3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
3OW2Z 1VQ71 1M1K1 3CC2Z 3CPWZ 2OTLZ 1VQPZ 1W2BZ 3CCS1 1YITZ 2OTJZ 1YJWZ 3CCV1 1Q861 1Q7Y1 3I56Z 1YIT1 1YI2Z 1Q7Y2 1VQNZ 1VQ9Z 1YJW1 3CCLZ 1K9M1 3CMAZ 1YI21 1YJN1 1VQOZ 1VQN1 3CME1 1YHQ1 1KC81 1KC82 3CCMZ 3CCM1 1VQMZ 1VQK1 1KQSY 1K8A2 3CC21 1JJ2Y 1S72Z 1M901 1M902 2OTL1 3CCEZ 1VQP1 1S721 3CC4Z 2OTJ1 1VQ6Z 3G4SZ 3I561 1YJ9Z 3G6EZ 1VQLZ 1KQSZ 1VQ4Z 1VQ91 1VQ61 3I55Z 1VQ8Z 3CCL1 3CMA1 1JJ2Z 3G71Z 1YJ91 1VQL1 1VQO1 3CCQZ 3CCRZ 1VQ81 1NJI2 3G711 2QEXZ 3CCUZ 1VQM1 1K8A1 2QEX1 3CCJZ 1Q812 1QVFY 1VQ5Z 3CCE1 3CC7Z 2QA4Z 3CC41 1VQ7Z 3G4S1 3G6E1 1QVFZ 1VQ41 1KD11 1KD12 3I551 1M1K2 1NJI1 3CCSZ 3CCQ1 3CCR1 1N8R1 1Q821 1N8R2 1Q822 3CCVZ 1QVGY 3CXCY 3CCU1 1Q811 1Q862 3OW2Y 1YJNZ 3CMEZ 3CPWY 3CCJ1 1K9M2 1YIJZ 1K731 1K732 1YHQZ 1VQ51 1W2BY 3CD6Z 1YIJ1 1QVGZ 3CC71 2QA41 3CD61 1VQKZ 3CXCZ
chains in the Genus database with same CATH superfamily
3CC2Z 4BY1I 2F4MA 2VUGA 1VQPZ 3GTPI 1R9TI 2E2JI 1FDOA 2JS4A 2P28A 1RQFA 3F3PC 1Q861 1Q7Y1 3I56Z 1YI2Z 3VMHA 1DL6A 3CCLZ 4NBDA 1RO2A 4RV9A 3BG1B 2JR6A 1FDIA 4MXUA 1KC82 4NB9A 4E32A 2NVYI 2JIQA 1VQMZ 3TDHB 2DE5A 2RIQA 1KQSY 3JAMf 1JJ2Y 5IP9I 2V8JA 1Z01A 2QLVB 1USPB 3J80f 4E31A 4NBCA 1S721 1TWHI 2K3RA 3HOVI 4RVGA 1QXFA 3VB9A 1WIIA 1RLYA 1VQO1 3HKZA 1L1OC 3VTNA 1NJI2 3S2DI 5T64A 1USPA 3EEDA 2QEXZ 1WJ2A 2H85A 2V45A 2PMZA 1VQ5Z 5IT9f 5C4XI 3KIFA 3M3YI 1ML8A 2V8IA 3CCE1 3GTMS 2DE6A 2V8KA 2VF1A 4NBHA 3BG0B 5A2Qf 2JA8I 4TNUA 4Y7NI 1QVFZ 1VQ41 1SIWA 4HGZA 1KD12 2Q51A 1NJI1 1M1K2 2DE7A 1Q821 1RO0A 1N2FA 2BJOA 4A3JI 1Y8CA 3CCU1 1PFTA 3OW2Y 4A3KI 1I6HI 3S15I 1K732 3S1NI 1W2BY 2HU9A 4EWCA 3S1RI 2NVXI 3S14I 4XX2A 1WZNA 1Y1VS 3FQQA 1TWFI 2O4HA 3S1QI 3T4NB 3NFZA 3S17I 2W04A 5FLXb 1M1K1 5IP7I 3CPWZ 3HOYI 2KI7B 1YITZ 2VUMI 1X3WA 2M6NA 1SFOI 1YJWZ 3CCV1 3GTGI 1Q7Y2 3GTJI 4HH4A 3HOWI 3D9XA 1YJN1 1VQOZ 1VQN1 3CME1 2VPWA 1YHQ1 2E9HA 3CCMZ 2JNYA 2G2KA 4A3DI 1TWGI 4DQYB 2R7ZI 2QRDB 2QR1B 1VQK1 2IZ4A 3D6WA 3PO3I 4DGLA 1I50I 3CCEZ 3M4OI 3NH8A 2J6AA 4MD7A 2LFUA 4A3EI 1Z03A 2OTJ1 1VQ6Z 5FLMI 1YJ9Z 2K5RA 1KQSZ 1VQ4Z 3CMA1 4E2WA 3G71Z 