3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
1NJI2 1NJI1 1YHQ1 3OW2Y 1Q822 1K731 1K9M1 3OW2Z 1Q862 3CCRZ 3CCQZ 1VQ5Z 2OTLZ 3I55Z 3CCE1 1YI21 2QEX1 1VQPZ 2QEXZ 3G711 3CC4Z 3CD6Z 3CCEZ 1K9M2 1VQMZ 3CCL1 2OTJ1 1VQP1 3G6EZ 3CCSZ 1YJNZ 1JJ2Y 3CCS1 1YJN1 1VQ91 1Q7Y1 1S721 1VQ9Z 1YIT1 1M902 1VQM1 1YITZ 1JJ2Z 1VQ61 1QVFZ 3CCU1 3CCR1 2QA41 3G71Z 3G4S1 3CC41 3CC2Z 1QVFY 3CMA1 1YHQZ 3CCV1 3CC7Z 1Q861 1VQ7Z 3CCM1 1K8A1 1VQNZ 1YJW1 3CCQ1 1KD12 1KD11 1VQL1 3CC21 3I551 3CC71 3CCLZ 3I56Z 1KC81 1YJWZ 3CCJ1 1W2BY 1VQ4Z 1VQKZ 3CCMZ 1YIJZ 3CD61 1KQSY 1W2BZ 1VQ8Z 1QVGY 1M901 3I561 1Q7Y2 1KQSZ 3CCJZ 1VQ41 1M1K2 1YI2Z 1QVGZ 1YIJ1 1VQLZ 1VQ51 2OTL1 1KC82 1VQ81 1S72Z 1YJ91 1VQ71 3G6E1 1VQK1 1K8A2 3CMAZ 1N8R1 3CXCY 3CCUZ 1Q812 1M1K1 1Q811 3G4SZ 2QA4Z 3CME1 3CXCZ 3CMEZ 1VQO1 1N8R2 1VQOZ 3CCVZ 3CPWY 1YJ9Z 1VQ6Z 1K732 2OTJZ 1Q821 3CPWZ 1VQN1
chains in the Genus database with same CATH superfamily
2OOYB 1RQFA 1WJ2A 2IZ4A 1Q822 1K731 1LQLA 2IZ3A 3H3VJ 5T6BA 3JAMb 4NB8A 4BY1I 3CCQZ 3GTJI 4BXXI 5IP7I 2DE6A 2F4MA 2H85A 3D2LA 3M3YI 3S17I 4MONA 2E7ZA 4A3FI 3CD6Z 2JIOA 3GTMI 1K9M2 2R92I 2OTJ1 4Y7NI 3Q87A 1N2FA 3NH5A 2JIMA 1JJ2Y 5A2Qf 3F3PC 2QLVB 2F4OA 2NVTI 1Q7Y1 4A3CI 1VQ9Z 2P28A 1QVFZ 1RNIA 2NVQI 2R93I 3G71Z 2AKLA 3CMA1 1R9TI 1RO4A 4E2XA 3MONA 4A3KI 5C44I 1VQ7Z 1VQNZ 2RPRA 4NBDA 3CC21 3J80f 4DQYB 2M6NA 3CC71 4MXUA 3TE5B 4MD8A 2JIPA 3I56Z 1YIJZ 2O53A 1W2BZ 4QTTA 3S2HI 1QVGY 3I561 4EWCA 1QF8A 4NH1C 2JR6A 1FDIA 1VQ71 1VQK1 2W04A 1KRLA 3S1RI 3J81b 1M1K1 4E31A 4NFRA 1Q811 3HOZI 5AN9F 3G4SZ 5IP9I 1N8R2 1VQOZ 3CPWY 3RZOI 1RO0A 3LUSA 4BY7I 2OTJZ 4A3LI 3GTGI 1NJI2 2LIYA 2LEXA 3S15I 4MRIA 5FLXb 3T4NB 5T64A 1K9M1 2VF1A 1X3WA 3S1MI 3OW2Z 2HU9A 2W03A 1Q862 3HOYI 3KIFA 3NDIA 2OTLZ 4RVHA 2RBLA 2QRCB 3ESWA 2PMZA 3CCE1 2E2HI 2RIQA 1RLYA 1YI21 1PFTA 1JWHC 5D1OA 4E32A 3CC4Z 3M4OI 2RT9A 4A3EI 3CCEZ 4E2WA 3GKQA 1Z02A 3G6EZ 3CCS1 1YJN1 3NFZA 3HOWI 1X0TA 1VQ91 1M902 3MZLB 1YITZ 1I3QI 1JJ2Z 5C3EI 3HOXI 2R7ZI 1TWAI 5CM2M 3CCU1 1NP6A 2K3RA 4DGLA 1Y8CA 2R6MA 1USPA 1YHQZ 3CC7Z 1Y1VS 3J80b 2PM9A 1KD11 3PO2I 1VQL1 1TWGI 4MH4A 4NB9A 