2NVYI

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvyI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvyI02
1TWGI 3S2HI 3S1RI 3Q87A 4NBCA 3VB9A 3VMIA 2JA7I 3M3YI 4A3CI 4Y7NI 1L1OC 2VUMI 1ML8A 4A93I 2DE5A 2JA6I 3VMGA 4A3LI 4X6AI 3GTPI 3S17I 1I6HI 3HOVI 3HOUI 2JS4A 3I07A 3S1MI 3HOZI 1ZB9A 4XX2A 4BY1I 4A3MI 4BBSI 1NUIA 3RZOI 4MH4A 2B63I 2P3YA 3S16I 4NBAA 3GCFA 3S14I 1K83I 2F4MA 5C4XI 3HOWI 1Y1VI 4BBRI 3K7AI 4NBHA 3I4NI 4BY7I 4A3GI 2E2HI 2AKLA 2J6AA 2R93I 3M4OI 3S2DI 1I3QI 1WCMI 4BXXI 2PK7A 3U50C 2JA8I 4NBBA 3GTMS 1PFTA 2RBLA 1R9TI 5IP7I 2R92I 1TWCI 5FLMI 3HOXI 3GTLI 1TWHI 1RO4A 3PO3I 3GTGI 4NBEA 3FKII 1LQLA 2YU9I 3EERA 4NBFA 3GTJI 2JNYA 4QTUA 1X3ZA 2F4OA 4A3EI 1RLYA 1TFIA 5IP9I 1SFOI 2HF1A 3D6WA 2K5RA 4A3JI 1TWFI 3PO2I 4NB8A 4A3DI 3S1NI 3S1QI 4Y52I 4A3FI 3GKQA 3GTQI 2R7ZI 2DE7A 1WW9A 5C3EI 2BJOA 1USPB 2NVQI 1DL6A 3GTKI 1YUAA 3S15I 2E2JI 1I50I 4QTTA 3ESWA 3RZDI 1Y1VS 5C4JI 2NVXI 4NBDA 2DE6A 2NVTI 1ZB8A 1VLAA 1Y1WI 3I4MI 4NOZA 4A3KI 2KPIA 3HOYI 1N2FA 3CQZI 2JA5I 1USPA 3LUSA 5CM2M 5C44I 3H3VJ 3PO3S 4A3BI 3GTOI 4NBGA 1X3WA 3GTMI 2NVYI 2E2II 1TWAI 2JR6A 3H0GI 3VMHA 4A3II 4NB9A 1QYPA
chains in the Genus database with same CATH superfamily
5FLXb 1Q16A 3CCU1 1RO2A 4Y7NI 2VUMI 1ML8A 1JJ2Y 4CL1A 3CXCY 1KD12 2JA6I 4DGLA 1QVFZ 1M1K2 3I551 1QF8A 1Z02A 4BBSI 2M48A 1VQM1 4MH4A 5T6BA 1KQSY 2B63I 4RS4A 3CCVZ 4RVDA 1AA6A 1QXFA 3NH4A 3G4SZ 3GCFA 1YIJ1 3S14I 2F4MA 4MD7A 2VPYA 2PMZA 3D9XA 3IF8A 1Q822 2AYDA 1Q812 3I4NI 1WJ2A 4A3GI 2AKLA 2R93I 3CCM1 1K732 4BXXI 1ZH1A 2P28A 4NBBA 3CCQ1 5A2Qf 1KRLA 3CCJZ 1NJI2 1TWCI 1VQ7Z 4E2WA 5FLMI 3HOXI 1YI21 1VQLZ 3PO3I 1YJ91 3GTGI 2RHBA 1VQ91 2G2KA 2EGTA 2F4OA 2RPRA 2V3VA 5FLXf 1TFIA 1TWFI 4MD9A 3CC21 4A3DI 3S1NI 3S1QI 4HH4A 3CCL1 3GKQA 2R7ZI 1VQ5Z 