3G4SZ

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4sZ00
1YJNZ 1VQ7Z 1JJ2Y 1N8R1 1VQ41 3CMAZ 3CCRZ 3CCVZ 1QVFY 3I56Z 1VQOZ 1VQ6Z 2OTJZ 1Q821 1Q812 1Q811 3G4SZ 2QEXZ 3I55Z 1YIT1 1VQ81 1VQPZ 1W2BY 1K731 1S721 3G4S1 1VQLZ 1M1K2 1VQN1 3I551 1KQSY 3CCE1 3CCL1 1N8R2 1KD11 1Q7Y2 1Q7Y1 3CC7Z 3OW2Y 3CCSZ 1YJN1 1VQ71 3CMA1 3CCR1 3CCV1 1YIJZ 1Q822 3CC4Z 3CXCY 3CCMZ 1YHQZ 3G71Z 1NJI2 1NJI1 3I561 1VQO1 1VQ61 2OTJ1 1K732 2QEX1 3CMEZ 3CPWY 3G6EZ 1KC81 1W2BZ 1VQP1 1VQKZ 1K9M2 1K9M1 3CD6Z 1VQ9Z 1VQMZ 1VQL1 1QVGY 1KD12 1M901 1K8A1 2OTLZ 1JJ2Z 1VQ5Z 3CC71 3CCJZ 3CCS1 1QVFZ 2QA4Z 1YJ9Z 3CCUZ 3CCJ1 1YIJ1 3CC41 3CXCZ 1YJ91 1VQ4Z 3CCM1 1YHQ1 3G711 1KC82 3CPWZ 3CME1 1M902 3G6E1 1KQSZ 1K8A2 1VQK1 3CC2Z 3CD61 1VQ91 1QVGZ 1VQM1 1VQ8Z 1YITZ 3OW2Z 1S72Z 2OTL1 3CC21 1YJWZ 3CCQZ 1VQNZ 1VQ51 1YI2Z 1Q862 1Q861 3CCEZ 3CCLZ 1YJW1 3CCQ1 1M1K1 1YI21 2QA41 3CCU1
chains in the Genus database with same CATH superfamily
3J81b 4RS4A 5IT9f 4Y52I 1YUAA 2AYDA 4MH4A 3S2HI 3J81f 4NBBA 3HOXI 2NVYI 3S1QI 1X3WA 5D1OA 3S17I 2EGTA 2PMZA 3FQQA 4MXUA 2V8KA 2JIRA 4AYBA 4E2YA 4DGLA 1M1K2 1TWGI 1USPA 3CCE1 3I4NI 3GKQA 2VUGA 1Q7Y1 2QRDB 3CC7Z 2VF1A 3D9XA 1SIWA 2AKLA 4DK1A 1I6HI 1YUKA 3HOZI 3CMA1 3CCR1 3CCV1 1YIJZ 3CQZI 3PO2I 3G71Z 4RVDA 1VQO1 2NVQI 3NH4A 1RQFA 3EEDA 3CPWY 2ZAEB 4HH4A 1SFOI 1KC81 3LUSA 4XX2A 1ZB8A 3CD6Z 1VQL1 3RZDI 1QVGY 2QKDA 1TWCI 4E31A 3NFZA 3HOWI 2W03A 1ZH1A 2JS4A 3CCS1 2E9HA 3NDJA 2VPXA 1YJ9Z 1FDOA 2JUBA 2WAQA 1YJ91 1VQ4Z 2JA8I 5C4JI 5D1PA 1KC82 3H3VJ 3CME1 1ZB9A 2WB1A 3GTJI 2P3YA 1WCMI 4RVHA 2VPYA 1YITZ 2GTIA 1P9NA 5IP7I 2YADA 1Q862 2KI7B 2JIQA 5FLXb 4X6AI 3BG0B 3GTOI 3CCU1 3J80f 2JA6I 1TWFI 2G2KA 4QTUA 1YJNZ 5C3EI 1VQ7Z 1JJ2Y 4RV9A 5FLXf 4A3FI 1WZNA 1WIIA 2J6AA 1QVFY 3MONA 4NB8A 1VQ6Z 2NVTI 1PFTA 2HF1A 1Q812 2KPIA 2E2HI 4MONA 4MRIA 3I55Z 1VQ81 4E30A 3D2LA 5A2Qb 1VQN1 3I551 1KQSY 3S16I 3IX0A 2R92I 5A2Qf 3S2DI 3OW2Y 5T64A 3J7A4 1N2FA 1YHQZ 1JWHC 2R7ZI 4A3LI 1NJI2 1I50I 1L1OC 2V45A 1AA6A 2K5RA 2E2JI 1Q16A 1VQ9Z 1VQMZ 3GTMI 3FQMA 2RIQA 3VTNA 1K8A1 1JJ2Z 4HGZA 5CM2M 2E7ZA 4TNUA 3CC71 2HU9A 4E2ZA 4DQYB 1QVFZ 