3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
1Q812 1M1K1 1VQMZ 3G6EZ 1N8R2 1VQ5Z 3CCS1 1YJ91 3CCQZ 3CC7Z 3G4SZ 3CD6Z 1YIJZ 3CXCZ 1VQN1 2QA4Z 1K732 3CCEZ 1VQ7Z 1S721 1KD11 3G6E1 1Q811 1NJI2 1QVFY 3CMA1 1VQ51 1YIT1 1VQPZ 3I561 2QEX1 1YIJ1 3CCE1 1QVGZ 1VQOZ 1VQ71 1K731 1Q7Y2 1Q821 3CCRZ 1YJN1 1NJI1 1VQ81 3CC2Z 1YI21 1VQ4Z 3CCMZ 1YHQZ 1K8A2 2OTJZ 1KC81 1JJ2Y 1VQKZ 1M902 3CCUZ 1QVFZ 1VQM1 1VQLZ 3CC4Z 3G71Z 1K9M2 1VQ9Z 3CCQ1 3CPWZ 3CC71 1N8R1 3G4S1 3CD61 3I55Z 2QA41 1K8A1 1VQ6Z 2OTLZ 1Q862 3CC41 3CCJZ 1VQP1 1VQ91 3CCLZ 3CCVZ 1YJWZ 1VQO1 3OW2Y 1Q7Y1 3CCSZ 3CCR1 1YJ9Z 3CC21 1VQ41 3CCM1 1YHQ1 1W2BY 1VQNZ 1KD12 3CMEZ 2OTJ1 1KQSY 1VQK1 1S72Z 3CCU1 3CMAZ 1VQL1 1YITZ 1M901 3I56Z 3G711 2QEXZ 3CME1 3I551 1K9M1 3CXCY 1Q822 1M1K2 1VQ61 1JJ2Z 2OTL1 3OW2Z 1YJNZ 1Q861 1VQ8Z 3CCJ1 1YI2Z 1KC82 3CPWY 1W2BZ 3CCL1 3CCV1 1KQSZ 1QVGY 1YJW1
chains in the Genus database with same CATH superfamily
4NFRA 1WIIA 1VQMZ 3G6EZ 4HGYA 1YUKA 1YJ91 2P28A 3VMHA 2LIYA 3G4SZ 1YIJZ 4HH4A 2E2II 3F3FC 1VQ7Z 1KD11 1NJI2 2QKDA 4NBEA 1YIT1 1TFIA 1VQPZ 2K5RA 3FKII 4MD9A 1Z03A 2RBLA 2JIMA 3FQMA 1K731 5FLXb 4HGZA 1Z01A 2JA6I 3S1NI 3CCRZ 4NH1C 3GKQA 3CCMZ 1YHQZ 1K8A2 2KI7B 3NDIA 1JJ2Y 1M902 3MZLB 2QR1B 3CCUZ 1VQM1 3CC4Z 1RQFA 4E32A 3I4NI 3G71Z 1TWCI 1N8R1 3G4S1 2M48A 3P5JB 2QLVB 3HOVI 1VQP1 2GTIA 1QXFA 2G2KA 4QTTA 4NOZA 1WZNA 3GTKI 2QRDB 3FQQA 5IT9f 1RO0A 2O53A 4NBDA 2WB1A 3S15I 3CCR1 1ZB9A 3HOWI 3GTJI 1Y1VS 3CCM1 3J81b 1YHQ1 4TNUA 3H3VJ 3VTNA 3D9XA 2GTHA 3S2HI 3CCU1 1VLAA 2RIQA 2VPYA 2JR6A 3I56Z 3G711 3QWUA 3CME1 4DQYB 1S7MA 2EGTA 4E30A 3IR7A 3S1QI 3BG1B 2NVYI 1YJNZ 1Q861 1YI2Z 3J7A4 1W2BZ 2JMOA 1KQSZ 3S2DI 1QVGY 2H85A 1Q812 3HOYI 3KIHA 4MONA 3CCQZ 3T4NB 3NDJA 3CD6Z 2JS4A 3CXCZ 3JAMb 3S16I 2NVXI 2VUMI 2RPRA 2GU2A 1VQ51 2V8KA 4CL1A 5T67A 3I561 2DE5A 2JIRA 3PO3S 5T64A 2K3RA 3J80f 5C44I 4MRIA 4E33A 1YJN1 1NJI1 2R7ZI 3CC2Z 4XX2A 1YI21 2OOYB 1VQ4Z 2E2HI 1NUIA 1VQKZ 1Y1VI 4RVDA 3CQZI 1SFOI 2E9HA 3CCQ1 5LL6f 3CD61 3HOUI 1K8A1 2OTLZ 2PM9A 3S17I 2V8JA 2JA8I 2VF1A 4E2XA 3CCVZ 2ZAEB 4A3LI 2HU9A 5A2Qf 3OW2Y 1Q7Y1 4A3JI 2LFUA 3LUSA 