3P5JB 2BJOA 3CCSZ 1QVGZ 2IZ3A 3NH8A 1S72Z 1RNIA 3GTKI 2E2JI 4E33A 2V8IA 3ESWA 1M902 1P9NA 2JMOA 4NBDA 4NH1C 1ZB8A 3I4MI 4NOZA 1W2BZ 1YHQ1 4A3KI 2QRDB 3HOYI 4S1TA 3LUSA 1SIWA 2IZ4A 3BG1B 1VQ41 4NFRA 1X3WA 2QLVB 2H85A 2Q51A 2JR6A 2O4HA 3BG0B 3H0GI 3QWUA 1K9M1 1QYPA 3CMEZ 3S2HI 3VB9A 4A3CI 2VF1A 1WZNA 3G6EZ 1QVGY 4A93I 4MD8A 2Q4ZA 4X6AI 3GTPI 3S17I 2JS4A 3I07A 3S1MI 3CD6Z 1YJNZ 3RZOI 3D2LA 2M6NA 2P3YA 1VQKZ 3S16I 2VUGA 1K83I 5AN9F 3NDJA 2GTHA 1W2BY 3OW2Z 2VPWA 3K7AI 1NP6A 1WCMI 2JIRA 4MXUA 3CC71 3U50C 4AYBA 3CCV1 3CCRZ 3F3PC 3G4S1 2RBLA 3TE5B 5IP7I 2R92I 3F3FC 5D1PA 2VPXA 1LQLA 3FKII 2IV2X 3EERA 1VQ8Z 2YU9I 3CC7Z 2JNYA 3CCEZ 3CCJ1 2OTJZ 3KIHA 5IP9I 1SFOI 2HF1A 4HGYA 3CPWZ 3D6WA 2K5RA 2NAPA 1VQ71 3J7A4 1VQL1 4A3FI 3FQMA 2DE7A 2QA4Z 1YUAA 3S15I 4QTTA 1VQOZ 3NFZA 2I3CA 3OW2Y 4E32A 3RZDI 1Y1VS 2W03A 4E2XA 3KIFA 5C4JI 1VQ51 2NVXI 3CCS1 2DE6A 2NVTI 2JIOA 1S721 5D1OB 1K9M2 1YITZ 4E2YA 5CM2M 5C44I 2JIMA 2QEXZ 1FDIA 2GU2A 2E2II 1TWAI 3VMHA 3CC4Z 1Z03A 2ZAEB 3CPWY 1Y8CA 5T64A 1TWGI 1K8A1 4NBCA 3NDIA 3M3YI 1VQNZ 2OOXB 1L1OC 5T67A 1Q7Y1 4E30A 3HOVI 3CME1 1ZB9A 4XX2A 2OTLZ 3MZLB 4BY1I 1NUIA 1WIIA 3G6E1 4NBAA 3HOWI 2V8KA 1Z01A 2OOYB 2V45A 1Y1VI 4BBRI 4NBHA 3CD61 3MZKB 1YJN1 2OZKA 2PK7A 2JA8I 1VQK1 1VQPZ 3GTMS 1PFTA 1R9TI 1YJWZ 1TWHI 1RO4A 2GTIA 2QKDA 1JWHC 4NBFA 1YUKA 2R6MA 4QTUA 4A3EI 3CCR1 2JIPA 2QREB 4A3JI 3PO2I 4NB8A 4Y52I 2O53A 3HKZA 1VQ81 3I56Z 3CCE1 4EWCA 1USPB 2OTJ1 1VQ6Z 2NVQI 1DL6A 2JIQA 1I50I 3CMAZ 3J80b 2KI7B 2QA41 1RO0A 2PM9A 1VQO1 2KPIA 1N2FA 1USPA 2WAQA 1K8A2 2E7ZA 3H3VJ 5IT9b 3CCUZ 2VPZA 1RQFA 2LFUA 4A3BI 3GTMI 1N8R1 1Q7Y2 4A3II 1YIT1 3I55Z 1Q861 4RVGA 3S1RI 3Q87A 2JA7I 3VMIA 4E2ZA 1VQMZ 5LL6f 2QEX1 2HU9A 2V8JA 2WB1A 2JUBA 3TDHB 1KC81 2DE5A 1YIJZ 3CC41 3NH5A 3VMGA 4A3LI 2QR1B 