4A3EI 2QA4Z 4CL1A 1YIJ1 1RLYA 3CXCZ 3G711 2R6MA 2NVXI 4A3JI 3GTMS 2QREB 2VPZA 3IR7A 3IF8A 1KQSZ 2Q51A 1K8A2 2DE6A 4S1TA 2Y0SA 3CD61 3VMHA 4QTTA 2QRCB 3OW2Z 1S72Z 3RZOI 1TWAI 1YI2Z 3S1NI 4BY1I 1QYPA 2GU2A 1Q861 3CCLZ 3S1RI 1YI21 2Q4ZA 4NBEA 2RBLA 3HOYI 1N8R1 1VQ41 3NH5A 2BJOA 1WJ2A 3K7AI 2V8IA 3I4MI 3VMIA 4EWCA 2DE7A 3I56Z 2OTJZ 4MD7A 3Q87A 1Q821 3HOVI 1LQLA 1Q811 1TWHI 2QEXZ 2JA5I 1Y1WI 3J80b 3PO3I 1YIT1 2V8JA 3JAMf 1WW9A 1VQPZ 1K731 4BXXI 2DE5A 1Y8CA 1N8R2 2YU9I 3D6WA 1YJN1 3GCFA 1VQ71 2R93I 3M4OI 3HOUI 2PM9A 2E2II 1RNIA 2VPWA 1QF8A 3PO3S 1Q822 4RVFA 3CC4Z 4E2XA 4A3CI 3CXCY 3F3FC 3CCMZ 1NJI1 2QLVB 1VQ61 1K83I 1K732 2RHBA 5T67A 3F3PC 3S15I 3G6EZ 3KIFA 1W2BZ 2JR6A 1VQKZ 3IFUA 1K9M2 2I3CA 2OTLZ 4NOZA 5AN9F 2JIMA 2JA7I 2JIOA 3S14I 1VQ5Z 3CCJZ 4NBFA 3NH8A 3GTPI 5LL6f 3CCJ1 4E32A 5T6BA 1YHQ1 4NBAA 5D1OB 1X3ZA 1NUIA 3MZLB 1Y1VI 2QR1B 5C44I 4MD8A 4NBCA 3CC2Z 3QWUA 4NBHA 1VQ91 1USPB 1VQM1 4NH1C 3VMGA 2RPRA 3CC21 2F4OA 4BY7I 1YJWZ 3CCQZ 2PK7A 4NBGA 3CCEZ 1YJW1 3CCQ1 4A3MI 3VB9A 2QA41 5C4XI 1Y1VS 4E2WA 3I07A 1DL6A 1ML8A 1QXFA 2GTHA 2NAPA 3CMAZ 3CCRZ 2O4HA 3CCVZ 2V3VA 3HKZA 3S1MI 1VQOZ 1VLAA 3GTKI 3G4SZ 1X0TA 1W2BY 4A3DI 1S721 3G4S1 1VQLZ 1S7MA 3M3YI 4Y7NI 3BG1B 3U50C 3CCL1 4A3GI 1KD11 2VUMI 1Q7Y2 2M6NA 1RO2A 1I3QI 4A93I 4A3KI 3CCSZ 2JIPA 3GTLI 2IZ3A 3TE5B 4BBSI 3JAMb 1NP6A 2OZKA 3P5JB 2F4MA 3GTGI 3I561 2OTJ1 4A3II 3FKII 1Z01A 2M48A 4RVGA 2QEX1 3CMEZ 2K3RA 1VQP1 1K9M1 1TFIA 3MZKB 5IP9I 1KD12 1M901 3NDIA 3ESWA 3T4NB 2JNYA 4NFRA 2IZ4A 4A3BI 3TDHB 3CCUZ 2OOXB 1Z03A 3CC41 1RO4A 2RT9A 1FDIA 2LIYA 3EERA 3CCM1 4BBRI 2OOYB 3CPWZ 2LFUA 2W04A 4MD9A 5FLMI 1M902 3G6E1 1R9TI 3KIHA 1VQK1 1RO0A 2IV2X 1QVGZ 3GTQI 1VQ8Z 3H0GI 2B63I 2OTL1 2P28A 2H85A 4NBDA 2LEXA 1VQNZ 1VQ51 1Z02A 5IT9b 4E33A 1KRLA 2O53A 1M1K1 2JMOA 4HGYA 4NB9A
chains in the Genus database with same CATH topology