3CC21 2R92I 1VQ41 1KD12 4A93I 3CMEZ 1RO2A 1LQLA 3KIFA 2M6NA 1S72Z 1VQK1 5C4XI 2W03A 5D1OA 2E2JI 2NVQI 4NBGA 1I50I 2JA5I 1QF8A 1X3WA 1K9M1 1M1K2 2R93I 2OTL1 1JWHC 3PO3I 1USPA 2PK7A 5CM2M 1ZB8A 2VPWA 3CCV1 2RHBA 4A3FI 3S14I 3IF8A 5A2Qb 1PFTA 1WCMI 3M4OI 1N8R2 1VQ5Z 3Q87A 5FLMI 1DL6A 4E31A 2W04A 4S1TA 2QA4Z 1S721 1Q811 1QVFY 1K83I 4Y52I 4RVHA 3F3PC 2BJOA 5IT9b 3NH5A 1NP6A 1Y8CA 3CCE1 1QVGZ 1VQOZ 1R9TI 3VMGA 1Q821 3HOZI 2YADA 3GTMS 2OZKA 1WJ2A 2QRCB 1RO4A 1KC81 1P9NA 3VB9A 4MD8A 4DGLA 4Y7NI 3VMIA 4NBCA 4DK1A 4MH4A 4NB8A 3NFZA 5IP9I 3CPWZ 3GTLI 3I55Z 1X0TA 2QA41 3S1MI 1Y1WI 4MXUA 1Q862 1TWAI 1X3ZA 3TE5B 3CCJZ 1VQ91 3CCLZ 1N2FA 3HOXI 3D2LA 4A3CI 2HF1A 1YJWZ 1VQO1 2KPIA 2NVTI 4NBBA 1ZH1A 2JIQA 3CCSZ 4RVFA 3I07A 5AN9F 5C4JI 1VQNZ 2JA7I 2B63I 5T6BA 3RZDI 2VPZA 1TWGI 1FDOA 3M3YI 1TWFI 2R6MA 3CMAZ 3S1RI 2V8IA 1M901 2PMZA 2QREB 2F4OA 4BXXI 4NB9A 2QEXZ 3GTQI 3I551 3J80b 1JJ2Z 3K7AI 1ML8A 3OW2Z 2V3VA 2RT9A 3IFUA 1VQ8Z 3CCJ1 4E2YA 1SIWA 3CCL1 2Q51A 3GTMI 2AKLA 4BY7I 1RLYA 1YJW1 2YU9I 1I6HI 1M1K1 4A3GI 1WW9A 5C3EI 4BY1I 3CCS1 3NH4A 3CC7Z 3U50C 1Q16A 1VQN1 3J81f 2WAQA 1K732 4NBFA 3CCEZ 5D1OB 3G6E1 3BG0B 4A3BI 4RVGA 3CMA1 4EWCA 4A3KI 2IZ3A 4X6AI 2QEX1 1YIJ1 1KRLA 2OOXB 1USPB 1VQ71 3MZKB 1Q7Y2 2VPXA 4NBHA 2IV2X 3TDHB 2JIOA 1FDIA 2IZ4A 2I3CA 1TWHI 1VQ81 4AYBA 2OTJZ 4E2WA 2DE6A 1L1OC 3GTPI 1QVFZ 2F4MA 1VQLZ 3ESWA 1K9M2 1VQ9Z 2Q4ZA 3MONA 3CC71 1Z02A 1RNIA 1QYPA 1VQ6Z 3JAMf 3GTOI 2Y0SA 2J6AA 3CC41 4A3II 4A3MI 3EEDA 2P3YA 2DE7A 2JUBA 4A3EI 5IP7I 1YJ9Z 3NH8A 1AA6A 3D6WA 4BBRI 1YUAA 1W2BY 2JNYA 2OTJ1 1KQSY 4A3DI 5D1PA 4E2ZA 3H0GI 1VQL1 1YITZ 2O4HA 4RS4A 3RZOI 4NBAA 2JIPA 2VUGA 4RV9A 3CXCY 3EERA 1Q822 1VQ61 4MD7A 2V45A 2LEXA 4BBSI 2AYDA 3IX0A 3GTGI 2NAPA 5FLXf 3I4MI 3PO2I 3GCFA 1KC82 2E7ZA 3CPWY 3HKZA 1I3QI 4QTUA
chains in the Genus database with same CATH topology
