z 3CXCZ 3G71Z 1W2BZ 3CC21 3CC2Z 1YI21 2OTJ1 1YJWZ 1YJW1 1VQL1 3CMA1 1K8A1 3OW2Y 3CCJZ 3CXCY 1VQ6Z 1W2BY 1N8R2 1YJ91 3CPWY 1VQ4Z 1VQ41 1Q861 3CCR1 1VQ8Z 1VQM1 1M902 1Q862 3CME1 1VQ7Z 1N8R1 3CC4Z 1QVGY 1YJ9Z 1VQO1 1Q7Y2 1K9M1 1YHQ1 1YIJZ 1Q812 3CPWZ 1KD11 3G4SZ 3CD61 3CD6Z 3CCMZ 1M901 1VQN1 1VQ61 1YI2Z 3CCJ1 1KD12 3CCQZ 3CC71 1YJNZ 1QVGZ 1VQ51 1K731 1M1K2 3I561 1YJN1 1Q821 1YHQZ 3I55Z 1K9M2 3CMAZ 2QEX1 1VQNZ 2QEXZ 3CCV1 3CCS1 3G4S1 3CCRZ 1KC81 1VQ81 1QVFY 2OTJZ 1S72Z 3CCUZ 1VQP1 3G711 1NJI1 1K732 1YIT1 1K8A2 1M1K1 1QVFZ 3CCQ1 2OTL1 1VQLZ 3CCE1 3CCLZ 3CCEZ 1VQ9Z 1Q7Y1 1VQ91 3CCL1 3CCU1 1VQPZ 1YIJ1 1KQSZ 3G6E1 3G6EZ 1JJ2Z 1YITZ 3CCM1 1KC82 3CCSZ 3CC7Z 1VQOZ 1S721 1Q822 1KQSY 1VQMZ 2QA41 2QA4Z 1VQKZ 1VQK1 1JJ2Y 3CCVZ 3I56Z 3CC41 2OTLZ 1NJI2 1Q811
chains in the Genus database with same CATH superfamily
1JWHC 1VQ71 3J7A4 2BJOA 4E32A 3TE5B 1TWAI 1FDOA 3RZDI 4X6AI 1VQL1 2V8IA 3CMA1 2NVQI 3CCJZ 2VPWA 1VQ6Z 4A3KI 4AYBA 4E33A 3F3PC 3IFUA 4RVHA 2IV2X 1YJ91 1VQ4Z 1VQ41 1Y1VS 1M902 2WAQA 1Q862 3GCFA 3CME1 3S16I 2V45A 3J80b 2EGTA 4A3FI 1YHQ1 2PMZA 3G4SZ 2VPXA 3CCMZ 1M901 4NBFA 4E2YA 1VQN1 1YI2Z 4BY7I 2Y0SA 2J6AA 4NBHA 3CC71 4NH1C 4CL1A 1RO0A 1QVGZ 5CM2M 4NOZA 4A3EI 1LQLA 3J81b 2RT9A 2VPZA 2YU9I 2E2II 1Y1WI 3HOYI 2R92I 1K9M2 3NFZA 2LIYA 2RHBA 1QXFA 2F4OA 3CCS1 3HOXI 1KC81 1QVFY 1FDIA 2KI7B 3H3VJ 2Q51A 1SFOI 3NH4A 2E7ZA 1VQP1 2OOYB 3M4OI 2JA8I 3VTNA 1QVFZ 1TWFI 3GTJI 3LUSA 1SIWA 2OTL1 1VQLZ 1I3QI 3CCE1 3CCLZ 3CCEZ 1VQ9Z 1Q7Y1 1VQ91 4NBEA 1Z01A 3NDIA 4NBCA 4NBGA 2JUBA 2LFUA 5FLXf 2W04A 1KC82 1PFTA 3CCSZ 1ZH1A 1S7MA 4MD7A 1VQMZ 2QA41 2QA4Z 3I56Z 4RS4A 3IF8A 3I4NI 2AYDA 5A2Qf 3OW2Z 2PK7A 1VLAA 3CXCZ 2JNYA 1TFIA 2JIOA 1N2FA 5D1OA 1YJWZ 1YJW1 1WZNA 2M6NA 5C4JI 2QRDB 2P28A 4HGYA 2V8KA 3HOWI 3OW2Y 2JIMA 2GTHA 2G2KA 2R6MA 1N8R2 3CPWY 5FLMI 4A3GI 1VQ8Z 1VQM1 3PO2I 1VQ7Z 1ZB9A 1N8R1 1YIJZ 1Q812 3CPWZ 1KD11 3CD61 3CD6Z 2K5RA 2WB1A 4A3CI 4MD8A 3CCJ1 3CCQZ 5T67A 2OZKA 4HGZA 4A3MI 2AKLA 3P5JB 3BG0B 1VQ51 2F4MA 1M1K2 4E2ZA 4QTTA 1YJN1 1Q821 2JA7I 2R7ZI 3RZOI 4A3BI 3I07A 3G4S1 1VQ81 1K83I 3GTLI 3S1RI 