1I6HI 3HOUI 3HOZI 4TNUA 2YADA 4A3MI 2RT9A 3J80f 3T4NB 3CCMZ 1VQN1 3J81b 3CCQZ 3FQQA 1KD11 4RVFA 5C4XI 1X0TA 5D1OA 2W04A 1YI2Z 1M1K1 2K3RA 4MONA 4BY7I 2E2HI 2E9HA 2J6AA 1YJ9Z 2OTL1 1QVFY 3VTNA 3M4OI 3S2DI 1VQ9Z 1I3QI 4E31A 5IT9f 3G711 2LEXA 3IR7A 3GTLI 3CC2Z 1Q821 1Q811 3CCLZ 4NBEA 1K731 3GTJI 3G71Z 1X3ZA 1FDOA 2QRCB 1RLYA 3JAMb 1VQP1 1NJI1 1S7MA 1YJW1 4DK1A 4DQYB 2Y0SA 3GTQI 1WW9A 5C3EI 1JJ2Z 3CXCZ 2RIQA 3J81f 1YHQZ 4RVHA 4RV9A 3IX0A 3I561 1KQSZ 1VQ4Z 2LIYA 1N8R2 1VLAA 1Y1WI 1VQ61 3IFUA 3CMA1 3CQZI 2JA5I 1Q862 4HGZA 4MRIA 3EEDA 1M901 5A2Qb 3PO3S 3GTOI 4NBGA 2NVYI 1KC82 3MONA 4NB9A 3JAMf
chains in the Genus database with same CATH topology
5FLXb 3CCU1 1RO2A 4Y7NI 2VUMI 1ML8A 1JJ2Y 4CL1A 3CXCY 1KD12 2JA6I 4DGLA 1QVFZ 1M1K2 3I551 1QF8A 1Z02A 4BBSI 2M48A 1VQM1 4MH4A 5T6BA 1KQSY 2B63I 4RS4A 3CCVZ 4RVDA 1YIJ1 3NH4A 3G4SZ 3GCFA 3S14I 2F4MA 4MD7A 2PMZA 3D9XA 3IF8A 1Q822 3I4NI 1Q812 4A3GI 2AKLA 2R93I 3CCM1 1K732 4BXXI 1ZH1A 2P28A 4NBBA 3CCQ1 5A2Qf 1KRLA 3CCJZ 1NJI2 1TWCI 1VQ7Z 4E2WA 5FLMI 3HOXI 1YI21 1VQLZ 3PO3I 1YJ91 3GTGI 2RHBA 1VQ91 2G2KA 2EGTA 2F4OA 2RPRA 5FLXf 1TFIA 1TWFI 4MD9A 3CC21 4A3DI 3S1NI 3S1QI 4HH4A 3CCL1 3GKQA 2R7ZI 1VQ5Z 3P5JB 2BJOA 3CCSZ 1QVGZ 2IZ3A 3NH8A 1S72Z 1RNIA 3GTKI 2E2JI 4E33A 2V8IA 3ESWA 1M902 1P9NA 2JMOA 4NBDA 4NH1C 1ZB8A 3I4MI 4NOZA 1W2BZ 1YHQ1 4A3KI 2QRDB 3HOYI 4S1TA 3LUSA 2IZ4A 3BG1B 1VQ41 4NFRA 1X3WA 2QLVB 2H85A 2Q51A 2JR6A 2O4HA 3BG0B 3H0GI 3QWUA 1K9M1 1QYPA 3CMEZ 3S2HI 3VB9A 4A3CI 2VF1A 3G6EZ 1QVGY 4A93I 4MD8A 2Q4ZA 4X6AI 3GTPI 3S17I 2JS4A 3I07A 3S1MI 3CD6Z 1YJNZ 3RZOI 2M6NA 2P3YA 1VQKZ 3S16I 2VUGA 1K83I 5AN9F 3NDJA 2GTHA 1W2BY 3OW2Z 3K7AI 1NP6A 1WCMI 4MXUA 3CC71 3U50C 4AYBA 3CCV1 3CCRZ 3F3PC 3G4S1 2RBLA 3TE5B 5IP7I 2R92I 3F3FC 5D1PA 3FKII 1LQLA 2YU9I 3EERA 