3J81b 4RS4A 5IT9f 4Y52I 1YUAA 4MH4A 3S2HI 3J81f 4NBBA 3HOXI 2NVYI 3S1QI 1X3WA 5D1OA 3S17I 2EGTA 2PMZA 3FQQA 4MXUA 2V8KA 4AYBA 4E2YA 4DGLA 1M1K2 1TWGI 1USPA 3CCE1 3I4NI 3GKQA 2VUGA 1Q7Y1 2QRDB 3CC7Z 2VF1A 3D9XA 2AKLA 4DK1A 1I6HI 1YUKA 3HOZI 3CMA1 3CCR1 3CCV1 1YIJZ 3CQZI 3PO2I 3G71Z 4RVDA 1VQO1 2NVQI 3NH4A 1RQFA 3EEDA 3CPWY 2ZAEB 4HH4A 1SFOI 1KC81 3LUSA 4XX2A 1ZB8A 3CD6Z 1VQL1 3RZDI 1QVGY 2QKDA 1TWCI 4E31A 3NFZA 3HOWI 2W03A 1ZH1A 2JS4A 3CCS1 2E9HA 3NDJA 1YJ9Z 2JUBA 2WAQA 1YJ91 1VQ4Z 2JA8I 5C4JI 5D1PA 1KC82 3H3VJ 3CME1 1ZB9A 2WB1A 3GTJI 2P3YA 1WCMI 4RVHA 1YITZ 2GTIA 1P9NA 5IP7I 2YADA 1Q862 2KI7B 5FLXb 4X6AI 3BG0B 3GTOI 3CCU1 3J80f 2JA6I 1TWFI 2G2KA 4QTUA 1YJNZ 5C3EI 1VQ7Z 1JJ2Y 4RV9A 5FLXf 4A3FI 1WIIA 2J6AA 1QVFY 3MONA 4NB8A 1VQ6Z 2NVTI 1PFTA 2HF1A 1Q812 2KPIA 2E2HI 4MONA 4MRIA 3I55Z 1VQ81 4E30A 5A2Qb 1VQN1 3I551 1KQSY 3S16I 3IX0A 2R92I 5A2Qf 3S2DI 3OW2Y 5T64A 3J7A4 1N2FA 1YHQZ 1JWHC 2R7ZI 4A3LI 1NJI2 1I50I 1L1OC 2K5RA 2E2JI 1VQ9Z 1VQMZ 3GTMI 3FQMA 2RIQA 3VTNA 1K8A1 1JJ2Z 4HGZA 5CM2M 4TNUA 3CC71 2HU9A 4E2ZA 4DQYB 1QVFZ 4A3EI 2QA4Z 4CL1A 1YIJ1 1RLYA 3CXCZ 3G711 2R6MA 2NVXI 4A3JI 3GTMS 2QREB 3IF8A 1KQSZ 2Q51A 1K8A2 2DE6A 4S1TA 2Y0SA 3CD61 3VMHA 4QTTA 2QRCB 3OW2Z 1S72Z 3RZOI 1TWAI 1YI2Z 3S1NI 4BY1I 1QYPA 2GU2A 1Q861 3CCLZ 3S1RI 1YI21 2Q4ZA 4NBEA 2RBLA 3HOYI 1N8R1 1VQ41 3NH5A 2BJOA 3K7AI 2V8IA 3I4MI 3VMIA 4EWCA 2DE7A 3I56Z 2OTJZ 4MD7A 3Q87A 1Q821 3HOVI 1LQLA 1Q811 1TWHI 2QEXZ 2JA5I 1Y1WI 3J80b 3PO3I 1YIT1 2V8JA 3JAMf 1WW9A 1VQPZ 1K731 4BXXI 2DE5A 1N8R2 2YU9I 3D6WA 1YJN1 3GCFA 1VQ71 2R93I 3M4OI 3HOUI 2PM9A 2E2II 1RNIA 1QF8A 3PO3S 1Q822 4RVFA 3CC4Z 4E2XA 4A3CI 3CXCY 3F3FC 3CCMZ 1NJI1 2QLVB 1VQ61 1K83I 1K732 2RHBA 5T67A 3F3PC 3S15I 3G6EZ 3KIFA 1W2BZ 2JR6A 1VQKZ 3IFUA 1K9M2 2I3CA 2OTLZ 4NOZA 5AN9F 2JA7I 3S14I 1VQ5Z 3CCJZ 4NBFA 3NH8A 3GTPI 5LL6f 3CCJ1 4E32A 5T6BA 1YHQ1 4NBAA 5D1OB 1X3ZA 1NUIA 3MZLB 1Y1VI 2QR1B 5C44I 4MD8A 4NBCA 3CC2Z 3QWUA 4NBHA 1VQ91 1USPB 1VQM1 4NH1C 3VMGA 2RPRA 3CC21 2F4OA 4BY7I 1YJWZ 3CCQZ 2PK7A 4NBGA 3CCEZ 1YJW1 3CCQ1 4A3MI 3VB9A 2QA41 5C4XI 1Y1VS 4E2WA 3I07A 1DL6A 1ML8A 2GTHA 3CMAZ 3CCRZ 2O4HA 3CCVZ 3HKZA 3S1MI 1VQOZ 1VLAA 3GTKI 3G4SZ 1X0TA 1W2BY 4A3DI 1S721 3G4S1 1VQLZ 1S7MA 3M3YI 4Y7NI 3BG1B 3U50C 3CCL1 4A3GI 1KD11 2VUMI 1Q7Y2 2M6NA 1RO2A 1I3QI 4A93I 4A3KI 3CCSZ 3GTLI 2IZ3A 3TE5B 4BBSI 3JAMb 