2RIQA 2NVTI 3S1NI 3F3FC 1RO2A 1S72Z 3CCUZ 3HOZI 3S1MI 1K732 1YIT1 1K8A2 3QWUA 4Y7NI 3CCQ1 2NAPA 4DK1A 5T64A 3K7AI 2RPRA 1ML8A 5C3EI 1WJ2A 4MXUA 3HKZA 5IT9f 1WIIA 2I3CA 3EEDA 3HOVI 5C4XI 5D1PA 2JA6I 3G6E1 3G6EZ 4QTUA 2HF1A 3CC7Z 2JS4A 2JA5I 3VB9A 4BXXI 3MZKB 2M48A 2OOXB 2P3YA 1VQKZ 3J80f 1VQK1 2V3VA 3CCVZ 5A2Qb 3CC41 2OTLZ 1Q811 2DE6A 2KPIA 1AA6A 3I551 1VQ5Z 1YUKA 4A3LI 4EWCA 3G71Z 4MD9A 3FKII 3ESWA 2VUGA 4E31A 3S1QI 2OTJ1 2QKDA 2O4HA 5FLXb 2V8JA 2QLVB 5C44I 2DE7A 3CXCY 4E30A 1WCMI 2QRCB 1YUAA 3CCR1 1Y1VI 4NB8A 5IP7I 3CC4Z 1VQO1 1Q16A 1K9M1 1NP6A 1VQ61 4A3II 1KD12 2VUMI 1X0TA 1YJNZ 3FQMA 4RVFA 3S17I 2K3RA 3I561 1Z02A 1YHQZ 4MH4A 4MRIA 3S14I 4RVDA 1TWCI 2VF1A 2QEX1 2QEXZ 1VQNZ 3H0GI 3CCV1 3CCRZ 4A3DI 3JAMb 2R93I 1RLYA 2JIRA 1X3WA 3D2LA 2B63I 3G711 2GU2A 3GTMS 1TWHI 3Q87A 3M3YI 3NH8A 4S1TA 2O53A 2GTIA 2E9HA 1ZB8A 3GTKI 3EERA 4A3JI 2JR6A 2E2JI 2YADA 3S2DI 2JMOA 4NFRA 3T4NB 1KRLA 1VQPZ 5IP9I 1YIJ1 1L1OC 4DQYB 1KQSZ 1USPB 1JJ2Z 3CCM1 2QREB 3HOUI 5IT9b 4MONA 1VQOZ 1S721 3NH5A 1Q822 2DE5A 1QF8A 2W03A 1Y8CA 1NJI2 3CMEZ 1X3ZA 5AN9F 2VPYA 4NBAA 2NVYI 1R9TI 1W2BZ 1WW9A 1RQFA 3KIHA 3CC2Z 3CC21 1YI21 3U50C 4A93I 1RNIA 4NBDA 1K8A1 1QYPA 1W2BY 3MZLB 2IZ4A 4RVGA 3TDHB 4XX2A 3S15I 4Y52I 2QR1B 1Q861 5T6BA 3PO3I 3CQZI 3NDJA 4NB9A 3D9XA 4DGLA 1USPA 1QVGY 1YJ9Z 1Q7Y2 1I6HI 3GTOI 1P9NA 3IX0A 3BG1B 3GTQI 2NVXI 2IZ3A 2H85A 4HH4A 1K731 2ZAEB 4BY1I 3JAMf 5D1OB 3I55Z 2RBLA 3J81f 3CMAZ 3GTPI 4BBSI 3GTGI 2HU9A 4TNUA 4BBRI 4E2XA 3PO3S 2OTJZ 3VMGA 1RO4A 2Q4ZA 3GKQA 3KIFA 1TWGI 4NBBA 2PM9A 1NJI1 1M1K1 3D6WA 4E2WA 3VMIA 2JIPA 3S2HI 2LEXA 1NUIA 1Z03A 2JIQA 3MONA 1I50I 3FQQA 3CCL1 3CCU1 3GTMI 4RV9A 1DL6A 1YITZ 3I4MI 1KQSY 1JJ2Y 5LL6f 3IR7A 2E2HI 3VMHA
chains in the Genus database with same CATH topology
1JWHC 1VQ71 3J7A4 2BJOA 4E32A 3TE5B 1TWAI 3RZDI 4X6AI 1VQL1 2V8IA 3CMA1 2NVQI 3CCJZ 1VQ6Z 4A3KI 4AYBA 4E33A 3F3PC 3IFUA 4RVHA 1YJ91 1VQ4Z 1VQ41 1Y1VS 1M902 2WAQA 1Q862 3GCFA 3CME1 3S16I 3J80b 2EGTA 4A3FI 1YHQ1 2PMZA 3G4SZ 4BY7I 3CCMZ 1M901 4NBFA 4E2YA 1VQN1 1YI2Z 2Y0SA 2J6AA 4NBHA 3CC71 4NH1C 4CL1A 1RO0A 