1VQ8Z 3CC7Z 2JNYA 3CCEZ 3CCJ1 2OTJZ 3KIHA 5IP9I 1SFOI 2HF1A 4HGYA 3CPWZ 3D6WA 2K5RA 1VQ71 3J7A4 1VQL1 4A3FI 3FQMA 2DE7A 2QA4Z 1YUAA 3S15I 4QTTA 1VQOZ 3NFZA 2I3CA 3OW2Y 4E32A 3RZDI 1Y1VS 2W03A 4E2XA 3KIFA 5C4JI 1VQ51 2NVXI 3CCS1 2DE6A 2NVTI 1S721 5D1OB 1K9M2 1YITZ 4E2YA 5CM2M 5C44I 2QEXZ 2GU2A 2E2II 1TWAI 3VMHA 3CC4Z 1Z03A 2ZAEB 3CPWY 5T64A 1TWGI 1K8A1 4NBCA 3NDIA 3M3YI 1VQNZ 2OOXB 1L1OC 5T67A 1Q7Y1 4E30A 3HOVI 3CME1 1ZB9A 4XX2A 2OTLZ 3MZLB 4BY1I 1NUIA 1WIIA 3G6E1 4NBAA 3HOWI 2V8KA 1Z01A 2OOYB 1Y1VI 4BBRI 4NBHA 3CD61 3MZKB 1YJN1 2OZKA 2PK7A 2JA8I 1VQK1 1VQPZ 3GTMS 1PFTA 1R9TI 1YJWZ 1TWHI 1RO4A 2GTIA 2QKDA 1JWHC 4NBFA 1YUKA 2R6MA 4QTUA 4A3EI 3CCR1 2QREB 4A3JI 3PO2I 4NB8A 4Y52I 2O53A 3HKZA 1VQ81 3I56Z 3CCE1 4EWCA 1USPB 2OTJ1 1VQ6Z 2NVQI 1DL6A 1I50I 3CMAZ 3J80b 2KI7B 2QA41 1RO0A 2PM9A 1VQO1 2KPIA 1N2FA 1USPA 2WAQA 1K8A2 3H3VJ 5IT9b 3CCUZ 1RQFA 2LFUA 4A3BI 3GTMI 1N8R1 1Q7Y2 4A3II 1YIT1 3I55Z 1Q861 4RVGA 3S1RI 3Q87A 2JA7I 3VMIA 4E2ZA 1VQMZ 5LL6f 2QEX1 2HU9A 2V8JA 2WB1A 2JUBA 3TDHB 1KC81 2DE5A 1YIJZ 3CC41 3NH5A 3VMGA 4A3LI 2QR1B 1I6HI 3HOUI 3HOZI 4TNUA 2YADA 4A3MI 2RT9A 3J80f 3T4NB 3CCMZ 1VQN1 3J81b 3CCQZ 3FQQA 1KD11 4RVFA 5C4XI 1X0TA 5D1OA 2W04A 1YI2Z 1M1K1 2K3RA 4MONA 4BY7I 2E2HI 2E9HA 2J6AA 1YJ9Z 2OTL1 1QVFY 3VTNA 3M4OI 3S2DI 1VQ9Z 1I3QI 4E31A 5IT9f 3G711 3GTLI 3CC2Z 1Q821 1Q811 3CCLZ 4NBEA 1K731 3GTJI 3G71Z 1X3ZA 2QRCB 1RLYA 3JAMb 1VQP1 1NJI1 1S7MA 1YJW1 4DK1A 4DQYB 2Y0SA 3GTQI 1WW9A 5C3EI 1JJ2Z 3CXCZ 2RIQA 3J81f 1YHQZ 4RVHA 4RV9A 3IX0A 3I561 1KQSZ 1VQ4Z 2LIYA 1N8R2 1VLAA 1Y1WI 1VQ61 3IFUA 3CMA1 3CQZI 2JA5I 1Q862 4HGZA 4MRIA 3EEDA 1M901 5A2Qb 3PO3S 3GTOI 4NBGA 2NVYI 1KC82 3MONA 4NB9A 3JAMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG I;  3S2H I;  3S1R I;  3Q87 A;  4NBC