2E2JI 4A3JI 3GCFA 3CCJ1 1VQ4Z 2KI7B 2QKDA 3BG1B 1KQSY 2E9HA 1X3ZA 3CCJZ 1VQ41 2DE5A 2JIRA 1QXFA 2OTL1 2YU9I 1KC82 3IF8A 2VUGA 1TWFI 1AA6A 4MD9A 2K5RA 2HF1A 4X6AI 1ML8A 3CXCY 2NAPA 2JUBA 2QA4Z 3CMEZ 1VQO1 1I6HI 3GTKI 1YJ9Z 4Y52I 3S1NI 3KIHA 4RV9A 1VQN1 3GTMS 4CL1A 1NJI1 3S2DI 3F3FC 3I4MI 2O4HA 2KPIA 3CCRZ 2ZAEB 2Q51A 1Y1VI 4NBGA 1Z01A 2VPXA 2Q4ZA 1P9NA 2JMOA 2QEX1 3VMGA 3TDHB 5FLMI 1QYPA 2QEXZ 1WIIA 4HGZA 3S1QI 2GTIA 5C4JI 4HH4A 5IT9b 4E2ZA 3CCSZ 1YJNZ 2QREB 3VTNA 1ZH1A 1YIT1 2LFUA 1VQM1 1VQ61 2JIQA 2EGTA 5D1OB 2WAQA 3NDJA 3CCR1 1DL6A 3U50C 3G4S1 3CC41 3CC2Z 1QVFY 3PO3I 4A3DI 4XX2A 3CCV1 2QRDB 3HOUI 3JAMf 3MZKB 1K8A1 2M48A 1KD12 1Y1WI 1Q16A 3FQQA 3I551 2JA8I 1YJWZ 5C4XI 1W2BY 3CCMZ 1YUAA 2JA7I 2GU2A 3FQMA 3CD61 4DK1A 3VB9A 1M901 2V8KA 1Q7Y2 1KQSZ 2V8IA 3PO3S 4TNUA 1QVGZ 3IFUA 1YIJ1 4RVGA 1VQ81 1RO2A 1S72Z 5IT9f 2Y0SA 1I50I 3GTQI 3G6E1 1NUIA 1K8A2 1S7MA 4S1TA 2DE7A 3CMAZ 1N8R1 1YUKA 4RS4A 3VMIA 3HKZA 4NBBA 3CME1 3S14I 1VQ6Z 4E33A 1Q821 1ZB8A 2B63I 3CPWZ 1K83I 2QR1B 3D9XA 3QWUA 1FDOA 5D1PA 1WW9A 3FKII 4A3GI 1SIWA 2JS4A 3EEDA 3RZDI 1YHQ1 3OW2Y 4A3MI 1USPB 2V45A 2GTHA 4RVFA 4A3BI 1ZB9A 1SFOI 1VQ5Z 1TWHI 4NBCA 3I55Z 2OOXB 3HOVI 1VQPZ 4NBAA 3G711 3J81f 3GTPI 2E2II 3H0GI 1VQMZ 3CCL1 2BJOA 4NBHA 4RVDA 1VQP1 1VLAA 4AYBA 3J7A4 3I07A 2OZKA 3CQZI 1S721 3VMHA 4NOZA 2YADA 2AYDA 2QA41 3P5JB 1WCMI 2V8JA 3I4NI 4A3II 2I3CA 2G2KA 1Q861 4E2YA 3CCM1 3IX0A 3CCQ1 1YJW1 4A93I 4NBFA 2RHBA 2VUMI 3CCLZ 1KC81 1VQKZ 2JNYA 4MD7A 1L1OC 1VQ8Z 2WB1A 1Z03A 4HGYA 1M1K2 1YI2Z 4BBSI 2JA6I 2JA5I 4BBRI 1VQLZ 1VQ51 3K7AI 2IV2X 1YJ91 4QTUA 3NH8A 3IR7A 2J6AA 3EERA 2VPYA 2NVYI 4E30A 2V3VA 2VPZA 3GTLI 2P3YA 2PK7A 3CCUZ 1Q812 2NVXI 5LL6f 1TFIA 3NH4A 2VPWA 3BG0B 3S16I 5T67A 3GTOI 4NBEA 3CXCZ 3CCVZ 5A2Qb 1K732 5FLXf 3D6WA 1WZNA 1TWCI
chains in the Genus database with same CATH topology