1QVGZ 5CM2M 4NOZA 4A3EI 1LQLA 3J81b 2RT9A 2YU9I 2E2II 1Y1WI 3HOYI 2R92I 1K9M2 3NFZA 2LIYA 2RHBA 2F4OA 3CCS1 3HOXI 1KC81 1QVFY 2KI7B 3H3VJ 2Q51A 1SFOI 3NH4A 1VQP1 2OOYB 3M4OI 2JA8I 3VTNA 1QVFZ 1TWFI 3GTJI 3LUSA 2OTL1 1VQLZ 1I3QI 3CCE1 3CCLZ 3CCEZ 1VQ9Z 1Q7Y1 1VQ91 4NBEA 1Z01A 3NDIA 4NBCA 4NBGA 2JUBA 2LFUA 5FLXf 2W04A 1KC82 1PFTA 3CCSZ 1ZH1A 1S7MA 4MD7A 1VQMZ 2QA41 2QA4Z 3I56Z 4RS4A 3IF8A 3I4NI 5A2Qf 3OW2Z 2PK7A 1VLAA 3CXCZ 2JNYA 1TFIA 1N2FA 5D1OA 1YJWZ 1YJW1 2M6NA 5C4JI 2QRDB 2P28A 4HGYA 2V8KA 3HOWI 3OW2Y 2GTHA 2G2KA 2R6MA 1N8R2 3CPWY 5FLMI 4A3GI 1VQ8Z 1VQM1 3PO2I 1VQ7Z 1ZB9A 1N8R1 1YIJZ 1Q812 3CPWZ 1KD11 3CD61 3CD6Z 2K5RA 2WB1A 4A3CI 4MD8A 3CCJ1 3CCQZ 5T67A 2OZKA 4HGZA 4A3MI 2AKLA 3P5JB 3BG0B 1VQ51 2F4MA 1M1K2 4E2ZA 4QTTA 1YJN1 1Q821 2JA7I 2R7ZI 3RZOI 4A3BI 3I07A 3G4S1 1VQ81 1K83I 3GTLI 3S1RI 2RIQA 2NVTI 3S1NI 3F3FC 1RO2A 1S72Z 3CCUZ 3HOZI 3S1MI 1K732 1YIT1 1K8A2 3QWUA 4Y7NI 3CCQ1 4DK1A 5T64A 3K7AI 2RPRA 1ML8A 5C3EI 4MXUA 3HKZA 5IT9f 1WIIA 2I3CA 3EEDA 3HOVI 5C4XI 5D1PA 2JA6I 3G6E1 3G6EZ 4QTUA 2HF1A 3CC7Z 2JS4A 2JA5I 3VB9A 4BXXI 3MZKB 2M48A 2OOXB 2P3YA 1VQKZ 3J80f 1VQK1 3CCVZ 5A2Qb 3CC41 2OTLZ 1Q811 2DE6A 2KPIA 3I551 1VQ5Z 1YUKA 4A3LI 4EWCA 3G71Z 4MD9A 3FKII 3ESWA 2VUGA 4E31A 3S1QI 2OTJ1 2QKDA 2O4HA 5FLXb 2V8JA 2QLVB 5C44I 2DE7A 3CXCY 4E30A 1WCMI 2QRCB 1YUAA 3CCR1 1Y1VI 4NB8A 5IP7I 3CC4Z 1VQO1 1K9M1 1NP6A 1VQ61 4A3II 1KD12 2VUMI 1X0TA 1YJNZ 3FQMA 4RVFA 3S17I 2K3RA 3I561 1Z02A 1YHQZ 4MH4A 4MRIA 3S14I 4RVDA 1TWCI 2VF1A 2QEX1 2QEXZ 1VQNZ 3H0GI 3CCV1 3CCRZ 4A3DI 3JAMb 2R93I 1RLYA 2B63I 1X3WA 3G711 2GU2A 3GTMS 1TWHI 3Q87A 3M3YI 3NH8A 4S1TA 2O53A 2GTIA 2E9HA 1ZB8A 3GTKI 3EERA 4A3JI 2JR6A 2E2JI 2YADA 3S2DI 2JMOA 4NFRA 3T4NB 1KRLA 1VQPZ 5IP9I 1YIJ1 1L1OC 4DQYB 1KQSZ 1USPB 1JJ2Z 3CCM1 2QREB 3HOUI 5IT9b 4MONA 1VQOZ 1S721 3NH5A 1Q822 2DE5A 1QF8A 2W03A 1NJI2 3CMEZ 1X3ZA 5AN9F 4NBAA 2NVYI 1R9TI 1W2BZ 1WW9A 1RQFA 3KIHA 3CC2Z 3CC21 1YI21 3U50C 4A93I 1RNIA 4NBDA 1K8A1 1QYPA 1W2BY 3MZLB 2IZ4A 4RVGA 3TDHB 4XX2A 3S15I 4Y52I 2QR1B 1Q861 5T6BA 3PO3I 3CQZI 3NDJA 4NB9A 3D9XA 4DGLA 1USPA 1QVGY 