1NP6A 2OZKA 3P5JB 2F4MA 3GTGI 3I561 2OTJ1 4A3II 3FKII 1Z01A 2M48A 4RVGA 2QEX1 3CMEZ 2K3RA 1VQP1 1K9M1 1TFIA 3MZKB 5IP9I 1KD12 1M901 3NDIA 3ESWA 3T4NB 2JNYA 4NFRA 2IZ4A 4A3BI 3TDHB 3CCUZ 2OOXB 1Z03A 3CC41 1RO4A 2RT9A 2LIYA 3EERA 3CCM1 4BBRI 2OOYB 3CPWZ 2LFUA 2W04A 4MD9A 5FLMI 1M902 3G6E1 1R9TI 3KIHA 1VQK1 1RO0A 1QVGZ 3GTQI 1VQ8Z 3H0GI 2B63I 2OTL1 2P28A 2H85A 4NBDA 1VQNZ 1VQ51 1Z02A 5IT9b 4E33A 1KRLA 2O53A 1M1K1 2JMOA 4HGYA 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  1VQ7 Z;  1JJ2 Y;  1N8R 1;  1VQ4 1;  3CMA Z;  3CCR Z;  3CCV Z;  1QVF Y;  3I56 Z;  1VQO Z;  1VQ6 Z;  2OTJ Z;  1Q82 1;  1Q81 2;  1Q81 1;  3G4S Z;  2QEX Z;  3I55 Z;  1YIT 1;  1VQ8 1;  1VQP Z;  1W2B Y;  1K73 1;  1S72 1;  3G4S 1;  1VQL Z;  1M1K 2;  1VQN 1;  3I55 1;  1KQS Y;  3CCE 1;  3CCL 1;  1N8R 2;  1KD1 1;  1Q7Y 2;  1Q7Y 1;  3CC7 Z;  3OW2 Y;  3CCS Z;  1YJN 1;  1VQ7 1;  3CMA 1;  3CCR 1;  3CCV 1;  1YIJ Z;  1Q82 2;  3CC4 Z;  3CXC Y;  3CCM Z;  1YHQ Z;  3G71 Z;  1NJI 2;  1NJI 1;  3I56 1;  1VQO 1;  1VQ6 1;  2OTJ 1;  1K73 2;  2QEX 1;  3CME Z;  3CPW Y;  3G6E Z;  1KC8 1;  1W2B Z;  1VQP 1;  1VQK Z;  1K9M 2;  1K9M 1;  3CD6 Z;  1VQ9 Z;  1VQM Z;  1VQL 1;  1QVG Y;  1KD1 2;  1M90 1;  1K8A 1;  2OTL Z;  1JJ2 Z;  1VQ5 Z;  3CC7 1;  3CCJ Z;  3CCS 1;  1QVF Z;  2QA4 Z;  1YJ9 Z;  3CCU Z;  3CCJ 1;  1YIJ 1;  3CC4 1;  3CXC Z;  1YJ9 1;  1VQ4 Z;  3CCM 1;  1YHQ 1;  3G71 1;  1KC8 2;  3CPW Z;  3CME 1;  1M90 2;  3G6E 1;  1KQS Z;  1K8A 2;  1VQK 1;  3CC2 Z;  3CD6 1;  1VQ9 1;  1QVG Z;  1VQM 1;  1VQ8 Z;  1YIT Z;  3OW2 Z;  1S72 Z;  2OTL 1;  3CC2 1;  1YJW Z;  3CCQ Z;  1VQN Z;  1VQ5 1;  1YI2 Z;  1Q86 2;  1Q86 1;  3CCE Z;  3CCL Z;  1YJW 1;  3CCQ 1;  1M1K 1;  1YI2 1;  2QA4 1;  3CCU 1; 
#chains in the Genus database with same CATH topology
 3J81 b;  4RS4 A;  5IT9 f;  4Y52 I;  1YUA A;  2AYD A;  4MH4 A;  3S2H I;  3J81 f;  4NBB A;  3HOX I;  2NVY I;  3S1Q I;  1X3W A;  5D1O A;  3S17 I;  2EGT A;  2PMZ A;  3FQQ A;  4MXU A;  2V8K A;  2JIR A;  4AYB A;  4E2Y A;  4DGL A;  1M1K 2;  1TWG I;  1USP A;  3CCE 1;  3I4N I;  3GKQ A;  2VUG A;  1Q7Y 1;  2QRD B;  3CC7 Z;  2VF1 