A;  3VB9 A;  3VMI A;  2JA7 I;  3M3Y I;  4A3C I;  4Y7N I;  1L1O C;  2VUM I;  1ML8 A;  4A93 I;  2DE5 A;  2JA6 I;  3VMG A;  4A3L I;  4X6A I;  3GTP I;  3S17 I;  1I6H I;  3HOV I;  3HOU I;  2JS4 A;  3I07 A;  3S1M I;  3HOZ I;  1ZB9 A;  4XX2 A;  4BY1 I;  4A3M I;  4BBS I;  1NUI A;  3RZO I;  4MH4 A;  2B63 I;  2P3Y A;  3S16 I;  4NBA A;  3GCF A;  3S14 I;  1K83 I;  2F4M A;  5C4X I;  3HOW I;  1Y1V I;  4BBR I;  3K7A I;  4NBH A;  3I4N I;  4BY7 I;  4A3G I;  2E2H I;  2AKL A;  2J6A A;  2R93 I;  3M4O I;  3S2D I;  1I3Q I;  1WCM I;  4BXX I;  2PK7 A;  3U50 C;  2JA8 I;  4NBB A;  3GTM S;  1PFT A;  2RBL A;  1R9T I;  5IP7 I;  2R92 I;  1TWC I;  5FLM I;  3HOX I;  3GTL I;  1TWH I;  1RO4 A;  3PO3 I;  3GTG I;  4NBE A;  3FKI I;  1LQL A;  2YU9 I;  3EER A;  4NBF A;  3GTJ I;  2JNY A;  4QTU A;  1X3Z A;  2F4O A;  4A3E I;  1RLY A;  1TFI A;  5IP9 I;  1SFO I;  2HF1 A;  3D6W A;  2K5R A;  4A3J I;  1TWF I;  3PO2 I;  4NB8 A;  4A3D I;  3S1N I;  3S1Q I;  4Y52 I;  4A3F I;  3GKQ A;  3GTQ I;  2R7Z I;  2DE7 A;  1WW9 A;  5C3E I;  2BJO A;  1USP B;  2NVQ I;  1DL6 A;  3GTK I;  1YUA A;  3S15 I;  2E2J I;  1I50 I;  4QTT A;  3ESW A;  3RZD I;  1Y1V S;  5C4J I;  2NVX I;  4NBD A;  2DE6 A;  2NVT I;  1ZB8 A;  1VLA A;  1Y1W I;  3I4M I;  4NOZ A;  4A3K I;  2KPI A;  3HOY I;  1N2F A;  3CQZ I;  2JA5 I;  1USP A;  3LUS A;  5CM2 M;  5C44 I;  3H3V J;  3PO3 S;  4A3B I;  3GTO I;  4NBG A;  1X3W A;  3GTM I;  2NVY I;  2E2I I;  1TWA I;  2JR6 A;  3H0G I;  3VMH A;  4A3I I;  4NB9 A;  1QYP A; 
#chains in the Genus database with same CATH topology