4NFRA 1WIIA 1VQMZ 3G6EZ 4HGYA 1YUKA 1YJ91 2P28A 3VMHA 2LIYA 3G4SZ 1YIJZ 4HH4A 2E2II 3F3FC 1VQ7Z 1KD11 1NJI2 2QKDA 4NBEA 1YIT1 1TFIA 1VQPZ 2K5RA 3FKII 4MD9A 1Z03A 2RBLA 3FQMA 1K731 5FLXb 4HGZA 1Z01A 2JA6I 3S1NI 3CCRZ 4NH1C 3GKQA 3CCMZ 1YHQZ 1K8A2 2KI7B 3NDIA 1JJ2Y 1M902 3MZLB 2QR1B 3CCUZ 1VQM1 3CC4Z 1RQFA 4E32A 3I4NI 3G71Z 1TWCI 1N8R1 3G4S1 2M48A 3P5JB 2QLVB 3HOVI 1VQP1 2GTIA 2G2KA 4QTTA 4NOZA 3GTKI 2QRDB 3FQQA 5IT9f 1RO0A 2O53A 4NBDA 2WB1A 3S15I 3CCR1 1ZB9A 3HOWI 3GTJI 1Y1VS 3CCM1 3J81b 1YHQ1 4TNUA 3H3VJ 3VTNA 3D9XA 2GTHA 3S2HI 3CCU1 1VLAA 2RIQA 2JR6A 3I56Z 3G711 3QWUA 3CME1 4DQYB 1S7MA 2EGTA 4E30A 3S1QI 3BG1B 2NVYI 1YJNZ 1Q861 1YI2Z 3J7A4 1W2BZ 2JMOA 1KQSZ 3S2DI 1QVGY 2H85A 1Q812 3HOYI 3KIHA 4MONA 3CCQZ 3T4NB 3NDJA 3CD6Z 2JS4A 3CXCZ 3JAMb 3S16I 2NVXI 2VUMI 2RPRA 2GU2A 1VQ51 2V8KA 4CL1A 5T67A 3I561 2DE5A 3PO3S 5T64A 2K3RA 3J80f 5C44I 4MRIA 4E33A 1YJN1 1NJI1 2R7ZI 3CC2Z 4XX2A 1YI21 2OOYB 1VQ4Z 2E2HI 1NUIA 1VQKZ 1Y1VI 4RVDA 3CQZI 1SFOI 2E9HA 3CCQ1 5LL6f 3CD61 3HOUI 1K8A1 2OTLZ 2PM9A 3S17I 2V8JA 2JA8I 2VF1A 4E2XA 3CCVZ 2ZAEB 4A3LI 2HU9A 5A2Qf 3OW2Y 1Q7Y1 4A3JI 2LFUA 3LUSA 3CC21 2R92I 1VQ41 1KD12 4A93I 3CMEZ 1RO2A 1LQLA 3KIFA 2M6NA 1S72Z 1VQK1 5C4XI 2W03A 5D1OA 2E2JI 2NVQI 4NBGA 1I50I 2JA5I 1QF8A 1X3WA 1K9M1 1M1K2 2R93I 2OTL1 1JWHC 3PO3I 1USPA 2PK7A 5CM2M 1ZB8A 3CCV1 2RHBA 4A3FI 3S14I 3IF8A 5A2Qb 1PFTA 1WCMI 3M4OI 1N8R2 1VQ5Z 3Q87A 5FLMI 1DL6A 4E31A 2W04A 4S1TA 2QA4Z 1S721 1Q811 1QVFY 1K83I 4Y52I 4RVHA 3F3PC 2BJOA 5IT9b 3NH5A 1NP6A 3CCE1 1QVGZ 1VQOZ 1R9TI 3VMGA 1Q821 3HOZI 2YADA 3GTMS 2OZKA 2QRCB 1RO4A 1KC81 1P9NA 3VB9A 4MD8A 4DGLA 4Y7NI 3VMIA 4NBCA 4DK1A 4MH4A 4NB8A 3NFZA 5IP9I 3CPWZ 3GTLI 3I55Z 1X0TA 2QA41 3S1MI 1Y1WI 4MXUA 1Q862 1TWAI 1X3ZA 3TE5B 3CCJZ 1VQ91 3CCLZ 1N2FA 3HOXI 4A3CI 2HF1A 1YJWZ 1VQO1 2KPIA 2NVTI 4NBBA 1ZH1A 3CCSZ 4RVFA 3I07A 5AN9F 5C4JI 1VQNZ 2JA7I 2B63I 5T6BA 3RZDI 1TWGI 3M3YI 1TWFI 2R6MA 3CMAZ 3S1RI 2V8IA 1M901 2PMZA 2QREB 2F4OA 4BXXI 4NB9A 2QEXZ 3GTQI 3I551 3J80b 1JJ2Z 3K7AI 1ML8A 3OW2Z 2RT9A 3IFUA 1VQ8Z 3CCJ1 4E2YA 3CCL1 2Q51A 3GTMI 2AKLA 4BY7I 1RLYA 1YJW1 2YU9I 1I6HI 1M1K1 4A3GI 1WW9A 5C3EI 4BY1I 3CCS1 3NH4A 3CC7Z 3U50C 1VQN1 3J81f 2WAQA 1K732 4NBFA 3CCEZ 5D1OB 3G6E1 3BG0B 4A3BI 4RVGA 3CMA1 4EWCA 4A3KI 2IZ3A 4X6AI 2QEX1 1YIJ1 1KRLA 2OOXB 1USPB 1VQ71 3MZKB 1Q7Y2 4NBHA 3TDHB 2IZ4A 2I3CA 1TWHI 1VQ81 