1JJ2Z 1VQL1 2IZ3A 1VQ81 3HOZI 2M48A 5AN9F 3CCUZ 2Y0SA 5T6BA 1JWHC 4NBGA 1RO4A 4A3LI 2OOYB 4BY7I 2P3YA 4QTUA 4HGYA 4A3GI 2GU2A 2VPZA 3D2LA 4RS4A 3K7AI 3GKQA 4RVHA 3EERA 3IR7A 3NDJA 4NFRA 1N8R1 1Z02A 1Q822 3CCVZ 4NBBA 2JUBA 3VMIA 3CXCY 3GTQI 1YJNZ 3QWUA 3CMEZ 2PK7A 1K9M2 3KIHA 1YIJZ 1YHQZ 3CD6Z 3J81b 5D1PA 3CC71 2QA41 1X3ZA 1Y1WI 1VQKZ 2RT9A 3OW2Z 2EGTA 1ZB8A 4E2ZA 2VPYA 4MRIA 3LUSA 1W2BZ 4X6AI 3CCS1 3S2HI 2R6MA 2OTJZ 2I3CA 3P5JB 3U50C 2F4OA 3GTMI 1K9M1 4BBSI 3HOXI 3CMAZ 2GTIA 1YI21 1S7MA 3IF8A 3H0GI 2WAQA 2GTHA 2W03A 4E2YA 2ZAEB 1NUIA 2JIMA 1YUAA 4A3MI 1VLAA 1K8A2 3FKII 2LIYA 4NB8A 5FLXf 2LEXA 1S72Z 1M901 2OTL1 4MH4A 2R93I 1VQ91 1Y1VI 3IX0A 1TFIA 2RHBA 3GTLI 2YU9I 4BBRI 2YADA 4E30A 3RZDI 1K8A1 2QEX1 1Q812 2B63I 4CL1A 3FQMA 2OOXB 3NH4A 3CC7Z 2QA4Z 2E7ZA 1NP6A 2HF1A 5D1OB 3VMGA 3CC41 4MONA 4E2XA 4A93I 4E33A 3G4S1 3H3VJ 2JIRA 3G6E1 4S1TA 3I551 3CCSZ 3CCQ1 3CCR1 2AKLA 1N8R2 1ZH1A 2OZKA 1QVGY 5D1OA 1QYPA 4QTTA 1Q811 3IFUA 1WW9A 3CCJ1 2QRCB 2R92I 2IV2X 4NH1C 2PM9A 4RVDA 2JA6I 2Q4ZA 1RNIA 3CXCZ 5C4JI 3JAMb 3S1MI 4Y52I 1VQ71 3J80b 2OTLZ 1Q16A 2QREB 4A3FI 3MZLB 2NVTI 5C44I 1YIT1 1VQNZ 1VQ9Z 1YJW1 4DK1A 3NH5A 4NBFA 3CQZI 1TWAI 1KC81 3MONA 3ESWA 3J81f 5T67A 3RZOI 3CCM1 3PO2I 1YUKA 1WCMI 4BXXI 2JMOA 4A3BI 5IT9b 3S16I 4MD8A 3CC21 3Q87A 1M902 1VQP1 2JA5I 4AYBA 5C3EI 4A3II 1LQLA 3CC4Z 5A2Qb 2RBLA 2KPIA 1KRLA 2E2II 3G4SZ 2AYDA 3I561 4MD9A 3G6EZ 1VQLZ 2JIPA 1VQ61 3I55Z 1VQ8Z 3CCL1 1YJ91 3CCQZ 3CCRZ 3NDIA 2O53A 3G711 2WB1A 3TE5B 2JIOA 1TWCI 4A3CI 4RVFA 2E2HI 1P9NA 1VQM1 2NVQI 2VPXA 3CCJZ 1I3QI 2V3VA 2RPRA 1QVFY 3HOUI 4NBEA 2JA7I 4NBAA 1K83I 1X0TA 1VQ7Z 3MZKB 4NOZA 1ZB9A 1KD11 3I07A 3GCFA 3F3FC 3J7A4 2NAPA 3I4NI 3PO3S 1AA6A 3GTKI 1Q862 3CPWY 2QKDA 1K731 1VQ51 5CM2M 3I4MI 1YIJ1 3GTOI 5LL6f 1QVGZ 3CD61 1QF8A
chains in the Genus database with same CATH topology