1YJ9Z 1Q7Y2 1I6HI 3GTOI 1P9NA 3IX0A 3BG1B 3GTQI 2NVXI 2IZ3A 2H85A 4HH4A 1K731 2ZAEB 4BY1I 3JAMf 5D1OB 3I55Z 2RBLA 3J81f 3CMAZ 3GTPI 4BBSI 3GTGI 2HU9A 4TNUA 4BBRI 4E2XA 3PO3S 2OTJZ 3VMGA 1RO4A 2Q4ZA 3GKQA 3KIFA 1TWGI 4NBBA 2PM9A 1NJI1 1M1K1 3D6WA 4E2WA 3VMIA 3S2HI 1NUIA 1Z03A 3MONA 1I50I 3FQQA 3CCL1 3CCU1 3GTMI 4RV9A 1DL6A 1YITZ 3I4MI 1KQSY 1JJ2Y 5LL6f 2E2HI 3VMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Z;  1VQ7 1;  3I55 1;  1VQ5 Z;  3OW2 Z;  3CXC Z;  3G71 Z;  1W2B Z;  3CC2 1;  3CC2 Z;  1YI2 1;  2OTJ 1;  1YJW Z;  1YJW 1;  1VQL 1;  3CMA 1;  1K8A 1;  3OW2 Y;  3CCJ Z;  3CXC Y;  1VQ6 Z;  1W2B Y;  1N8R 2;  1YJ9 1;  3CPW Y;  1VQ4 Z;  1VQ4 1;  1Q86 1;  3CCR 1;  1VQ8 Z;  1VQM 1;  1M90 2;  1Q86 2;  3CME 1;  1VQ7 Z;  1N8R 1;  3CC4 Z;  1QVG Y;  1YJ9 Z;  1VQO 1;  1Q7Y 2;  1K9M 1;  1YHQ 1;  1YIJ Z;  1Q81 2;  3CPW Z;  1KD1 1;  3G4S Z;  3CD6 1;  3CD6 Z;  3CCM Z;  1M90 1;  1VQN 1;  1VQ6 1;  1YI2 Z;  3CCJ 1;  1KD1 2;  3CCQ Z;  3CC7 1;  1YJN Z;  1QVG Z;  1VQ5 1;  1K73 1;  1M1K 2;  3I56 1;  1YJN 1;  1Q82 1;  1YHQ Z;  3I55 Z;  1K9M 2;  3CMA Z;  2QEX 1;  1VQN Z;  2QEX Z;  3CCV 1;  3CCS 1;  3G4S 1;  3CCR Z;  1KC8 1;  1VQ8 1;  1QVF Y;  2OTJ Z;  1S72 Z;  3CCU Z;  1VQP 1;  3G71 1;  1NJI 1;  1K73 2;  1YIT 1;  1K8A 2;  1M1K 1;  1QVF Z;  3CCQ 1;  2OTL 1;  1VQL Z;  3CCE 1;  3CCL Z;  3CCE Z;  1VQ9 Z;  1Q7Y 1;  1VQ9 1;  3CCL 1;  3CCU 1;  1VQP Z;  1YIJ 1;  1KQS Z;  3G6E 1;  3G6E Z;  1JJ2 Z;  1YIT Z;  3CCM 1;  1KC8 2;  3CCS Z;  3CC7 Z;  1VQO Z;  1S72 1;  1Q82 2;  1KQS Y;  1VQM Z;  2QA4 1;  2QA4 Z;  1VQK Z;  1VQK 1;  1JJ2 Y;  3CCV Z;  3I56 Z;  3CC4 1;  2OTL Z;  1NJI 2;  1Q81 1; 
#chains in the Genus database with same CATH topology
 1JWH C;  1VQ7 1;  3J7A 4;  2BJO A;  4E32 A;  3TE5 B;  1TWA I;  1FDO A;  3RZD I;  4X6A I;  1VQL 1;  2V8I A;  3CMA 1;  2NVQ I;  3CCJ Z;  2VPW A;  1VQ6 Z;  4A3K I;  4AYB A;  4E33 A;  3F3P C;  3IFU A;  4RVH A;  2IV2 X;  1YJ9 1;  1VQ4 Z;  1VQ4 1;  1Y1V S;  1M90 2;  2WAQ A;  1Q86 2;  3GCF A;  3CME 1;  3S16 I;  2V45 A;  3J80 b;  2EGT A;  4A3F I;  1YHQ 1;  2PMZ A;  3G4S