4AYBA 2OTJZ 4E2WA 2DE6A 1L1OC 3GTPI 1QVFZ 2F4MA 1VQLZ 3ESWA 1K9M2 1VQ9Z 2Q4ZA 3MONA 3CC71 1Z02A 1RNIA 1QYPA 1VQ6Z 3JAMf 3GTOI 2Y0SA 2J6AA 3CC41 4A3II 4A3MI 3EEDA 2P3YA 2DE7A 2JUBA 4A3EI 5IP7I 1YJ9Z 3NH8A 3D6WA 4BBRI 1YUAA 1W2BY 2JNYA 2OTJ1 1KQSY 4A3DI 5D1PA 4E2ZA 3H0GI 1VQL1 1YITZ 2O4HA 4RS4A 3RZOI 4NBAA 2VUGA 4RV9A 3CXCY 3EERA 1Q822 1VQ61 4MD7A 4BBSI 3IX0A 3GTGI 5FLXf 3I4MI 3PO2I 3GCFA 1KC82 3CPWY 3HKZA 1I3QI 4QTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 2;  1M1K 1;  1VQM Z;  3G6E Z;  1N8R 2;  1VQ5 Z;  3CCS 1;  1YJ9 1;  3CCQ Z;  3CC7 Z;  3G4S Z;  3CD6 Z;  1YIJ Z;  3CXC Z;  1VQN 1;  2QA4 Z;  1K73 2;  3CCE Z;  1VQ7 Z;  1S72 1;  1KD1 1;  3G6E 1;  1Q81 1;  1NJI 2;  1QVF Y;  3CMA 1;  1VQ5 1;  1YIT 1;  1VQP Z;  3I56 1;  2QEX 1;  1YIJ 1;  3CCE 1;  1QVG Z;  1VQO Z;  1VQ7 1;  1K73 1;  1Q7Y 2;  1Q82 1;  3CCR Z;  1YJN 1;  1NJI 1;  1VQ8 1;  3CC2 Z;  1YI2 1;  1VQ4 Z;  3CCM Z;  1YHQ Z;  1K8A 2;  2OTJ Z;  1KC8 1;  1JJ2 Y;  1VQK Z;  1M90 2;  3CCU Z;  1QVF Z;  1VQM 1;  1VQL Z;  3CC4 Z;  3G71 Z;  1K9M 2;  1VQ9 Z;  3CCQ 1;  3CPW Z;  3CC7 1;  1N8R 1;  3G4S 1;  3CD6 1;  3I55 Z;  2QA4 1;  1K8A 1;  1VQ6 Z;  2OTL Z;  1Q86 2;  3CC4 1;  3CCJ Z;  1VQP 1;  1VQ9 1;  3CCL Z;  3CCV Z;  1YJW Z;  1VQO 1;  3OW2 Y;  1Q7Y 1;  3CCS Z;  3CCR 1;  1YJ9 Z;  3CC2 1;  1VQ4 1;  3CCM 1;  1YHQ 1;  1W2B Y;  1VQN Z;  1KD1 2;  3CME Z;  2OTJ 1;  1KQS Y;  1VQK 1;  1S72 Z;  3CCU 1;  3CMA Z;  1VQL 1;  1YIT Z;  1M90 1;  3I56 Z;  3G71 1;  2QEX Z;  3CME 1;  3I55 1;  1K9M 1;  3CXC Y;  1Q82 2;  1M1K 2;  1VQ6 1;  1JJ2 Z;  2OTL 1;  3OW2 Z;  1YJN Z;  1Q86 1;  1VQ8 Z;  3CCJ 1;  1YI2 Z;  1KC8 2;  3CPW Y;  1W2B Z;  3CCL 1;  3CCV 1;  1KQS Z;  1QVG Y;  1YJW 1; 
#chains in the Genus database with same CATH topology
 4NFR A;  1WII A;  1VQM Z;  3G6E Z;  4HGY A;  1YUK A;  1YJ9 1;  2P28 A;  3VMH A;  2LIY A;  3G4S Z;  1YIJ Z;  4HH4 A;  2E2I I;  3F3F C;  1VQ7 Z;  1KD1 1;  1NJI 2;  2QKD A;  4NBE A;  1YIT 1;  1TFI A;  1VQP Z;  2K5R A;  3FKI I;  4MD9 A;  1Z03 A;  2RBL A;  2JIM A;  3FQM A;  1K73 1;  5FLX b;  4HGZ A;  1Z01 A;  2JA6 I;  3S1N I;  