3CC2Z 4BY1I 2F4MA 2VUGA 1VQPZ 3GTPI 1R9TI 2E2JI 2JS4A 2P28A 1RQFA 3F3PC 1Q861 1Q7Y1 3I56Z 1YI2Z 3VMHA 1DL6A 3CCLZ 4NBDA 1RO2A 4RV9A 3BG1B 2JR6A 4MXUA 1KC82 4NB9A 4E32A 2NVYI 1VQMZ 3TDHB 2DE5A 2RIQA 1KQSY 3JAMf 1JJ2Y 5IP9I 2V8JA 1Z01A 2QLVB 1USPB 3J80f 4E31A 4NBCA 1S721 1TWHI 2K3RA 3HOVI 4RVGA 3VB9A 1WIIA 1RLYA 1VQO1 3HKZA 1L1OC 3VTNA 1NJI2 3S2DI 5T64A 1USPA 3EEDA 2QEXZ 2H85A 2PMZA 1VQ5Z 5IT9f 5C4XI 3KIFA 3M3YI 1ML8A 2V8IA 3CCE1 3GTMS 2DE6A 2V8KA 2VF1A 4NBHA 3BG0B 5A2Qf 2JA8I 4TNUA 4Y7NI 1QVFZ 1VQ41 4HGZA 1KD12 2Q51A 1NJI1 1M1K2 2DE7A 1Q821 1RO0A 1N2FA 2BJOA 4A3JI 3CCU1 1PFTA 3OW2Y 4A3KI 1I6HI 3S15I 1K732 3S1NI 1W2BY 2HU9A 4EWCA 3S1RI 2NVXI 3S14I 4XX2A 1Y1VS 3FQQA 1TWFI 2O4HA 3S1QI 3T4NB 3NFZA 3S17I 2W04A 5FLXb 1M1K1 5IP7I 3CPWZ 3HOYI 2KI7B 1YITZ 2VUMI 1X3WA 2M6NA 1SFOI 1YJWZ 3CCV1 3GTGI 1Q7Y2 3GTJI 4HH4A 3HOWI 3D9XA 1YJN1 1VQOZ 1VQN1 3CME1 1YHQ1 2E9HA 3CCMZ 2JNYA 2G2KA 4A3DI 1TWGI 4DQYB 2R7ZI 2QRDB 2QR1B 1VQK1 2IZ4A 3D6WA 3PO3I 4DGLA 1I50I 3CCEZ 3M4OI 3NH8A 2J6AA 4MD7A 2LFUA 4A3EI 1Z03A 2OTJ1 1VQ6Z 5FLMI 1YJ9Z 2K5RA 1KQSZ 1VQ4Z 3CMA1 4E2WA 3G71Z 1JJ2Z 1VQL1 2IZ3A 1VQ81 3HOZI 2M48A 5AN9F 3CCUZ 2Y0SA 5T6BA 1JWHC 4NBGA 1RO4A 4A3LI 2OOYB 4BY7I 2P3YA 4QTUA 4HGYA 4A3GI 2GU2A 4RS4A 3K7AI 3GKQA 4RVHA 3EERA 3NDJA 4NFRA 1N8R1 1Z02A 1Q822 3CCVZ 4NBBA 2JUBA 3VMIA 3CXCY 3GTQI 1YJNZ 3QWUA 3CMEZ 2PK7A 1K9M2 3KIHA 1YIJZ 1YHQZ 3CD6Z 3J81b 5D1PA 3CC71 2QA41 1X3ZA 1Y1WI 1VQKZ 2RT9A 3OW2Z 2EGTA 1ZB8A 4E2ZA 4MRIA 3LUSA 1W2BZ 4X6AI 3CCS1 3S2HI 2R6MA 2OTJZ 2I3CA 3P5JB 3U50C 2F4OA 3GTMI 1K9M1 4BBSI 3HOXI 3CMAZ 2GTIA 1YI21 1S7MA 3IF8A 3H0GI 2WAQA 2GTHA 2W03A 4E2YA 2ZAEB 1NUIA 1YUAA 4A3MI 1VLAA 1K8A2 3FKII 2LIYA 4NB8A 5FLXf 1S72Z 1M901 2OTL1 4MH4A 2R93I 1VQ91 1Y1VI 3IX0A 1TFIA 2RHBA 3GTLI 2YU9I 4BBRI 2YADA 4E30A 3RZDI 1K8A1 2QEX1 1Q812 2B63I 4CL1A 3FQMA 2OOXB 3NH4A 3CC7Z 2QA4Z 2HF1A 1NP6A 5D1OB 3VMGA 3CC41 4MONA 4E2XA 4A93I 4E33A 3G4S1 3H3VJ 3G6E1 4S1TA 3I551 3CCSZ 3CCQ1 3CCR1 2AKLA 1N8R2 1ZH1A 2OZKA 1QVGY 5D1OA 1QYPA 4QTTA 1Q811 3IFUA 1WW9A 3CCJ1 2QRCB 2R92I 4NH1C 2PM9A 4RVDA 2JA6I 2Q4ZA 1RNIA 3CXCZ 5C4JI 3JAMb 3S1MI 4Y52I 1VQ71 3J80b 2OTLZ 2QREB 4A3FI 3MZLB 2NVTI 5C44I 1YIT1 1VQNZ 1VQ9Z 1YJW1 4DK1A 3NH5A 4NBFA 3CQZI 1TWAI 1KC81 3MONA 3ESWA 3J81f 5T67A 3RZOI 3CCM1 3PO2I 1YUKA 1WCMI 4BXXI 2JMOA 4A3BI 5IT9b 3S16I 4MD8A 3CC21 3Q87A 1M902 1VQP1 