Z;  2VPX A;  3CCM Z;  1M90 1;  4NBF A;  4E2Y A;  1VQN 1;  1YI2 Z;  4BY7 I;  2Y0S A;  2J6A A;  4NBH A;  3CC7 1;  4NH1 C;  4CL1 A;  1RO0 A;  1QVG Z;  5CM2 M;  4NOZ A;  4A3E I;  1LQL A;  3J81 b;  2RT9 A;  2VPZ A;  2YU9 I;  2E2I I;  1Y1W I;  3HOY I;  2R92 I;  1K9M 2;  3NFZ A;  2LIY A;  2RHB A;  1QXF A;  2F4O A;  3CCS 1;  3HOX I;  1KC8 1;  1QVF Y;  1FDI A;  2KI7 B;  3H3V J;  2Q51 A;  1SFO I;  3NH4 A;  2E7Z A;  1VQP 1;  2OOY B;  3M4O I;  2JA8 I;  3VTN A;  1QVF Z;  1TWF I;  3GTJ I;  3LUS A;  1SIW A;  2OTL 1;  1VQL Z;  1I3Q I;  3CCE 1;  3CCL Z;  3CCE Z;  1VQ9 Z;  1Q7Y 1;  1VQ9 1;  4NBE A;  1Z01 A;  3NDI A;  4NBC A;  4NBG A;  2JUB A;  2LFU A;  5FLX f;  2W04 A;  1KC8 2;  1PFT A;  3CCS Z;  1ZH1 A;  1S7M A;  4MD7 A;  1VQM Z;  2QA4 1;  2QA4 Z;  3I56 Z;  4RS4 A;  3IF8 A;  3I4N I;  2AYD A;  5A2Q f;  3OW2 Z;  2PK7 A;  1VLA A;  3CXC Z;  2JNY A;  1TFI A;  2JIO A;  1N2F A;  5D1O A;  1YJW Z;  1YJW 1;  1WZN A;  2M6N A;  5C4J I;  2QRD B;  2P28 A;  4HGY A;  2V8K A;  3HOW I;  3OW2 Y;  2JIM A;  2GTH A;  2G2K A;  2R6M A;  1N8R 2;  3CPW Y;  5FLM I;  4A3G I;  1VQ8 Z;  1VQM 1;  3PO2 I;  1VQ7 Z;  1ZB9 A;  1N8R 1;  1YIJ Z;  1Q81 2;  3CPW Z;  1KD1 1;  3CD6 1;  3CD6 Z;  2K5R A;  2WB1 A;  4A3C I;  4MD8 A;  3CCJ 1;  3CCQ Z;  5T67 A;  2OZK A;  4HGZ A;  4A3M I;  2AKL A;  3P5J B;  3BG0 B;  1VQ5 1;  2F4M A;  1M1K 2;  4E2Z A;  4QTT A;  1YJN 1;  1Q82 1;  2JA7 I;  2R7Z I;  3RZO I;  4A3B I;  3I07 A;  3G4S 1;  1VQ8 1;  1K83 I;  3GTL I;  3S1R I;  2RIQ A;  2NVT I;  3S1N I;  3F3F C;  1RO2 A;  1S72 Z;  3CCU Z;  3HOZ I;  3S1M I;  1K73 2;  1YIT 1;  1K8A 2;  3QWU A;  4Y7N I;  3CCQ 1;  2NAP A;  4DK1 A;  5T64 A;  3K7A I;  2RPR A;  1ML8 A;  5C3E I;  1WJ2 A;  4MXU A;  3HKZ A;  5IT9 f;  1WII A;  2I3C A;  3EED A;  3HOV I;  5C4X I;  5D1P A;  2JA6 I;  3G6E 1;  3G6E Z;  4QTU A;  2HF1 A;  3CC7 Z;  2JS4 A;  2JA5 I;  3VB9 A;  4BXX I;  3MZK B;  2M48 A;  2OOX B;  2P3Y A;  1VQK Z;  3J80 f;  1VQK 1;  2V3V A;  3CCV Z;  5A2Q b;  3CC4 1;  2OTL Z;  1Q81 1;  2DE6 A;  2KPI A;  1AA6 A;  3I55 1;  1VQ5 Z;  1YUK A;  4A3L I;  4EWC A;  3G71 Z;  