3CCR Z;  4NH1 C;  3GKQ A;  3CCM Z;  1YHQ Z;  1K8A 2;  2KI7 B;  3NDI A;  1JJ2 Y;  1M90 2;  3MZL B;  2QR1 B;  3CCU Z;  1VQM 1;  3CC4 Z;  1RQF A;  4E32 A;  3I4N I;  3G71 Z;  1TWC I;  1N8R 1;  3G4S 1;  2M48 A;  3P5J B;  2QLV B;  3HOV I;  1VQP 1;  2GTI A;  1QXF A;  2G2K A;  4QTT A;  4NOZ A;  1WZN A;  3GTK I;  2QRD B;  3FQQ A;  5IT9 f;  1RO0 A;  2O53 A;  4NBD A;  2WB1 A;  3S15 I;  3CCR 1;  1ZB9 A;  3HOW I;  3GTJ I;  1Y1V S;  3CCM 1;  3J81 b;  1YHQ 1;  4TNU A;  3H3V J;  3VTN A;  3D9X A;  2GTH A;  3S2H I;  3CCU 1;  1VLA A;  2RIQ A;  2VPY A;  2JR6 A;  3I56 Z;  3G71 1;  3QWU A;  3CME 1;  4DQY B;  1S7M A;  2EGT A;  4E30 A;  3IR7 A;  3S1Q I;  3BG1 B;  2NVY I;  1YJN Z;  1Q86 1;  1YI2 Z;  3J7A 4;  1W2B Z;  2JMO A;  1KQS Z;  3S2D I;  1QVG Y;  2H85 A;  1Q81 2;  3HOY I;  3KIH A;  4MON A;  3CCQ Z;  3T4N B;  3NDJ A;  3CD6 Z;  2JS4 A;  3CXC Z;  3JAM b;  3S16 I;  2NVX I;  2VUM I;  2RPR A;  2GU2 A;  1VQ5 1;  2V8K A;  4CL1 A;  5T67 A;  3I56 1;  2DE5 A;  2JIR A;  3PO3 S;  5T64 A;  2K3R A;  3J80 f;  5C44 I;  4MRI A;  4E33 A;  1YJN 1;  1NJI 1;  2R7Z I;  3CC2 Z;  4XX2 A;  1YI2 1;  2OOY B;  1VQ4 Z;  2E2H I;  1NUI A;  1VQK Z;  1Y1V I;  4RVD A;  3CQZ I;  1SFO I;  2E9H A;  3CCQ 1;  5LL6 f;  3CD6 1;  3HOU I;  1K8A 1;  2OTL Z;  2PM9 A;  3S17 I;  2V8J A;  2JA8 I;  2VF1 A;  4E2X A;  3CCV Z;  2ZAE B;  4A3L I;  2HU9 A;  5A2Q f;  3OW2 Y;  1Q7Y 1;  4A3J I;  2LFU A;  3LUS A;  3CC2 1;  2R92 I;  1VQ4 1;  1KD1 2;  4A93 I;  3CME Z;  1RO2 A;  1LQL A;  3KIF A;  2M6N A;  1S72 Z;  1VQK 1;  5C4X I;  2W03 A;  5D1O A;  2E2J I;  2NVQ I;  4NBG A;  1I50 I;  2JA5 I;  1QF8 A;  1X3W A;  1K9M 1;  1M1K 2;  2R93 I;  2OTL 1;  1JWH C;  3PO3 I;  1USP A;  2PK7 A;  5CM2 M;  1ZB8 A;  2VPW A;  3CCV 1;  2RHB A;  4A3F I;  3S14 I;  3IF8 A;  5A2Q b;  1PFT A;  1WCM I;  3M4O I;  1N8R 2;  1VQ5 Z;  3Q87 A;  5FLM I;  1DL6 A;  4E31 A;  2W04 A;  4S1T A;  2QA4 Z;  1S72 1;  1Q81 1;  1QVF Y;  1K83 I;  4Y52 I;  4RVH A;  3F3P C;  2BJO A;  5IT9 b;  3NH5 A;  1NP6 A;  1Y8C A;  3CCE 1;  1QVG Z;  1VQO Z;  1R9T I;  3VMG A;  1Q82 1;  3HOZ I;  2YAD A;  3GTM S;  2OZK