2JA5I 4AYBA 5C3EI 4A3II 1LQLA 3CC4Z 5A2Qb 2RBLA 2KPIA 1KRLA 2E2II 3G4SZ 3I561 4MD9A 3G6EZ 1VQLZ 1VQ61 3I55Z 1VQ8Z 3CCL1 1YJ91 3CCQZ 3CCRZ 3NDIA 2O53A 3G711 2WB1A 3TE5B 1TWCI 4A3CI 4RVFA 2E2HI 1P9NA 1VQM1 2NVQI 3CCJZ 1I3QI 2RPRA 1QVFY 3HOUI 4NBEA 2JA7I 4NBAA 1K83I 1X0TA 1VQ7Z 3MZKB 4NOZA 1ZB9A 1KD11 3I07A 3GCFA 3F3FC 3J7A4 3I4NI 3PO3S 3GTKI 1Q862 3CPWY 2QKDA 1K731 1VQ51 5CM2M 3I4MI 1YIJ1 3GTOI 5LL6f 1QVGZ 3CD61 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  1VQ7 1;  1M1K 1;  3CC2 Z;  3CPW Z;  2OTL Z;  1VQP Z;  1W2B Z;  3CCS 1;  1YIT Z;  2OTJ Z;  1YJW Z;  3CCV 1;  1Q86 1;  1Q7Y 1;  3I56 Z;  1YIT 1;  1YI2 Z;  1Q7Y 2;  1VQN Z;  1VQ9 Z;  1YJW 1;  3CCL Z;  1K9M 1;  3CMA Z;  1YI2 1;  1YJN 1;  1VQO Z;  1VQN 1;  3CME 1;  1YHQ 1;  1KC8 1;  1KC8 2;  3CCM Z;  3CCM 1;  1VQM Z;  1VQK 1;  1KQS Y;  1K8A 2;  3CC2 1;  1JJ2 Y;  1S72 Z;  1M90 1;  1M90 2;  2OTL 1;  3CCE Z;  1VQP 1;  1S72 1;  3CC4 Z;  2OTJ 1;  1VQ6 Z;  3G4S Z;  3I56 1;  1YJ9 Z;  3G6E Z;  1VQL Z;  1KQS Z;  1VQ4 Z;  1VQ9 1;  1VQ6 1;  3I55 Z;  1VQ8 Z;  3CCL 1;  3CMA 1;  1JJ2 Z;  3G71 Z;  1YJ9 1;  1VQL 1;  1VQO 1;  3CCQ Z;  3CCR Z;  1VQ8 1;  1NJI 2;  3G71 1;  2QEX Z;  3CCU Z;  1VQM 1;  1K8A 1;  2QEX 1;  3CCJ Z;  1Q81 2;  1QVF Y;  1VQ5 Z;  3CCE 1;  3CC7 Z;  2QA4 Z;  3CC4 1;  1VQ7 Z;  3G4S 1;  3G6E 1;  1QVF Z;  1VQ4 1;  1KD1 1;  1KD1 2;  3I55 1;  1M1K 2;  1NJI 1;  3CCS Z;  3CCQ 1;  3CCR 1;  1N8R 1;  1Q82 1;  1N8R 2;  1Q82 2;  3CCV Z;  1QVG Y;  3CXC Y;  3CCU 1;  1Q81 1;  1Q86 2;  3OW2 Y;  1YJN Z;  3CME Z;  3CPW Y;  3CCJ 1;  1K9M 2;  1YIJ Z;  1K73 1;  1K73 2;  1YHQ Z;  1VQ5 1;  1W2B Y;  3CD6 Z;  1YIJ 1;  1QVG Z;  3CC7 1;  2QA4 1;  3CD6 1;  1VQK Z;  3CXC Z; 
#chains in the Genus database with same CATH topology
 3CC2 Z;  4BY1 I;  2F4M A;  2VUG A;  1VQP Z;  3GTP I;  1R9T I;  2E2J I;  1FDO A;  2JS4 A;  2P28 A;  1RQF A;  3F3P C;  1Q86 1;  1Q7Y 1;  3I56 Z;  1YI2 Z;  3VMH A;  1DL6 A;  3CCL Z;  4NBD A;  1RO2 A;  4RV9 A;  3BG1 B;  2JR6 A;  1FDI A;  4MXU A;  1KC8 2;  4NB9 A;  4E32 A;  2NVY I;  2JIQ A;  1VQM Z;  3TDH B;  2DE5 A;  2RIQ A;  