2OOYB 1RQFA 2IZ4A 1Q822 1K731 1LQLA 2IZ3A 3H3VJ 5T6BA 3JAMb 4NB8A 4BY1I 3CCQZ 3GTJI 4BXXI 5IP7I 2DE6A 2F4MA 2H85A 3M3YI 3S17I 4MONA 4A3FI 3CD6Z 3GTMI 1K9M2 2R92I 2OTJ1 4Y7NI 3Q87A 1N2FA 3NH5A 1JJ2Y 5A2Qf 3F3PC 2QLVB 2F4OA 2NVTI 1Q7Y1 4A3CI 1VQ9Z 2P28A 1QVFZ 1RNIA 2NVQI 2R93I 3G71Z 2AKLA 3CMA1 1R9TI 1RO4A 4E2XA 3MONA 4A3KI 5C44I 1VQ7Z 1VQNZ 2RPRA 4NBDA 3CC21 3J80f 4DQYB 2M6NA 3CC71 4MXUA 3TE5B 4MD8A 3I56Z 1YIJZ 2O53A 1W2BZ 4QTTA 3S2HI 1QVGY 3I561 4EWCA 1QF8A 4NH1C 2JR6A 1VQ71 1VQK1 2W04A 1KRLA 3S1RI 3J81b 1M1K1 4E31A 4NFRA 1Q811 3HOZI 5AN9F 3G4SZ 5IP9I 1N8R2 1VQOZ 3CPWY 3RZOI 1RO0A 3LUSA 4BY7I 2OTJZ 4A3LI 3GTGI 1NJI2 2LIYA 3S15I 4MRIA 5FLXb 3T4NB 5T64A 1K9M1 2VF1A 1X3WA 3S1MI 3OW2Z 2HU9A 2W03A 1Q862 3HOYI 3KIFA 3NDIA 2OTLZ 4RVHA 2RBLA 2QRCB 3ESWA 2PMZA 3CCE1 2E2HI 2RIQA 1RLYA 1YI21 1PFTA 1JWHC 5D1OA 4E32A 3CC4Z 3M4OI 2RT9A 4A3EI 3CCEZ 4E2WA 3GKQA 1Z02A 3G6EZ 3CCS1 1YJN1 3NFZA 3HOWI 1X0TA 1VQ91 1M902 3MZLB 1YITZ 1I3QI 1JJ2Z 5C3EI 3HOXI 2R7ZI 1TWAI 5CM2M 3CCU1 1NP6A 2K3RA 4DGLA 2R6MA 1USPA 1YHQZ 3CC7Z 1Y1VS 3J80b 2PM9A 1KD11 3PO2I 1VQL1 1TWGI 4MH4A 4NB9A 2E2JI 4A3JI 3GCFA 3CCJ1 1VQ4Z 2KI7B 2QKDA 3BG1B 1KQSY 2E9HA 1X3ZA 3CCJZ 1VQ41 2DE5A 2OTL1 2YU9I 1KC82 3IF8A 2VUGA 1TWFI 4MD9A 2K5RA 2HF1A 4X6AI 1ML8A 3CXCY 2JUBA 2QA4Z 3CMEZ 1VQO1 1I6HI 3GTKI 1YJ9Z 4Y52I 3S1NI 3KIHA 4RV9A 1VQN1 3GTMS 4CL1A 1NJI1 3S2DI 3F3FC 3I4MI 2O4HA 2KPIA 3CCRZ 2ZAEB 2Q51A 1Y1VI 4NBGA 1Z01A 2Q4ZA 1P9NA 2JMOA 2QEX1 3VMGA 3TDHB 5FLMI 1QYPA 2QEXZ 1WIIA 4HGZA 3S1QI 2GTIA 5C4JI 4HH4A 5IT9b 4E2ZA 3CCSZ 1YJNZ 2QREB 3VTNA 1ZH1A 1YIT1 2LFUA 1VQM1 1VQ61 2EGTA 5D1OB 2WAQA 3NDJA 3CCR1 1DL6A 3U50C 3G4S1 3CC41 3CC2Z 1QVFY 3PO3I 4A3DI 4XX2A 3CCV1 2QRDB 3HOUI 3JAMf 3MZKB 1K8A1 2M48A 1KD12 1Y1WI 3FQQA 3I551 2JA8I 1YJWZ 5C4XI 1W2BY 3CCMZ 1YUAA 2JA7I 2GU2A 3FQMA 3CD61 4DK1A 3VB9A 1M901 2V8KA 1Q7Y2 1KQSZ 2V8IA 3PO3S 4TNUA 1QVGZ 3IFUA 1YIJ1 4RVGA 1VQ81 1RO2A 1S72Z 5IT9f 2Y0SA 1I50I 3GTQI 3G6E1 1NUIA 1K8A2 1S7MA 4S1TA 2DE7A 3CMAZ 1N8R1 1YUKA 4RS4A 3VMIA 3HKZA 4NBBA 3CME1 3S14I 1VQ6Z 4E33A 1Q821 1ZB8A 2B63I 3CPWZ 1K83I 2QR1B 3D9XA 3QWUA 5D1PA 1WW9A 3FKII 4A3GI 3EEDA 2JS4A 3RZDI 1YHQ1 3OW2Y 4A3MI 1USPB 2GTHA 4RVFA 4A3BI 1ZB9A 1SFOI 1VQ5Z 1TWHI 4NBCA 3I55Z 2OOXB 3HOVI 1VQPZ 4NBAA 3G711 3J81f 3GTPI 2E2II 3H0GI 1VQMZ 3CCL1 2BJOA 4NBHA 4RVDA 1VQP1 1VLAA 4AYBA 3J7A4 3I07A 2OZKA 