 5FLX b;  1Q16 A;  3CCU 1;  1RO2 A;  4Y7N I;  2VUM I;  1ML8 A;  1JJ2 Y;  4CL1 A;  3CXC Y;  1KD1 2;  2JA6 I;  4DGL A;  1QVF Z;  1M1K 2;  3I55 1;  1QF8 A;  1Z02 A;  4BBS I;  2M48 A;  1VQM 1;  4MH4 A;  5T6B A;  1KQS Y;  2B63 I;  4RS4 A;  3CCV Z;  4RVD A;  1AA6 A;  1QXF A;  3NH4 A;  3G4S Z;  3GCF A;  1YIJ 1;  3S14 I;  2F4M A;  4MD7 A;  2VPY A;  2PMZ A;  3D9X A;  3IF8 A;  1Q82 2;  2AYD A;  1Q81 2;  3I4N I;  1WJ2 A;  4A3G I;  2AKL A;  2R93 I;  3CCM 1;  1K73 2;  4BXX I;  1ZH1 A;  2P28 A;  4NBB A;  3CCQ 1;  5A2Q f;  1KRL A;  3CCJ Z;  1NJI 2;  1TWC I;  1VQ7 Z;  4E2W A;  5FLM I;  3HOX I;  1YI2 1;  1VQL Z;  3PO3 I;  1YJ9 1;  3GTG I;  2RHB A;  1VQ9 1;  2G2K A;  2EGT A;  2F4O A;  2RPR A;  2V3V A;  5FLX f;  1TFI A;  1TWF I;  4MD9 A;  3CC2 1;  4A3D I;  3S1N I;  3S1Q I;  4HH4 A;  3CCL 1;  3GKQ A;  2R7Z I;  1VQ5 Z;  3P5J B;  2BJO A;  3CCS Z;  1QVG Z;  2IZ3 A;  3NH8 A;  1S72 Z;  1RNI A;  3GTK I;  2E2J I;  4E33 A;  2V8I A;  3ESW A;  1M90 2;  1P9N A;  2JMO A;  4NBD A;  4NH1 C;  1ZB8 A;  3I4M I;  4NOZ A;  1W2B Z;  1YHQ 1;  4A3K I;  2QRD B;  3HOY I;  4S1T A;  3LUS A;  1SIW A;  2IZ4 A;  3BG1 B;  1VQ4 1;  4NFR A;  1X3W A;  2QLV B;  2H85 A;  2Q51 A;  2JR6 A;  2O4H A;  3BG0 B;  3H0G I;  3QWU A;  1K9M 1;  1QYP A;  3CME Z;  3S2H I;  3VB9 A;  4A3C I;  2VF1 A;  1WZN A;  3G6E Z;  1QVG Y;  4A93 I;  4MD8 A;  2Q4Z A;  4X6A I;  3GTP I;  3S17 I;  2JS4 A;  3I07 A;  3S1M I;  3CD6 Z;  1YJN Z;  3RZO I;  3D2L A;  2M6N A;  2P3Y A;  1VQK Z;  3S16 I;  2VUG A;  1K83 I;  5AN9 F;  3NDJ A;  2GTH A;  1W2B Y;  3OW2 Z;  2VPW A;  3K7A I;  1NP6 A;  1WCM I;  2JIR A;  4MXU A;  3CC7 1;  3U50 C;  4AYB A;  3CCV 1;  3CCR Z;  3F3P C;  3G4S 1;  2RBL A;  3TE5 B;  5IP7 I;  2R92 I;  3F3F C;  5D1P A;  2VPX A;  1LQL A;  3FKI I;  2IV2 X;  3EER A;  1VQ8 Z;  2YU9 I;  3CC7 Z;  2JNY A;  3CCE Z;  3CCJ 1;  2OTJ Z;  3KIH A;  5IP9 I;  1SFO I;  2HF1 A;  4HGY A;  3CPW Z;  3D6W A;  2K5R A;  2NAP A;  1VQ7 1;  3J7A 4;  1VQL 1;  4A3F I;  3FQM A;  2DE7 A;  2QA4 Z;  