A;  1WJ2 A;  2QRC B;  1RO4 A;  1KC8 1;  1P9N A;  3VB9 A;  4MD8 A;  4DGL A;  4Y7N I;  3VMI A;  4NBC A;  4DK1 A;  4MH4 A;  4NB8 A;  3NFZ A;  5IP9 I;  3CPW Z;  3GTL I;  3I55 Z;  1X0T A;  2QA4 1;  3S1M I;  1Y1W I;  4MXU A;  1Q86 2;  1TWA I;  1X3Z A;  3TE5 B;  3CCJ Z;  1VQ9 1;  3CCL Z;  1N2F A;  3HOX I;  3D2L A;  4A3C I;  2HF1 A;  1YJW Z;  1VQO 1;  2KPI A;  2NVT I;  4NBB A;  1ZH1 A;  2JIQ A;  3CCS Z;  4RVF A;  3I07 A;  5AN9 F;  5C4J I;  1VQN Z;  2JA7 I;  2B63 I;  5T6B A;  3RZD I;  2VPZ A;  1TWG I;  1FDO A;  3M3Y I;  1TWF I;  2R6M A;  3CMA Z;  3S1R I;  2V8I A;  1M90 1;  2PMZ A;  2QRE B;  2F4O A;  4BXX I;  4NB9 A;  2QEX Z;  3GTQ I;  3I55 1;  3J80 b;  1JJ2 Z;  3K7A I;  1ML8 A;  3OW2 Z;  2V3V A;  2RT9 A;  3IFU A;  1VQ8 Z;  3CCJ 1;  4E2Y A;  1SIW A;  3CCL 1;  2Q51 A;  3GTM I;  2AKL A;  4BY7 I;  1RLY A;  1YJW 1;  2YU9 I;  1I6H I;  1M1K 1;  4A3G I;  1WW9 A;  5C3E I;  4BY1 I;  3CCS 1;  3NH4 A;  3CC7 Z;  3U50 C;  1Q16 A;  1VQN 1;  3J81 f;  2WAQ A;  1K73 2;  4NBF A;  3CCE Z;  5D1O B;  3G6E 1;  3BG0 B;  4A3B I;  4RVG A;  3CMA 1;  4EWC A;  4A3K I;  2IZ3 A;  4X6A I;  2QEX 1;  1YIJ 1;  1KRL A;  2OOX B;  1USP B;  1VQ7 1;  3MZK B;  1Q7Y 2;  2VPX A;  4NBH A;  2IV2 X;  3TDH B;  2JIO A;  1FDI A;  2IZ4 A;  2I3C A;  1TWH I;  1VQ8 1;  4AYB A;  2OTJ Z;  4E2W A;  2DE6 A;  1L1O C;  3GTP I;  1QVF Z;  2F4M A;  1VQL Z;  3ESW A;  1K9M 2;  1VQ9 Z;  2Q4Z A;  3MON A;  3CC7 1;  1Z02 A;  1RNI A;  1QYP A;  1VQ6 Z;  3JAM f;  3GTO I;  2Y0S A;  2J6A A;  3CC4 1;  4A3I I;  4A3M I;  3EED A;  2P3Y A;  2DE7 A;  2JUB A;  4A3E I;  5IP7 I;  1YJ9 Z;  3NH8 A;  1AA6 A;  3D6W A;  4BBR I;  1YUA A;  1W2B Y;  2JNY A;  2OTJ 1;  1KQS Y;  4A3D I;  5D1P A;  4E2Z A;  3H0G I;  1VQL 1;  1YIT Z;  2O4H A;  4RS4 A;  3RZO I;  4NBA A;  2JIP A;  2VUG A;  4RV9 A;  3CXC Y;  3EER A;  1Q82 2;  1VQ6 1;  4MD7 A;  2V45 A;  2LEX A;  4BBS I;  2AYD A;  3IX0 A;  3GTG I;  2NAP A;  5FLX f;  3I4M I;  3PO2 I;  3GCF A;  1KC8 2;  2E7Z A;  3CPW Y;  3HKZ A;  1I3Q I;  4QTU A; 
#chains in the Genus database with same CATH homology