3CQZI 1S721 3VMHA 4NOZA 2YADA 2QA41 3P5JB 1WCMI 2V8JA 3I4NI 4A3II 2I3CA 2G2KA 1Q861 4E2YA 3CCM1 3IX0A 3CCQ1 1YJW1 4A93I 4NBFA 2RHBA 2VUMI 3CCLZ 1KC81 1VQKZ 2JNYA 4MD7A 1L1OC 1VQ8Z 2WB1A 1Z03A 4HGYA 1M1K2 1YI2Z 4BBSI 2JA6I 2JA5I 4BBRI 1VQLZ 1VQ51 3K7AI 1YJ91 4QTUA 3NH8A 2J6AA 3EERA 2NVYI 4E30A 3GTLI 2P3YA 2PK7A 3CCUZ 1Q812 2NVXI 5LL6f 1TFIA 3NH4A 3BG0B 3S16I 5T67A 3GTOI 4NBEA 3CXCZ 3CCVZ 5A2Qb 1K732 5FLXf 3D6WA 1TWCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 2;  1NJI 1;  1YHQ 1;  3OW2 Y;  1Q82 2;  1K73 1;  1K9M 1;  3OW2 Z;  1Q86 2;  3CCR Z;  3CCQ Z;  1VQ5 Z;  2OTL Z;  3I55 Z;  3CCE 1;  1YI2 1;  2QEX 1;  1VQP Z;  2QEX Z;  3G71 1;  3CC4 Z;  3CD6 Z;  3CCE Z;  1K9M 2;  1VQM Z;  3CCL 1;  2OTJ 1;  1VQP 1;  3G6E Z;  3CCS Z;  1YJN Z;  1JJ2 Y;  3CCS 1;  1YJN 1;  1VQ9 1;  1Q7Y 1;  1S72 1;  1VQ9 Z;  1YIT 1;  1M90 2;  1VQM 1;  1YIT Z;  1JJ2 Z;  1VQ6 1;  1QVF Z;  3CCU 1;  3CCR 1;  2QA4 1;  3G71 Z;  3G4S 1;  3CC4 1;  3CC2 Z;  1QVF Y;  3CMA 1;  1YHQ Z;  3CCV 1;  3CC7 Z;  1Q86 1;  1VQ7 Z;  3CCM 1;  1K8A 1;  1VQN Z;  1YJW 1;  3CCQ 1;  1KD1 2;  1KD1 1;  1VQL 1;  3CC2 1;  3I55 1;  3CC7 1;  3CCL Z;  3I56 Z;  1KC8 1;  1YJW Z;  3CCJ 1;  1W2B Y;  1VQ4 Z;  1VQK Z;  3CCM Z;  1YIJ Z;  3CD6 1;  1KQS Y;  1W2B Z;  1VQ8 Z;  1QVG Y;  1M90 1;  3I56 1;  1Q7Y 2;  1KQS Z;  3CCJ Z;  1VQ4 1;  1M1K 2;  1YI2 Z;  1QVG Z;  1YIJ 1;  1VQL Z;  1VQ5 1;  2OTL 1;  1KC8 2;  1VQ8 1;  1S72 Z;  1YJ9 1;  1VQ7 1;  3G6E 1;  1VQK 1;  1K8A 2;  3CMA Z;  1N8R 1;  3CXC Y;  3CCU Z;  1Q81 2;  1M1K 1;  1Q81 1;  3G4S Z;  2QA4 Z;  3CME 1;  3CXC Z;  3CME Z;  1VQO 1;  1N8R 2;  1VQO Z;  3CCV Z;  3CPW Y;  1YJ9 Z;  1VQ6 Z;  1K73 2;  2OTJ Z;  1Q82 1;  3CPW Z;  1VQN 1; 
#chains in the Genus database with same CATH topology
 2OOY B;  1RQF A;  1WJ2 A;  2IZ4 A;  1Q82 2;  1K73 1;  1LQL A;  2IZ3 A;  3H3V J;  5T6B A;  3JAM b;  4NB8 A;  4BY1 I;  3CCQ Z;  3GTJ I;  4BXX I;  5IP7 I;  2DE6 A;  2F4M A;  2H85 A;  3D2L A;  3M3Y I;  3S17 I;  4MON A;  2E7Z A;  4A3F I;  3CD6 Z;  2JIO A;  3GTM I;  1K9M 2;  2R92 I;  2OTJ 1;  4Y7N I;  3Q87 A;  1N2F A;  3NH5 A;  