A;  3D9X A;  1SIW A;  2AKL A;  4DK1 A;  1I6H I;  1YUK A;  3HOZ I;  3CMA 1;  3CCR 1;  3CCV 1;  1YIJ Z;  3CQZ I;  3PO2 I;  3G71 Z;  4RVD A;  1VQO 1;  2NVQ I;  3NH4 A;  1RQF A;  3EED A;  3CPW Y;  2ZAE B;  4HH4 A;  1SFO I;  1KC8 1;  3LUS A;  4XX2 A;  1ZB8 A;  3CD6 Z;  1VQL 1;  3RZD I;  1QVG Y;  2QKD A;  1TWC I;  4E31 A;  3NFZ A;  3HOW I;  2W03 A;  1ZH1 A;  2JS4 A;  3CCS 1;  2E9H A;  3NDJ A;  2VPX A;  1YJ9 Z;  1FDO A;  2JUB A;  2WAQ A;  1YJ9 1;  1VQ4 Z;  2JA8 I;  5C4J I;  5D1P A;  1KC8 2;  3H3V J;  3CME 1;  1ZB9 A;  2WB1 A;  3GTJ I;  2P3Y A;  1WCM I;  4RVH A;  2VPY A;  1YIT Z;  2GTI A;  1P9N A;  5IP7 I;  2YAD A;  1Q86 2;  2KI7 B;  2JIQ A;  5FLX b;  4X6A I;  3BG0 B;  3GTO I;  3CCU 1;  3J80 f;  2JA6 I;  1TWF I;  2G2K A;  4QTU A;  1YJN Z;  5C3E I;  1VQ7 Z;  1JJ2 Y;  4RV9 A;  5FLX f;  4A3F I;  1WZN A;  1WII A;  2J6A A;  1QVF Y;  3MON A;  4NB8 A;  1VQ6 Z;  2NVT I;  1PFT A;  2HF1 A;  1Q81 2;  2KPI A;  2E2H I;  4MON A;  4MRI A;  3I55 Z;  1VQ8 1;  4E30 A;  3D2L A;  5A2Q b;  1VQN 1;  3I55 1;  1KQS Y;  3S16 I;  3IX0 A;  2R92 I;  5A2Q f;  3S2D I;  3OW2 Y;  5T64 A;  3J7A 4;  1N2F A;  1YHQ Z;  1JWH C;  2R7Z I;  4A3L I;  1NJI 2;  1I50 I;  1L1O C;  2V45 A;  1AA6 A;  2K5R A;  2E2J I;  1Q16 A;  1VQ9 Z;  1VQM Z;  3GTM I;  3FQM A;  2RIQ A;  3VTN A;  1K8A 1;  1JJ2 Z;  4HGZ A;  5CM2 M;  2E7Z A;  4TNU A;  3CC7 1;  2HU9 A;  4E2Z A;  4DQY B;  1QVF Z;  4A3E I;  2QA4 Z;  4CL1 A;  1YIJ 1;  1RLY A;  3CXC Z;  3G71 1;  2R6M A;  2NVX I;  4A3J I;  3GTM S;  2QRE B;  2VPZ A;  3IR7 A;  3IF8 A;  1KQS Z;  2Q51 A;  1K8A 2;  2DE6 A;  4S1T A;  2Y0S A;  3CD6 1;  3VMH A;  4QTT A;  2QRC B;  3OW2 Z;  1S72 Z;  3RZO I;  1TWA I;  1YI2 Z;  3S1N I;  4BY1 I;  1QYP A;  2GU2 A;  1Q86 1;  3CCL Z;  3S1R I;  1YI2 1;  2Q4Z A;  4NBE A;  2RBL A;  3HOY I;  1N8R 1;  1VQ4 1;  3NH5 A;  2BJO A;  1WJ2 A;  3K7A I;  2V8I A;  3I4M I;  3VMI A;  4EWC A;  2DE7 A;  3I56 Z;  2OTJ Z;  4MD7 A;  3Q87 A;  1Q82 1;  3HOV I;  1LQL A;  1Q81 1;  1TWH I;  2QEX Z;  2JA5 I;  1Y1W I;  3J80 b;  3PO3 I;  1YIT 1;  2V8J A;  3JAM f;  1WW9 A;  1VQP Z;  1K73 1;  4BXX I;  