 4NFR A;  1WII A;  1VQM Z;  3G6E Z;  4HGY A;  1YUK A;  1YJ9 1;  2P28 A;  3VMH A;  2LIY A;  3G4S Z;  1YIJ Z;  4HH4 A;  2E2I I;  3F3F C;  1VQ7 Z;  1KD1 1;  1NJI 2;  2QKD A;  4NBE A;  1YIT 1;  1TFI A;  1VQP Z;  2K5R A;  3FKI I;  4MD9 A;  1Z03 A;  2RBL A;  3FQM A;  1K73 1;  5FLX b;  4HGZ A;  1Z01 A;  2JA6 I;  3S1N I;  3CCR Z;  4NH1 C;  3GKQ A;  3CCM Z;  1YHQ Z;  1K8A 2;  2KI7 B;  3NDI A;  1JJ2 Y;  1M90 2;  3MZL B;  2QR1 B;  3CCU Z;  1VQM 1;  3CC4 Z;  1RQF A;  4E32 A;  3I4N I;  3G71 Z;  1TWC I;  1N8R 1;  3G4S 1;  2M48 A;  3P5J B;  2QLV B;  3HOV I;  1VQP 1;  2GTI A;  2G2K A;  4QTT A;  4NOZ A;  3GTK I;  2QRD B;  3FQQ A;  5IT9 f;  1RO0 A;  2O53 A;  4NBD A;  2WB1 A;  3S15 I;  3CCR 1;  1ZB9 A;  3HOW I;  3GTJ I;  1Y1V S;  3CCM 1;  3J81 b;  1YHQ 1;  4TNU A;  3H3V J;  3VTN A;  3D9X A;  2GTH A;  3S2H I;  3CCU 1;  1VLA A;  2RIQ A;  2JR6 A;  3I56 Z;  3G71 1;  3QWU A;  3CME 1;  4DQY B;  1S7M A;  2EGT A;  4E30 A;  3S1Q I;  3BG1 B;  2NVY I;  1YJN Z;  1Q86 1;  1YI2 Z;  3J7A 4;  1W2B Z;  2JMO A;  1KQS Z;  3S2D I;  1QVG Y;  2H85 A;  1Q81 2;  3HOY I;  3KIH A;  4MON A;  3CCQ Z;  3T4N B;  3NDJ A;  3CD6 Z;  2JS4 A;  3CXC Z;  3JAM b;  3S16 I;  2NVX I;  2VUM I;  2RPR A;  2GU2 A;  1VQ5 1;  2V8K A;  4CL1 A;  5T67 A;  3I56 1;  2DE5 A;  3PO3 S;  5T64 A;  2K3R A;  3J80 f;  5C44 I;  4MRI A;  4E33 A;  1YJN 1;  1NJI 1;  2R7Z I;  3CC2 Z;  4XX2 A;  1YI2 1;  2OOY B;  1VQ4 Z;  2E2H I;  1NUI A;  1VQK Z;  1Y1V I;  4RVD A;  3CQZ I;  1SFO I;  2E9H A;  3CCQ 1;  5LL6 f;  3CD6 1;  3HOU I;  1K8A 1;  2OTL Z;  2PM9 A;  3S17 I;  2V8J A;  2JA8 I;  2VF1 A;  4E2X A;  3CCV Z;  2ZAE B;  4A3L I;  2HU9 A;  5A2Q f;  3OW2 Y;  1Q7Y 1;  4A3J I;  2LFU A;  3LUS A;  3CC2 1;  2R92 I;  1VQ4 1;  1KD1 2;  4A93 I;  3CME Z;  1RO2 A;  1LQL A;  3KIF A;  2M6N A;  1S72 Z;  1VQK 1;  5C4X I;  2W03 A;  5D1O A;  2E2J I;  2NVQ I;  4NBG A;  1I50 I;  2JA5 I;  1QF8 A;  1X3W A;  1K9M 1;  1M1K 2;  2R93 I;  2OTL 1;  1JWH C;  3PO3 I;  1USP A;  2PK7 A;  5CM2 M;  1ZB8 A;  3CCV 1;  2RHB A;  4A3F I;  3S14 I;  3IF8 A;  5A2Q b;  1PFT A;  1WCM I;  3M4O I;  1N8R 2;  1VQ5 Z;  3Q87 A;  5FLM I;  1DL6 A;  4E31 A;  