2JIM A;  1JJ2 Y;  5A2Q f;  3F3P C;  2QLV B;  2F4O A;  2NVT I;  1Q7Y 1;  4A3C I;  1VQ9 Z;  2P28 A;  1QVF Z;  1RNI A;  2NVQ I;  2R93 I;  3G71 Z;  2AKL A;  3CMA 1;  1R9T I;  1RO4 A;  4E2X A;  3MON A;  4A3K I;  5C44 I;  1VQ7 Z;  1VQN Z;  2RPR A;  4NBD A;  3CC2 1;  3J80 f;  4DQY B;  2M6N A;  3CC7 1;  4MXU A;  3TE5 B;  4MD8 A;  2JIP A;  3I56 Z;  1YIJ Z;  2O53 A;  1W2B Z;  4QTT A;  3S2H I;  1QVG Y;  3I56 1;  4EWC A;  1QF8 A;  4NH1 C;  2JR6 A;  1FDI A;  1VQ7 1;  1VQK 1;  2W04 A;  1KRL A;  3S1R I;  3J81 b;  1M1K 1;  4E31 A;  4NFR A;  1Q81 1;  3HOZ I;  5AN9 F;  3G4S Z;  5IP9 I;  1N8R 2;  1VQO Z;  3CPW Y;  3RZO I;  1RO0 A;  3LUS A;  4BY7 I;  2OTJ Z;  4A3L I;  3GTG I;  1NJI 2;  2LIY A;  2LEX A;  3S15 I;  4MRI A;  5FLX b;  3T4N B;  5T64 A;  1K9M 1;  2VF1 A;  1X3W A;  3S1M I;  3OW2 Z;  2HU9 A;  2W03 A;  1Q86 2;  3HOY I;  3KIF A;  3NDI A;  2OTL Z;  4RVH A;  2RBL A;  2QRC B;  3ESW A;  2PMZ A;  3CCE 1;  2E2H I;  2RIQ A;  1RLY A;  1YI2 1;  1PFT A;  1JWH C;  5D1O A;  4E32 A;  3CC4 Z;  3M4O I;  2RT9 A;  4A3E I;  3CCE Z;  4E2W A;  3GKQ A;  1Z02 A;  3G6E Z;  3CCS 1;  1YJN 1;  3NFZ A;  3HOW I;  1X0T A;  1VQ9 1;  1M90 2;  3MZL B;  1YIT Z;  1I3Q I;  1JJ2 Z;  5C3E I;  3HOX I;  2R7Z I;  1TWA I;  5CM2 M;  3CCU 1;  1NP6 A;  2K3R A;  4DGL A;  1Y8C A;  2R6M A;  1USP A;  1YHQ Z;  3CC7 Z;  1Y1V S;  3J80 b;  2PM9 A;  1KD1 1;  3PO2 I;  1VQL 1;  1TWG I;  4MH4 A;  4NB9 A;  2E2J I;  4A3J I;  3GCF A;  3CCJ 1;  1VQ4 Z;  2KI7 B;  2QKD A;  3BG1 B;  1KQS Y;  2E9H A;  1X3Z A;  3CCJ Z;  1VQ4 1;  2DE5 A;  2JIR A;  1QXF A;  2OTL 1;  2YU9 I;  1KC8 2;  3IF8 A;  2VUG A;  1TWF I;  1AA6 A;  4MD9 A;  2K5R A;  2HF1 A;  4X6A I;  1ML8 A;  3CXC Y;  2NAP A;  2JUB A;  2QA4 Z;  3CME Z;  1VQO 1;  1I6H I;  3GTK I;  1YJ9 Z;  4Y52 I;  3S1N I;  3KIH A;  4RV9 A;  1VQN 1;  3GTM S;  4CL1 A;  1NJI 1;  3S2D I;  3F3F C;  3I4M I;  2O4H A;  2KPI A;  3CCR Z;  2ZAE B;  2Q51 A;  1Y1V I;  4NBG A;  1Z01 A;  2VPX A;  2Q4Z A;  1P9N A;  2JMO A;  2QEX 1;  3VMG A;  3TDH B;  5FLM I;  1QYP A;  2QEX Z;  1WII A;  4HGZ A;  3S1Q I;  2GTI A;  5C4J I;  4HH4 A;  5IT9 