2DE5 A;  1Y8C A;  1N8R 2;  2YU9 I;  3D6W A;  1YJN 1;  3GCF A;  1VQ7 1;  2R93 I;  3M4O I;  3HOU I;  2PM9 A;  2E2I I;  1RNI A;  2VPW A;  1QF8 A;  3PO3 S;  1Q82 2;  4RVF A;  3CC4 Z;  4E2X A;  4A3C I;  3CXC Y;  3F3F C;  3CCM Z;  1NJI 1;  2QLV B;  1VQ6 1;  1K83 I;  1K73 2;  2RHB A;  5T67 A;  3F3P C;  3S15 I;  3G6E Z;  3KIF A;  1W2B Z;  2JR6 A;  1VQK Z;  3IFU A;  1K9M 2;  2I3C A;  2OTL Z;  4NOZ A;  5AN9 F;  2JIM A;  2JA7 I;  2JIO A;  3S14 I;  1VQ5 Z;  3CCJ Z;  4NBF A;  3NH8 A;  3GTP I;  5LL6 f;  3CCJ 1;  4E32 A;  5T6B A;  1YHQ 1;  4NBA A;  5D1O B;  1X3Z A;  1NUI A;  3MZL B;  1Y1V I;  2QR1 B;  5C44 I;  4MD8 A;  4NBC A;  3CC2 Z;  3QWU A;  4NBH A;  1VQ9 1;  1USP B;  1VQM 1;  4NH1 C;  3VMG A;  2RPR A;  3CC2 1;  2F4O A;  4BY7 I;  1YJW Z;  3CCQ Z;  2PK7 A;  4NBG A;  3CCE Z;  1YJW 1;  3CCQ 1;  4A3M I;  3VB9 A;  2QA4 1;  5C4X I;  1Y1V S;  4E2W A;  3I07 A;  1DL6 A;  1ML8 A;  1QXF A;  2GTH A;  2NAP A;  3CMA Z;  3CCR Z;  2O4H A;  3CCV Z;  2V3V A;  3HKZ A;  3S1M I;  1VQO Z;  1VLA A;  3GTK I;  3G4S Z;  1X0T A;  1W2B Y;  4A3D I;  1S72 1;  3G4S 1;  1VQL Z;  1S7M A;  3M3Y I;  4Y7N I;  3BG1 B;  3U50 C;  3CCL 1;  4A3G I;  1KD1 1;  2VUM I;  1Q7Y 2;  2M6N A;  1RO2 A;  1I3Q I;  4A93 I;  4A3K I;  3CCS Z;  2JIP A;  3GTL I;  2IZ3 A;  3TE5 B;  4BBS I;  3JAM b;  1NP6 A;  2OZK A;  3P5J B;  2F4M A;  3GTG I;  3I56 1;  2OTJ 1;  4A3I I;  3FKI I;  1Z01 A;  2M48 A;  4RVG A;  2QEX 1;  3CME Z;  2K3R A;  1VQP 1;  1K9M 1;  1TFI A;  3MZK B;  5IP9 I;  1KD1 2;  1M90 1;  3NDI A;  3ESW A;  3T4N B;  2JNY A;  4NFR A;  2IZ4 A;  4A3B I;  3TDH B;  3CCU Z;  2OOX B;  1Z03 A;  3CC4 1;  1RO4 A;  2RT9 A;  1FDI A;  2LIY A;  3EER A;  3CCM 1;  4BBR I;  2OOY B;  3CPW Z;  2LFU A;  2W04 A;  4MD9 A;  5FLM I;  1M90 2;  3G6E 1;  1R9T I;  3KIH A;  1VQK 1;  1RO0 A;  2IV2 X;  1QVG Z;  3GTQ I;  1VQ8 Z;  3H0G I;  2B63 I;  2OTL 1;  2P28 A;  2H85 A;  4NBD A;  2LEX A;  1VQN Z;  1VQ5 1;  1Z02 A;  5IT9 b;  4E33 A;  1KRL A;  2O53 A;  1M1K 1;  2JMO A;  4HGY A;  4NB9 A; 
#chains in the Genus database with same CATH homology