2W04 A;  4S1T A;  2QA4 Z;  1S72 1;  1Q81 1;  1QVF Y;  1K83 I;  4Y52 I;  4RVH A;  3F3P C;  2BJO A;  5IT9 b;  3NH5 A;  1NP6 A;  3CCE 1;  1QVG Z;  1VQO Z;  1R9T I;  3VMG A;  1Q82 1;  3HOZ I;  2YAD A;  3GTM S;  2OZK A;  2QRC B;  1RO4 A;  1KC8 1;  1P9N A;  3VB9 A;  4MD8 A;  4DGL A;  4Y7N I;  3VMI A;  4NBC A;  4DK1 A;  4MH4 A;  4NB8 A;  3NFZ A;  5IP9 I;  3CPW Z;  3GTL I;  3I55 Z;  1X0T A;  2QA4 1;  3S1M I;  1Y1W I;  4MXU A;  1Q86 2;  1TWA I;  1X3Z A;  3TE5 B;  3CCJ Z;  1VQ9 1;  3CCL Z;  1N2F A;  3HOX I;  4A3C I;  2HF1 A;  1YJW Z;  1VQO 1;  2KPI A;  2NVT I;  4NBB A;  1ZH1 A;  3CCS Z;  4RVF A;  3I07 A;  5AN9 F;  5C4J I;  1VQN Z;  2JA7 I;  2B63 I;  5T6B A;  3RZD I;  1TWG I;  3M3Y I;  1TWF I;  2R6M A;  3CMA Z;  3S1R I;  2V8I A;  1M90 1;  2PMZ A;  2QRE B;  2F4O A;  4BXX I;  4NB9 A;  2QEX Z;  3GTQ I;  3I55 1;  3J80 b;  1JJ2 Z;  3K7A I;  1ML8 A;  3OW2 Z;  2RT9 A;  3IFU A;  1VQ8 Z;  3CCJ 1;  4E2Y A;  3CCL 1;  2Q51 A;  3GTM I;  2AKL A;  4BY7 I;  1RLY A;  1YJW 1;  2YU9 I;  1I6H I;  1M1K 1;  4A3G I;  1WW9 A;  5C3E I;  4BY1 I;  3CCS 1;  3NH4 A;  3CC7 Z;  3U50 C;  1VQN 1;  3J81 f;  2WAQ A;  1K73 2;  4NBF A;  3CCE Z;  5D1O B;  3G6E 1;  3BG0 B;  4A3B I;  4RVG A;  3CMA 1;  4EWC A;  4A3K I;  2IZ3 A;  4X6A I;  2QEX 1;  1YIJ 1;  1KRL A;  2OOX B;  1USP B;  1VQ7 1;  3MZK B;  1Q7Y 2;  4NBH A;  3TDH B;  2IZ4 A;  2I3C A;  1TWH I;  1VQ8 1;  4AYB A;  2OTJ Z;  4E2W A;  2DE6 A;  1L1O C;  3GTP I;  1QVF Z;  2F4M A;  1VQL Z;  3ESW A;  1K9M 2;  1VQ9 Z;  2Q4Z A;  3MON A;  3CC7 1;  1Z02 A;  1RNI A;  1QYP A;  1VQ6 Z;  3JAM f;  3GTO I;  2Y0S A;  2J6A A;  3CC4 1;  4A3I I;  4A3M I;  3EED A;  2P3Y A;  2DE7 A;  2JUB A;  4A3E I;  5IP7 I;  1YJ9 Z;  3NH8 A;  3D6W A;  4BBR I;  1YUA A;  1W2B Y;  2JNY A;  2OTJ 1;  1KQS Y;  4A3D I;  5D1P A;  4E2Z A;  3H0G I;  1VQL 1;  1YIT Z;  2O4H A;  4RS4 A;  3RZO I;  4NBA A;  2VUG A;  4RV9 A;  3CXC Y;  3EER A;  1Q82 2;  1VQ6 1;  4MD7 A;  4BBS I;  3IX0 A;  3GTG I;  5FLX f;  3I4M I;  3PO2 I;  3GCF A;  1KC8 2;  3CPW Y;  3HKZ A;  1I3Q I;  4QTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...