b;  4E2Z A;  3CCS Z;  1YJN Z;  2QRE B;  3VTN A;  1ZH1 A;  1YIT 1;  2LFU A;  1VQM 1;  1VQ6 1;  2JIQ A;  2EGT A;  5D1O B;  2WAQ A;  3NDJ A;  3CCR 1;  1DL6 A;  3U50 C;  3G4S 1;  3CC4 1;  3CC2 Z;  1QVF Y;  3PO3 I;  4A3D I;  4XX2 A;  3CCV 1;  2QRD B;  3HOU I;  3JAM f;  3MZK B;  1K8A 1;  2M48 A;  1KD1 2;  1Y1W I;  1Q16 A;  3FQQ A;  3I55 1;  2JA8 I;  1YJW Z;  5C4X I;  1W2B Y;  3CCM Z;  1YUA A;  2JA7 I;  2GU2 A;  3FQM A;  3CD6 1;  4DK1 A;  3VB9 A;  1M90 1;  2V8K A;  1Q7Y 2;  1KQS Z;  2V8I A;  3PO3 S;  4TNU A;  1QVG Z;  3IFU A;  1YIJ 1;  4RVG A;  1VQ8 1;  1RO2 A;  1S72 Z;  5IT9 f;  2Y0S A;  1I50 I;  3GTQ I;  3G6E 1;  1NUI A;  1K8A 2;  1S7M A;  4S1T A;  2DE7 A;  3CMA Z;  1N8R 1;  1YUK A;  4RS4 A;  3VMI A;  3HKZ A;  4NBB A;  3CME 1;  3S14 I;  1VQ6 Z;  4E33 A;  1Q82 1;  1ZB8 A;  2B63 I;  3CPW Z;  1K83 I;  2QR1 B;  3D9X A;  3QWU A;  1FDO A;  5D1P A;  1WW9 A;  3FKI I;  4A3G I;  1SIW A;  2JS4 A;  3EED A;  3RZD I;  1YHQ 1;  3OW2 Y;  4A3M I;  1USP B;  2V45 A;  2GTH A;  4RVF A;  4A3B I;  1ZB9 A;  1SFO I;  1VQ5 Z;  1TWH I;  4NBC A;  3I55 Z;  2OOX B;  3HOV I;  1VQP Z;  4NBA A;  3G71 1;  3J81 f;  3GTP I;  2E2I I;  3H0G I;  1VQM Z;  3CCL 1;  2BJO A;  4NBH A;  4RVD A;  1VQP 1;  1VLA A;  4AYB A;  3J7A 4;  3I07 A;  2OZK A;  3CQZ I;  1S72 1;  3VMH A;  4NOZ A;  2YAD A;  2AYD A;  2QA4 1;  3P5J B;  1WCM I;  2V8J A;  3I4N I;  4A3I I;  2I3C A;  2G2K A;  1Q86 1;  4E2Y A;  3CCM 1;  3IX0 A;  3CCQ 1;  1YJW 1;  4A93 I;  4NBF A;  2RHB A;  2VUM I;  3CCL Z;  1KC8 1;  1VQK Z;  2JNY A;  4MD7 A;  1L1O C;  1VQ8 Z;  2WB1 A;  1Z03 A;  4HGY A;  1M1K 2;  1YI2 Z;  4BBS I;  2JA6 I;  2JA5 I;  4BBR I;  1VQL Z;  1VQ5 1;  3K7A I;  2IV2 X;  1YJ9 1;  4QTU A;  3NH8 A;  3IR7 A;  2J6A A;  3EER A;  2VPY A;  2NVY I;  4E30 A;  2V3V A;  2VPZ A;  3GTL I;  2P3Y A;  2PK7 A;  3CCU Z;  1Q81 2;  2NVX I;  5LL6 f;  1TFI A;  3NH4 A;  2VPW A;  3BG0 B;  3S16 I;  5T67 A;  3GTO I;  4NBE A;  3CXC Z;  3CCV Z;  5A2Q b;  1K73 2;  5FLX f;  3D6W A;  1WZN A;  1TWC I; 
#chains in the Genus database with same CATH homology