 3J81 b;  4RS4 A;  5IT9 f;  4Y52 I;  1YUA A;  4MH4 A;  3S2H I;  3J81 f;  4NBB A;  3HOX I;  2NVY I;  3S1Q I;  1X3W A;  5D1O A;  3S17 I;  2EGT A;  2PMZ A;  3FQQ A;  4MXU A;  2V8K A;  4AYB A;  4E2Y A;  4DGL A;  1M1K 2;  1TWG I;  1USP A;  3CCE 1;  3I4N I;  3GKQ A;  2VUG A;  1Q7Y 1;  2QRD B;  3CC7 Z;  2VF1 A;  3D9X A;  2AKL A;  4DK1 A;  1I6H I;  1YUK A;  3HOZ I;  3CMA 1;  3CCR 1;  3CCV 1;  1YIJ Z;  3CQZ I;  3PO2 I;  3G71 Z;  4RVD A;  1VQO 1;  2NVQ I;  3NH4 A;  1RQF A;  3EED A;  3CPW Y;  2ZAE B;  4HH4 A;  1SFO I;  1KC8 1;  3LUS A;  4XX2 A;  1ZB8 A;  3CD6 Z;  1VQL 1;  3RZD I;  1QVG Y;  2QKD A;  1TWC I;  4E31 A;  3NFZ A;  3HOW I;  2W03 A;  1ZH1 A;  2JS4 A;  3CCS 1;  2E9H A;  3NDJ A;  1YJ9 Z;  2JUB A;  2WAQ A;  1YJ9 1;  1VQ4 Z;  2JA8 I;  5C4J I;  5D1P A;  1KC8 2;  3H3V J;  3CME 1;  1ZB9 A;  2WB1 A;  3GTJ I;  2P3Y A;  1WCM I;  4RVH A;  1YIT Z;  2GTI A;  1P9N A;  5IP7 I;  2YAD A;  1Q86 2;  2KI7 B;  5FLX b;  4X6A I;  3BG0 B;  3GTO I;  3CCU 1;  3J80 f;  2JA6 I;  1TWF I;  2G2K A;  4QTU A;  1YJN Z;  5C3E I;  1VQ7 Z;  1JJ2 Y;  4RV9 A;  5FLX f;  4A3F I;  1WII A;  2J6A A;  1QVF Y;  3MON A;  4NB8 A;  1VQ6 Z;  2NVT I;  1PFT A;  2HF1 A;  1Q81 2;  2KPI A;  2E2H I;  4MON A;  4MRI A;  3I55 Z;  1VQ8 1;  4E30 A;  5A2Q b;  1VQN 1;  3I55 1;  1KQS Y;  3S16 I;  3IX0 A;  2R92 I;  5A2Q f;  3S2D I;  3OW2 Y;  5T64 A;  3J7A 4;  1N2F A;  1YHQ Z;  1JWH C;  2R7Z I;  4A3L I;  1NJI 2;  1I50 I;  1L1O C;  2K5R A;  2E2J I;  1VQ9 Z;  1VQM Z;  3GTM I;  3FQM A;  2RIQ A;  3VTN A;  1K8A 1;  1JJ2 Z;  4HGZ A;  5CM2 M;  4TNU A;  3CC7 1;  2HU9 A;  4E2Z A;  4DQY B;  1QVF Z;  4A3E I;  2QA4 Z;  4CL1 A;  1YIJ 1;  1RLY A;  3CXC Z;  3G71 1;  2R6M A;  2NVX I;  4A3J I;  3GTM S;  2QRE B;  3IF8 A;  1KQS Z;  2Q51 A;  1K8A 2;  2DE6 A;  4S1T A;  2Y0S A;  3CD6 1;  3VMH A;  4QTT A;  2QRC B;  3OW2 Z;  1S72 Z;  3RZO I;  1TWA I;  1YI2 Z;  3S1N I;  4BY1 I;  1QYP A;  2GU2 A;  1Q86 1;  3CCL Z;  3S1R I;  1YI2 1;  2Q4Z A;  4NBE A;  2RBL A;  3HOY I;  1N8R 1;  1VQ4 1;  3NH5 A;  2BJO A;  3K7A I;  2V8I A;  3I4M I;  3VMI A;  4EWC A;  2DE7 A;  3I56 Z;  2OTJ Z;  4MD7 A;  3Q87 A;  1Q82 1;  3HOV