1KQS Y;  3JAM f;  1JJ2 Y;  5IP9 I;  2V8J A;  1Z01 A;  2QLV B;  1USP B;  3J80 f;  4E31 A;  4NBC A;  1S72 1;  1TWH I;  2K3R A;  3HOV I;  4RVG A;  1QXF A;  3VB9 A;  1WII A;  1RLY A;  1VQO 1;  3HKZ A;  1L1O C;  3VTN A;  1NJI 2;  3S2D I;  5T64 A;  1USP A;  3EED A;  2QEX Z;  1WJ2 A;  2H85 A;  2V45 A;  2PMZ A;  1VQ5 Z;  5IT9 f;  5C4X I;  3KIF A;  3M3Y I;  1ML8 A;  2V8I A;  3CCE 1;  3GTM S;  2DE6 A;  2V8K A;  2VF1 A;  4NBH A;  3BG0 B;  5A2Q f;  2JA8 I;  4TNU A;  4Y7N I;  1QVF Z;  1VQ4 1;  1SIW A;  4HGZ A;  1KD1 2;  2Q51 A;  1NJI 1;  1M1K 2;  2DE7 A;  1Q82 1;  1RO0 A;  1N2F A;  2BJO A;  4A3J I;  1Y8C A;  3CCU 1;  1PFT A;  3OW2 Y;  4A3K I;  1I6H I;  3S15 I;  1K73 2;  3S1N I;  1W2B Y;  2HU9 A;  4EWC A;  3S1R I;  2NVX I;  3S14 I;  4XX2 A;  1WZN A;  1Y1V S;  3FQQ A;  1TWF I;  2O4H A;  3S1Q I;  3T4N B;  3NFZ A;  3S17 I;  2W04 A;  5FLX b;  1M1K 1;  5IP7 I;  3CPW Z;  3HOY I;  2KI7 B;  1YIT Z;  2VUM I;  1X3W A;  2M6N A;  1SFO I;  1YJW Z;  3CCV 1;  3GTG I;  1Q7Y 2;  3GTJ I;  4HH4 A;  3HOW I;  3D9X A;  1YJN 1;  1VQO Z;  1VQN 1;  3CME 1;  2VPW A;  1YHQ 1;  2E9H A;  3CCM Z;  2JNY A;  2G2K A;  4A3D I;  1TWG I;  4DQY B;  2R7Z I;  2QRD B;  2QR1 B;  1VQK 1;  2IZ4 A;  3D6W A;  3PO3 I;  4DGL A;  1I50 I;  3CCE Z;  3M4O I;  3NH8 A;  2J6A A;  4MD7 A;  2LFU A;  4A3E I;  1Z03 A;  2OTJ 1;  1VQ6 Z;  5FLM I;  1YJ9 Z;  2K5R A;  1KQS Z;  1VQ4 Z;  3CMA 1;  4E2W A;  3G71 Z;  1JJ2 Z;  1VQL 1;  2IZ3 A;  1VQ8 1;  3HOZ I;  2M48 A;  5AN9 F;  3CCU Z;  2Y0S A;  5T6B A;  1JWH C;  4NBG A;  1RO4 A;  4A3L I;  2OOY B;  4BY7 I;  2P3Y A;  4QTU A;  4HGY A;  4A3G I;  2GU2 A;  2VPZ A;  3D2L A;  4RS4 A;  3K7A I;  3GKQ A;  4RVH A;  3EER A;  3IR7 A;  3NDJ A;  4NFR A;  1N8R 1;  1Z02 A;  1Q82 2;  3CCV Z;  4NBB A;  2JUB A;  3VMI A;  3CXC Y;  3GTQ I;  1YJN Z;  3QWU A;  3CME Z;  2PK7 A;  1K9M 2;  3KIH A;  1YIJ Z;  1YHQ Z;  3CD6 Z;  3J81 b;  5D1P A;  3CC7 1;  2QA4 1;  1X3Z A;  1Y1W I;  1VQK Z;  2RT9 A;  3OW2 Z;  2EGT A;  1ZB8 A;  4E2Z A;  2VPY A;  4MRI A;  3LUS A;  1W2B Z;  4X6A I;  3CCS 1;  3S2H I;  2R6M A;  2OTJ Z;  2I3C A;  3P5J B;  3U50 