4MD9 A;  3FKI I;  3ESW A;  2VUG A;  4E31 A;  3S1Q I;  2OTJ 1;  2QKD A;  2O4H A;  5FLX b;  2V8J A;  2QLV B;  5C44 I;  2DE7 A;  3CXC Y;  4E30 A;  1WCM I;  2QRC B;  1YUA A;  3CCR 1;  1Y1V I;  4NB8 A;  5IP7 I;  3CC4 Z;  1VQO 1;  1Q16 A;  1K9M 1;  1NP6 A;  1VQ6 1;  4A3I I;  1KD1 2;  2VUM I;  1X0T A;  1YJN Z;  3FQM A;  4RVF A;  3S17 I;  2K3R A;  3I56 1;  1Z02 A;  1YHQ Z;  4MH4 A;  4MRI A;  3S14 I;  4RVD A;  1TWC I;  2VF1 A;  2QEX 1;  2QEX Z;  1VQN Z;  3H0G I;  3CCV 1;  3CCR Z;  4A3D I;  3JAM b;  2R93 I;  1RLY A;  2JIR A;  1X3W A;  3D2L A;  2B63 I;  3G71 1;  2GU2 A;  3GTM S;  1TWH I;  3Q87 A;  3M3Y I;  3NH8 A;  4S1T A;  2O53 A;  2GTI A;  2E9H A;  1ZB8 A;  3GTK I;  3EER A;  4A3J I;  2JR6 A;  2E2J I;  2YAD A;  3S2D I;  2JMO A;  4NFR A;  3T4N B;  1KRL A;  1VQP Z;  5IP9 I;  1YIJ 1;  1L1O C;  4DQY B;  1KQS Z;  1USP B;  1JJ2 Z;  3CCM 1;  2QRE B;  3HOU I;  5IT9 b;  4MON A;  1VQO Z;  1S72 1;  3NH5 A;  1Q82 2;  2DE5 A;  1QF8 A;  2W03 A;  1Y8C A;  1NJI 2;  3CME Z;  1X3Z A;  5AN9 F;  2VPY A;  4NBA A;  2NVY I;  1R9T I;  1W2B Z;  1WW9 A;  1RQF A;  3KIH A;  3CC2 Z;  3CC2 1;  1YI2 1;  3U50 C;  4A93 I;  1RNI A;  4NBD A;  1K8A 1;  1QYP A;  1W2B Y;  3MZL B;  2IZ4 A;  4RVG A;  3TDH B;  4XX2 A;  3S15 I;  4Y52 I;  2QR1 B;  1Q86 1;  5T6B A;  3PO3 I;  3CQZ I;  3NDJ A;  4NB9 A;  3D9X A;  4DGL A;  1USP A;  1QVG Y;  1YJ9 Z;  1Q7Y 2;  1I6H I;  3GTO I;  1P9N A;  3IX0 A;  3BG1 B;  3GTQ I;  2NVX I;  2IZ3 A;  2H85 A;  4HH4 A;  1K73 1;  2ZAE B;  4BY1 I;  3JAM f;  5D1O B;  3I55 Z;  2RBL A;  3J81 f;  3CMA Z;  3GTP I;  4BBS I;  3GTG I;  2HU9 A;  4TNU A;  4BBR I;  4E2X A;  3PO3 S;  2OTJ Z;  3VMG A;  1RO4 A;  2Q4Z A;  3GKQ A;  3KIF A;  1TWG I;  4NBB A;  2PM9 A;  1NJI 1;  1M1K 1;  3D6W A;  4E2W A;  3VMI A;  2JIP A;  3S2H I;  2LEX A;  1NUI A;  1Z03 A;  2JIQ A;  3MON A;  1I50 I;  3FQQ A;  3CCL 1;  3CCU 1;  3GTM I;  4RV9 A;  1DL6 A;  1YIT Z;  3I4M I;  1KQS Y;  1JJ2 Y;  5LL6 f;  3IR7 A;  2E2H I;  3VMH A; 
#chains in the Genus database with same CATH homology