I;  1LQL A;  1Q81 1;  1TWH I;  2QEX Z;  2JA5 I;  1Y1W I;  3J80 b;  3PO3 I;  1YIT 1;  2V8J A;  3JAM f;  1WW9 A;  1VQP Z;  1K73 1;  4BXX I;  2DE5 A;  1N8R 2;  2YU9 I;  3D6W A;  1YJN 1;  3GCF A;  1VQ7 1;  2R93 I;  3M4O I;  3HOU I;  2PM9 A;  2E2I I;  1RNI A;  1QF8 A;  3PO3 S;  1Q82 2;  4RVF A;  3CC4 Z;  4E2X A;  4A3C I;  3CXC Y;  3F3F C;  3CCM Z;  1NJI 1;  2QLV B;  1VQ6 1;  1K83 I;  1K73 2;  2RHB A;  5T67 A;  3F3P C;  3S15 I;  3G6E Z;  3KIF A;  1W2B Z;  2JR6 A;  1VQK Z;  3IFU A;  1K9M 2;  2I3C A;  2OTL Z;  4NOZ A;  5AN9 F;  2JA7 I;  3S14 I;  1VQ5 Z;  3CCJ Z;  4NBF A;  3NH8 A;  3GTP I;  5LL6 f;  3CCJ 1;  4E32 A;  5T6B A;  1YHQ 1;  4NBA A;  5D1O B;  1X3Z A;  1NUI A;  3MZL B;  1Y1V I;  2QR1 B;  5C44 I;  4MD8 A;  4NBC A;  3CC2 Z;  3QWU A;  4NBH A;  1VQ9 1;  1USP B;  1VQM 1;  4NH1 C;  3VMG A;  2RPR A;  3CC2 1;  2F4O A;  4BY7 I;  1YJW Z;  3CCQ Z;  2PK7 A;  4NBG A;  3CCE Z;  1YJW 1;  3CCQ 1;  4A3M I;  3VB9 A;  2QA4 1;  5C4X I;  1Y1V S;  4E2W A;  3I07 A;  1DL6 A;  1ML8 A;  2GTH A;  3CMA Z;  3CCR Z;  2O4H A;  3CCV Z;  3HKZ A;  3S1M I;  1VQO Z;  1VLA A;  3GTK I;  3G4S Z;  1X0T A;  1W2B Y;  4A3D I;  1S72 1;  3G4S 1;  1VQL Z;  1S7M A;  3M3Y I;  4Y7N I;  3BG1 B;  3U50 C;  3CCL 1;  4A3G I;  1KD1 1;  2VUM I;  1Q7Y 2;  2M6N A;  1RO2 A;  1I3Q I;  4A93 I;  4A3K I;  3CCS Z;  3GTL I;  2IZ3 A;  3TE5 B;  4BBS I;  3JAM b;  1NP6 A;  2OZK A;  3P5J B;  2F4M A;  3GTG I;  3I56 1;  2OTJ 1;  4A3I I;  3FKI I;  1Z01 A;  2M48 A;  4RVG A;  2QEX 1;  3CME Z;  2K3R A;  1VQP 1;  1K9M 1;  1TFI A;  3MZK B;  5IP9 I;  1KD1 2;  1M90 1;  3NDI A;  3ESW A;  3T4N B;  2JNY A;  4NFR A;  2IZ4 A;  4A3B I;  3TDH B;  3CCU Z;  2OOX B;  1Z03 A;  3CC4 1;  1RO4 A;  2RT9 A;  2LIY A;  3EER A;  3CCM 1;  4BBR I;  2OOY B;  3CPW Z;  2LFU A;  2W04 A;  4MD9 A;  5FLM I;  1M90 2;  3G6E 1;  1R9T I;  3KIH A;  1VQK 1;  1RO0 A;  1QVG Z;  3GTQ I;  1VQ8 Z;  3H0G I;  2B63 I;  2OTL 1;  2P28 A;  2H85 A;  4NBD A;  1VQN Z;  1VQ5 1;  1Z02 A;  5IT9 b;  4E33 A;  1KRL A;  2O53 A;  1M1K 1;  2JMO A;  4HGY A;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...