C;  2F4O A;  3GTM I;  1K9M 1;  4BBS I;  3HOX I;  3CMA Z;  2GTI A;  1YI2 1;  1S7M A;  3IF8 A;  3H0G I;  2WAQ A;  2GTH A;  2W03 A;  4E2Y A;  2ZAE B;  1NUI A;  2JIM A;  1YUA A;  4A3M I;  1VLA A;  1K8A 2;  3FKI I;  2LIY A;  4NB8 A;  5FLX f;  2LEX A;  1S72 Z;  1M90 1;  2OTL 1;  4MH4 A;  2R93 I;  1VQ9 1;  1Y1V I;  3IX0 A;  1TFI A;  2RHB A;  3GTL I;  2YU9 I;  4BBR I;  2YAD A;  4E30 A;  3RZD I;  1K8A 1;  2QEX 1;  1Q81 2;  2B63 I;  4CL1 A;  3FQM A;  2OOX B;  3NH4 A;  3CC7 Z;  2QA4 Z;  2E7Z A;  1NP6 A;  2HF1 A;  5D1O B;  3VMG A;  3CC4 1;  4MON A;  4E2X A;  4A93 I;  4E33 A;  3G4S 1;  3H3V J;  2JIR A;  3G6E 1;  4S1T A;  3I55 1;  3CCS Z;  3CCQ 1;  3CCR 1;  2AKL A;  1N8R 2;  1ZH1 A;  2OZK A;  1QVG Y;  5D1O A;  1QYP A;  4QTT A;  1Q81 1;  3IFU A;  1WW9 A;  3CCJ 1;  2QRC B;  2R92 I;  2IV2 X;  4NH1 C;  2PM9 A;  4RVD A;  2JA6 I;  2Q4Z A;  1RNI A;  3CXC Z;  5C4J I;  3JAM b;  3S1M I;  4Y52 I;  1VQ7 1;  3J80 b;  2OTL Z;  1Q16 A;  2QRE B;  4A3F I;  3MZL B;  2NVT I;  5C44 I;  1YIT 1;  1VQN Z;  1VQ9 Z;  1YJW 1;  4DK1 A;  3NH5 A;  4NBF A;  3CQZ I;  1TWA I;  1KC8 1;  3MON A;  3ESW A;  3J81 f;  5T67 A;  3RZO I;  3CCM 1;  3PO2 I;  1YUK A;  1WCM I;  4BXX I;  2JMO A;  4A3B I;  5IT9 b;  3S16 I;  4MD8 A;  3CC2 1;  3Q87 A;  1M90 2;  1VQP 1;  2JA5 I;  4AYB A;  5C3E I;  4A3I I;  1LQL A;  3CC4 Z;  5A2Q b;  2RBL A;  2KPI A;  1KRL A;  2E2I I;  3G4S Z;  2AYD A;  3I56 1;  4MD9 A;  3G6E Z;  1VQL Z;  2JIP A;  1VQ6 1;  3I55 Z;  1VQ8 Z;  3CCL 1;  1YJ9 1;  3CCQ Z;  3CCR Z;  3NDI A;  2O53 A;  3G71 1;  2WB1 A;  3TE5 B;  2JIO A;  1TWC I;  4A3C I;  4RVF A;  2E2H I;  1P9N A;  1VQM 1;  2NVQ I;  2VPX A;  3CCJ Z;  1I3Q I;  2V3V A;  2RPR A;  1QVF Y;  3HOU I;  4NBE A;  2JA7 I;  4NBA A;  1K83 I;  1X0T A;  1VQ7 Z;  3MZK B;  4NOZ A;  1ZB9 A;  1KD1 1;  3I07 A;  3GCF A;  3F3F C;  3J7A 4;  2NAP A;  3I4N I;  3PO3 S;  1AA6 A;  3GTK I;  1Q86 2;  3CPW Y;  2QKD A;  1K73 1;  1VQ5 1;  5CM2 M;  3I4M I;  1YIJ 1;  3GTO I;  5LL6 f;  1QVG Z;  3CD6 1;  1QF8 A; 
#chains in the Genus database with same CATH homology