 1JWH C;  1VQ7 1;  3J7A 4;  2BJO A;  4E32 A;  3TE5 B;  1TWA I;  3RZD I;  4X6A I;  1VQL 1;  2V8I A;  3CMA 1;  2NVQ I;  3CCJ Z;  1VQ6 Z;  4A3K I;  4AYB A;  4E33 A;  3F3P C;  3IFU A;  4RVH A;  1YJ9 1;  1VQ4 Z;  1VQ4 1;  1Y1V S;  1M90 2;  2WAQ A;  1Q86 2;  3GCF A;  3CME 1;  3S16 I;  3J80 b;  2EGT A;  4A3F I;  1YHQ 1;  2PMZ A;  3G4S Z;  4BY7 I;  3CCM Z;  1M90 1;  4NBF A;  4E2Y A;  1VQN 1;  1YI2 Z;  2Y0S A;  2J6A A;  4NBH A;  3CC7 1;  4NH1 C;  4CL1 A;  1RO0 A;  1QVG Z;  5CM2 M;  4NOZ A;  4A3E I;  1LQL A;  3J81 b;  2RT9 A;  2YU9 I;  2E2I I;  1Y1W I;  3HOY I;  2R92 I;  1K9M 2;  3NFZ A;  2LIY A;  2RHB A;  2F4O A;  3CCS 1;  3HOX I;  1KC8 1;  1QVF Y;  2KI7 B;  3H3V J;  2Q51 A;  1SFO I;  3NH4 A;  1VQP 1;  2OOY B;  3M4O I;  2JA8 I;  3VTN A;  1QVF Z;  1TWF I;  3GTJ I;  3LUS A;  2OTL 1;  1VQL Z;  1I3Q I;  3CCE 1;  3CCL Z;  3CCE Z;  1VQ9 Z;  1Q7Y 1;  1VQ9 1;  4NBE A;  1Z01 A;  3NDI A;  4NBC A;  4NBG A;  2JUB A;  2LFU A;  5FLX f;  2W04 A;  1KC8 2;  1PFT A;  3CCS Z;  1ZH1 A;  1S7M A;  4MD7 A;  1VQM Z;  2QA4 1;  2QA4 Z;  3I56 Z;  4RS4 A;  3IF8 A;  3I4N I;  5A2Q f;  3OW2 Z;  2PK7 A;  1VLA A;  3CXC Z;  2JNY A;  1TFI A;  1N2F A;  5D1O A;  1YJW Z;  1YJW 1;  2M6N A;  5C4J I;  2QRD B;  2P28 A;  4HGY A;  2V8K A;  3HOW I;  3OW2 Y;  2GTH A;  2G2K A;  2R6M A;  1N8R 2;  3CPW Y;  5FLM I;  4A3G I;  1VQ8 Z;  1VQM 1;  3PO2 I;  1VQ7 Z;  1ZB9 A;  1N8R 1;  1YIJ Z;  1Q81 2;  3CPW Z;  1KD1 1;  3CD6 1;  3CD6 Z;  2K5R A;  2WB1 A;  4A3C I;  4MD8 A;  3CCJ 1;  3CCQ Z;  5T67 A;  2OZK A;  4HGZ A;  4A3M I;  2AKL A;  3P5J B;  3BG0 B;  1VQ5 1;  2F4M A;  1M1K 2;  4E2Z A;  4QTT A;  1YJN 1;  1Q82 1;  2JA7 I;  2R7Z I;  3RZO I;  4A3B I;  3I07 A;  3G4S 1;  1VQ8 1;  1K83 I;  3GTL I;  3S1R I;  2RIQ A;  2NVT I;  3S1N I;  3F3F C;  1RO2 A;  1S72 Z;  3CCU Z;  3HOZ I;  3S1M I;  1K73 2;  1YIT 1;  1K8A 2;  3QWU A;  4Y7N I;  3CCQ 1;  4DK1 A;  5T64 A;  3K7A I;  2RPR A;  1ML8 A;  5C3E I;  4MXU A;  3HKZ A;  5IT9 f;  1WII A;  2I3C A;  3EED A;  3HOV I;  5C4X I;  5D1P A;  2JA6 I;  3G6E 1;  3G6E Z;  4QTU A;  2HF1 A;  3CC7 Z;  2JS4 A;  2JA5 I;  3VB9 A;  4BXX I;  3MZK B;  2M48 A;  2OOX B;  2P3Y A;  