 2OOY B;  1RQF A;  2IZ4 A;  1Q82 2;  1K73 1;  1LQL A;  2IZ3 A;  3H3V J;  5T6B A;  3JAM b;  4NB8 A;  4BY1 I;  3CCQ Z;  3GTJ I;  4BXX I;  5IP7 I;  2DE6 A;  2F4M A;  2H85 A;  3M3Y I;  3S17 I;  4MON A;  4A3F I;  3CD6 Z;  3GTM I;  1K9M 2;  2R92 I;  2OTJ 1;  4Y7N I;  3Q87 A;  1N2F A;  3NH5 A;  1JJ2 Y;  5A2Q f;  3F3P C;  2QLV B;  2F4O A;  2NVT I;  1Q7Y 1;  4A3C I;  1VQ9 Z;  2P28 A;  1QVF Z;  1RNI A;  2NVQ I;  2R93 I;  3G71 Z;  2AKL A;  3CMA 1;  1R9T I;  1RO4 A;  4E2X A;  3MON A;  4A3K I;  5C44 I;  1VQ7 Z;  1VQN Z;  2RPR A;  4NBD A;  3CC2 1;  3J80 f;  4DQY B;  2M6N A;  3CC7 1;  4MXU A;  3TE5 B;  4MD8 A;  3I56 Z;  1YIJ Z;  2O53 A;  1W2B Z;  4QTT A;  3S2H I;  1QVG Y;  3I56 1;  4EWC A;  1QF8 A;  4NH1 C;  2JR6 A;  1VQ7 1;  1VQK 1;  2W04 A;  1KRL A;  3S1R I;  3J81 b;  1M1K 1;  4E31 A;  4NFR A;  1Q81 1;  3HOZ I;  5AN9 F;  3G4S Z;  5IP9 I;  1N8R 2;  1VQO Z;  3CPW Y;  3RZO I;  1RO0 A;  3LUS A;  4BY7 I;  2OTJ Z;  4A3L I;  3GTG I;  1NJI 2;  2LIY A;  3S15 I;  4MRI A;  5FLX b;  3T4N B;  5T64 A;  1K9M 1;  2VF1 A;  1X3W A;  3S1M I;  3OW2 Z;  2HU9 A;  2W03 A;  1Q86 2;  3HOY I;  3KIF A;  3NDI A;  2OTL Z;  4RVH A;  2RBL A;  2QRC B;  3ESW A;  2PMZ A;  3CCE 1;  2E2H I;  2RIQ A;  1RLY A;  1YI2 1;  1PFT A;  1JWH C;  5D1O A;  4E32 A;  3CC4 Z;  3M4O I;  2RT9 A;  4A3E I;  3CCE Z;  4E2W A;  3GKQ A;  1Z02 A;  3G6E Z;  3CCS 1;  1YJN 1;  3NFZ A;  3HOW I;  1X0T A;  1VQ9 1;  1M90 2;  3MZL B;  1YIT Z;  1I3Q I;  1JJ2 Z;  5C3E I;  3HOX I;  2R7Z I;  1TWA I;  5CM2 M;  3CCU 1;  1NP6 A;  2K3R A;  4DGL A;  2R6M A;  1USP A;  1YHQ Z;  3CC7 Z;  1Y1V S;  3J80 b;  2PM9 A;  1KD1 1;  3PO2 I;  1VQL 1;  1TWG I;  4MH4 A;  4NB9 A;  2E2J I;  4A3J I;  3GCF A;  3CCJ 1;  1VQ4 Z;  2KI7 B;  2QKD A;  3BG1 B;  1KQS Y;  2E9H A;  1X3Z A;  3CCJ Z;  1VQ4 1;  2DE5 A;  2OTL 1;  2YU9 I;  1KC8 2;  3IF8 A;  2VUG A;  1TWF I;  4MD9 A;  2K5R A;  2HF1 A;  4X6A I;  1ML8 A;  3CXC Y;  2JUB A;  2QA4 Z;  3CME Z;  1VQO 1;  1I6H I;  3GTK I;  1YJ9 Z;  4Y52 I;  3S1N I;  3KIH A;  4RV9 A;  1VQN 1;  3GTM S;  4CL1 A;  1NJI 1;  3S2D I;  3F3F C;  3I4M I;  2O4H A;  2KPI A;  3CCR Z;  2ZAE B;  2Q51 A;  1Y1V I;  