 3CC2 Z;  4BY1 I;  2F4M A;  2VUG A;  1VQP Z;  3GTP I;  1R9T I;  2E2J I;  2JS4 A;  2P28 A;  1RQF A;  3F3P C;  1Q86 1;  1Q7Y 1;  3I56 Z;  1YI2 Z;  3VMH A;  1DL6 A;  3CCL Z;  4NBD A;  1RO2 A;  4RV9 A;  3BG1 B;  2JR6 A;  4MXU A;  1KC8 2;  4NB9 A;  4E32 A;  2NVY I;  1VQM Z;  3TDH B;  2DE5 A;  2RIQ A;  1KQS Y;  3JAM f;  1JJ2 Y;  5IP9 I;  2V8J A;  1Z01 A;  2QLV B;  1USP B;  3J80 f;  4E31 A;  4NBC A;  1S72 1;  1TWH I;  2K3R A;  3HOV I;  4RVG A;  3VB9 A;  1WII A;  1RLY A;  1VQO 1;  3HKZ A;  1L1O C;  3VTN A;  1NJI 2;  3S2D I;  5T64 A;  1USP A;  3EED A;  2QEX Z;  2H85 A;  2PMZ A;  1VQ5 Z;  5IT9 f;  5C4X I;  3KIF A;  3M3Y I;  1ML8 A;  2V8I A;  3CCE 1;  3GTM S;  2DE6 A;  2V8K A;  2VF1 A;  4NBH A;  3BG0 B;  5A2Q f;  2JA8 I;  4TNU A;  4Y7N I;  1QVF Z;  1VQ4 1;  4HGZ A;  1KD1 2;  2Q51 A;  1NJI 1;  1M1K 2;  2DE7 A;  1Q82 1;  1RO0 A;  1N2F A;  2BJO A;  4A3J I;  3CCU 1;  1PFT A;  3OW2 Y;  4A3K I;  1I6H I;  3S15 I;  1K73 2;  3S1N I;  1W2B Y;  2HU9 A;  4EWC A;  3S1R I;  2NVX I;  3S14 I;  4XX2 A;  1Y1V S;  3FQQ A;  1TWF I;  2O4H A;  3S1Q I;  3T4N B;  3NFZ A;  3S17 I;  2W04 A;  5FLX b;  1M1K 1;  5IP7 I;  3CPW Z;  3HOY I;  2KI7 B;  1YIT Z;  2VUM I;  1X3W A;  2M6N A;  1SFO I;  1YJW Z;  3CCV 1;  3GTG I;  1Q7Y 2;  3GTJ I;  4HH4 A;  3HOW I;  3D9X A;  1YJN 1;  1VQO Z;  1VQN 1;  3CME 1;  1YHQ 1;  2E9H A;  3CCM Z;  2JNY A;  2G2K A;  4A3D I;  1TWG I;  4DQY B;  2R7Z I;  2QRD B;  2QR1 B;  1VQK 1;  2IZ4 A;  3D6W A;  3PO3 I;  4DGL A;  1I50 I;  3CCE Z;  3M4O I;  3NH8 A;  2J6A A;  4MD7 A;  2LFU A;  4A3E I;  1Z03 A;  2OTJ 1;  1VQ6 Z;  5FLM I;  1YJ9 Z;  2K5R A;  1KQS Z;  1VQ4 Z;  3CMA 1;  4E2W A;  3G71 Z;  1JJ2 Z;  1VQL 1;  2IZ3 A;  1VQ8 1;  3HOZ I;  2M48 A;  5AN9 F;  3CCU Z;  2Y0S A;  5T6B A;  1JWH C;  4NBG A;  1RO4 A;  4A3L I;  2OOY B;  4BY7 I;  2P3Y A;  4QTU A;  4HGY A;  4A3G I;  2GU2 A;  4RS4 A;  3K7A I;  3GKQ A;  4RVH A;  3EER A;  3NDJ A;  4NFR A;  1N8R 1;  1Z02 A;  1Q82 2;  3CCV Z;  4NBB A;  2JUB A;  3VMI A;  3CXC Y;  3GTQ I;  1YJN Z;  3QWU A;  3CME Z;  2PK7 A;  1K9M 2;  3KIH A;  1YIJ Z;  1YHQ Z;  3CD6 Z;  3J81 b;  5D1P A;  3CC7 1;  2QA4 1;  1X3Z