1VQK Z;  3J80 f;  1VQK 1;  3CCV Z;  5A2Q b;  3CC4 1;  2OTL Z;  1Q81 1;  2DE6 A;  2KPI A;  3I55 1;  1VQ5 Z;  1YUK A;  4A3L I;  4EWC A;  3G71 Z;  4MD9 A;  3FKI I;  3ESW A;  2VUG A;  4E31 A;  3S1Q I;  2OTJ 1;  2QKD A;  2O4H A;  5FLX b;  2V8J A;  2QLV B;  5C44 I;  2DE7 A;  3CXC Y;  4E30 A;  1WCM I;  2QRC B;  1YUA A;  3CCR 1;  1Y1V I;  4NB8 A;  5IP7 I;  3CC4 Z;  1VQO 1;  1K9M 1;  1NP6 A;  1VQ6 1;  4A3I I;  1KD1 2;  2VUM I;  1X0T A;  1YJN Z;  3FQM A;  4RVF A;  3S17 I;  2K3R A;  3I56 1;  1Z02 A;  1YHQ Z;  4MH4 A;  4MRI A;  3S14 I;  4RVD A;  1TWC I;  2VF1 A;  2QEX 1;  2QEX Z;  1VQN Z;  3H0G I;  3CCV 1;  3CCR Z;  4A3D I;  3JAM b;  2R93 I;  1RLY A;  2B63 I;  1X3W A;  3G71 1;  2GU2 A;  3GTM S;  1TWH I;  3Q87 A;  3M3Y I;  3NH8 A;  4S1T A;  2O53 A;  2GTI A;  2E9H A;  1ZB8 A;  3GTK I;  3EER A;  4A3J I;  2JR6 A;  2E2J I;  2YAD A;  3S2D I;  2JMO A;  4NFR A;  3T4N B;  1KRL A;  1VQP Z;  5IP9 I;  1YIJ 1;  1L1O C;  4DQY B;  1KQS Z;  1USP B;  1JJ2 Z;  3CCM 1;  2QRE B;  3HOU I;  5IT9 b;  4MON A;  1VQO Z;  1S72 1;  3NH5 A;  1Q82 2;  2DE5 A;  1QF8 A;  2W03 A;  1NJI 2;  3CME Z;  1X3Z A;  5AN9 F;  4NBA A;  2NVY I;  1R9T I;  1W2B Z;  1WW9 A;  1RQF A;  3KIH A;  3CC2 Z;  3CC2 1;  1YI2 1;  3U50 C;  4A93 I;  1RNI A;  4NBD A;  1K8A 1;  1QYP A;  1W2B Y;  3MZL B;  2IZ4 A;  4RVG A;  3TDH B;  4XX2 A;  3S15 I;  4Y52 I;  2QR1 B;  1Q86 1;  5T6B A;  3PO3 I;  3CQZ I;  3NDJ A;  4NB9 A;  3D9X A;  4DGL A;  1USP A;  1QVG Y;  1YJ9 Z;  1Q7Y 2;  1I6H I;  3GTO I;  1P9N A;  3IX0 A;  3BG1 B;  3GTQ I;  2NVX I;  2IZ3 A;  2H85 A;  4HH4 A;  1K73 1;  2ZAE B;  4BY1 I;  3JAM f;  5D1O B;  3I55 Z;  2RBL A;  3J81 f;  3CMA Z;  3GTP I;  4BBS I;  3GTG I;  2HU9 A;  4TNU A;  4BBR I;  4E2X A;  3PO3 S;  2OTJ Z;  3VMG A;  1RO4 A;  2Q4Z A;  3GKQ A;  3KIF A;  1TWG I;  4NBB A;  2PM9 A;  1NJI 1;  1M1K 1;  3D6W A;  4E2W A;  3VMI A;  3S2H I;  1NUI A;  1Z03 A;  3MON A;  1I50 I;  3FQQ A;  3CCL 1;  3CCU 1;  3GTM I;  4RV9 A;  1DL6 A;  1YIT Z;  3I4M I;  1KQS Y;  1JJ2 Y;  5LL6 f;  2E2H I;  3VMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...