4NBG A;  1Z01 A;  2Q4Z A;  1P9N A;  2JMO A;  2QEX 1;  3VMG A;  3TDH B;  5FLM I;  1QYP A;  2QEX Z;  1WII A;  4HGZ A;  3S1Q I;  2GTI A;  5C4J I;  4HH4 A;  5IT9 b;  4E2Z A;  3CCS Z;  1YJN Z;  2QRE B;  3VTN A;  1ZH1 A;  1YIT 1;  2LFU A;  1VQM 1;  1VQ6 1;  2EGT A;  5D1O B;  2WAQ A;  3NDJ A;  3CCR 1;  1DL6 A;  3U50 C;  3G4S 1;  3CC4 1;  3CC2 Z;  1QVF Y;  3PO3 I;  4A3D I;  4XX2 A;  3CCV 1;  2QRD B;  3HOU I;  3JAM f;  3MZK B;  1K8A 1;  2M48 A;  1KD1 2;  1Y1W I;  3FQQ A;  3I55 1;  2JA8 I;  1YJW Z;  5C4X I;  1W2B Y;  3CCM Z;  1YUA A;  2JA7 I;  2GU2 A;  3FQM A;  3CD6 1;  4DK1 A;  3VB9 A;  1M90 1;  2V8K A;  1Q7Y 2;  1KQS Z;  2V8I A;  3PO3 S;  4TNU A;  1QVG Z;  3IFU A;  1YIJ 1;  4RVG A;  1VQ8 1;  1RO2 A;  1S72 Z;  5IT9 f;  2Y0S A;  1I50 I;  3GTQ I;  3G6E 1;  1NUI A;  1K8A 2;  1S7M A;  4S1T A;  2DE7 A;  3CMA Z;  1N8R 1;  1YUK A;  4RS4 A;  3VMI A;  3HKZ A;  4NBB A;  3CME 1;  3S14 I;  1VQ6 Z;  4E33 A;  1Q82 1;  1ZB8 A;  2B63 I;  3CPW Z;  1K83 I;  2QR1 B;  3D9X A;  3QWU A;  5D1P A;  1WW9 A;  3FKI I;  4A3G I;  3EED A;  2JS4 A;  3RZD I;  1YHQ 1;  3OW2 Y;  4A3M I;  1USP B;  2GTH A;  4RVF A;  4A3B I;  1ZB9 A;  1SFO I;  1VQ5 Z;  1TWH I;  4NBC A;  3I55 Z;  2OOX B;  3HOV I;  1VQP Z;  4NBA A;  3G71 1;  3J81 f;  3GTP I;  2E2I I;  3H0G I;  1VQM Z;  3CCL 1;  2BJO A;  4NBH A;  4RVD A;  1VQP 1;  1VLA A;  4AYB A;  3J7A 4;  3I07 A;  2OZK A;  3CQZ I;  1S72 1;  3VMH A;  4NOZ A;  2YAD A;  2QA4 1;  3P5J B;  1WCM I;  2V8J A;  3I4N I;  4A3I I;  2I3C A;  2G2K A;  1Q86 1;  4E2Y A;  3CCM 1;  3IX0 A;  3CCQ 1;  1YJW 1;  4A93 I;  4NBF A;  2RHB A;  2VUM I;  3CCL Z;  1KC8 1;  1VQK Z;  2JNY A;  4MD7 A;  1L1O C;  1VQ8 Z;  2WB1 A;  1Z03 A;  4HGY A;  1M1K 2;  1YI2 Z;  4BBS I;  2JA6 I;  2JA5 I;  4BBR I;  1VQL Z;  1VQ5 1;  3K7A I;  1YJ9 1;  4QTU A;  3NH8 A;  2J6A A;  3EER A;  2NVY I;  4E30 A;  3GTL I;  2P3Y A;  2PK7 A;  3CCU Z;  1Q81 2;  2NVX I;  5LL6 f;  1TFI A;  3NH4 A;  3BG0 B;  3S16 I;  5T67 A;  3GTO I;  4NBE A;  3CXC Z;  3CCV Z;  5A2Q b;  1K73 2;  5FLX f;  3D6W A;  1TWC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...