A;  1Y1W I;  1VQK Z;  2RT9 A;  3OW2 Z;  2EGT A;  1ZB8 A;  4E2Z A;  4MRI A;  3LUS A;  1W2B Z;  4X6A I;  3CCS 1;  3S2H I;  2R6M A;  2OTJ Z;  2I3C A;  3P5J B;  3U50 C;  2F4O A;  3GTM I;  1K9M 1;  4BBS I;  3HOX I;  3CMA Z;  2GTI A;  1YI2 1;  1S7M A;  3IF8 A;  3H0G I;  2WAQ A;  2GTH A;  2W03 A;  4E2Y A;  2ZAE B;  1NUI A;  1YUA A;  4A3M I;  1VLA A;  1K8A 2;  3FKI I;  2LIY A;  4NB8 A;  5FLX f;  1S72 Z;  1M90 1;  2OTL 1;  4MH4 A;  2R93 I;  1VQ9 1;  1Y1V I;  3IX0 A;  1TFI A;  2RHB A;  3GTL I;  2YU9 I;  4BBR I;  2YAD A;  4E30 A;  3RZD I;  1K8A 1;  2QEX 1;  1Q81 2;  2B63 I;  4CL1 A;  3FQM A;  2OOX B;  3NH4 A;  3CC7 Z;  2QA4 Z;  2HF1 A;  1NP6 A;  5D1O B;  3VMG A;  3CC4 1;  4MON A;  4E2X A;  4A93 I;  4E33 A;  3G4S 1;  3H3V J;  3G6E 1;  4S1T A;  3I55 1;  3CCS Z;  3CCQ 1;  3CCR 1;  2AKL A;  1N8R 2;  1ZH1 A;  2OZK A;  1QVG Y;  5D1O A;  1QYP A;  4QTT A;  1Q81 1;  3IFU A;  1WW9 A;  3CCJ 1;  2QRC B;  2R92 I;  4NH1 C;  2PM9 A;  4RVD A;  2JA6 I;  2Q4Z A;  1RNI A;  3CXC Z;  5C4J I;  3JAM b;  3S1M I;  4Y52 I;  1VQ7 1;  3J80 b;  2OTL Z;  2QRE B;  4A3F I;  3MZL B;  2NVT I;  5C44 I;  1YIT 1;  1VQN Z;  1VQ9 Z;  1YJW 1;  4DK1 A;  3NH5 A;  4NBF A;  3CQZ I;  1TWA I;  1KC8 1;  3MON A;  3ESW A;  3J81 f;  5T67 A;  3RZO I;  3CCM 1;  3PO2 I;  1YUK A;  1WCM I;  4BXX I;  2JMO A;  4A3B I;  5IT9 b;  3S16 I;  4MD8 A;  3CC2 1;  3Q87 A;  1M90 2;  1VQP 1;  2JA5 I;  4AYB A;  5C3E I;  4A3I I;  1LQL A;  3CC4 Z;  5A2Q b;  2RBL A;  2KPI A;  1KRL A;  2E2I I;  3G4S Z;  3I56 1;  4MD9 A;  3G6E Z;  1VQL Z;  1VQ6 1;  3I55 Z;  1VQ8 Z;  3CCL 1;  1YJ9 1;  3CCQ Z;  3CCR Z;  3NDI A;  2O53 A;  3G71 1;  2WB1 A;  3TE5 B;  1TWC I;  4A3C I;  4RVF A;  2E2H I;  1P9N A;  1VQM 1;  2NVQ I;  3CCJ Z;  1I3Q I;  2RPR A;  1QVF Y;  3HOU I;  4NBE A;  2JA7 I;  4NBA A;  1K83 I;  1X0T A;  1VQ7 Z;  3MZK B;  4NOZ A;  1ZB9 A;  1KD1 1;  3I07 A;  3GCF A;  3F3F C;  3J7A 4;  3I4N I;  3PO3 S;  3GTK I;  1Q86 2;  3CPW Y;  2QKD A;  1K73 1;  1VQ5 1;  5CM2 M;  3I4M I;  1YIJ 1;  3GTO I;  5LL6 f;  1QVG Z;  3CD6 1;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...