1YUA A;  3S15 I;  4QTT A;  1VQO Z;  3NFZ A;  2I3C A;  3OW2 Y;  4E32 A;  3RZD I;  1Y1V S;  2W03 A;  4E2X A;  3KIF A;  5C4J I;  1VQ5 1;  2NVX I;  3CCS 1;  2DE6 A;  2NVT I;  2JIO A;  1S72 1;  5D1O B;  1K9M 2;  1YIT Z;  4E2Y A;  5CM2 M;  5C44 I;  2JIM A;  2QEX Z;  1FDI A;  2GU2 A;  2E2I I;  1TWA I;  3VMH A;  3CC4 Z;  1Z03 A;  2ZAE B;  3CPW Y;  1Y8C A;  5T64 A;  1TWG I;  1K8A 1;  4NBC A;  3NDI A;  3M3Y I;  1VQN Z;  2OOX B;  1L1O C;  5T67 A;  1Q7Y 1;  4E30 A;  3HOV I;  3CME 1;  1ZB9 A;  4XX2 A;  2OTL Z;  3MZL B;  4BY1 I;  1NUI A;  1WII A;  3G6E 1;  4NBA A;  3HOW I;  2V8K A;  1Z01 A;  2OOY B;  2V45 A;  1Y1V I;  4BBR I;  4NBH A;  3CD6 1;  3MZK B;  1YJN 1;  2OZK A;  2PK7 A;  2JA8 I;  1VQK 1;  1VQP Z;  3GTM S;  1PFT A;  1R9T I;  1YJW Z;  1TWH I;  1RO4 A;  2GTI A;  2QKD A;  1JWH C;  4NBF A;  1YUK A;  2R6M A;  4QTU A;  4A3E I;  3CCR 1;  2JIP A;  2QRE B;  4A3J I;  3PO2 I;  4NB8 A;  4Y52 I;  2O53 A;  3HKZ A;  1VQ8 1;  3I56 Z;  3CCE 1;  4EWC A;  1USP B;  2OTJ 1;  1VQ6 Z;  2NVQ I;  1DL6 A;  2JIQ A;  1I50 I;  3CMA Z;  3J80 b;  2KI7 B;  2QA4 1;  1RO0 A;  2PM9 A;  1VQO 1;  2KPI A;  1N2F A;  1USP A;  2WAQ A;  1K8A 2;  2E7Z A;  3H3V J;  5IT9 b;  3CCU Z;  2VPZ A;  1RQF A;  2LFU A;  4A3B I;  3GTM I;  1N8R 1;  1Q7Y 2;  4A3I I;  1YIT 1;  3I55 Z;  1Q86 1;  4RVG A;  3S1R I;  3Q87 A;  2JA7 I;  3VMI A;  4E2Z A;  1VQM Z;  5LL6 f;  2QEX 1;  2HU9 A;  2V8J A;  2WB1 A;  2JUB A;  3TDH B;  1KC8 1;  2DE5 A;  1YIJ Z;  3CC4 1;  3NH5 A;  3VMG A;  4A3L I;  2QR1 B;  1I6H I;  3HOU I;  3HOZ I;  4TNU A;  2YAD A;  4A3M I;  2RT9 A;  3J80 f;  3T4N B;  3CCM Z;  1VQN 1;  3J81 b;  3CCQ Z;  3FQQ A;  1KD1 1;  4RVF A;  5C4X I;  1X0T A;  5D1O A;  2W04 A;  1YI2 Z;  1M1K 1;  2K3R A;  4MON A;  4BY7 I;  2E2H I;  2E9H A;  2J6A A;  1YJ9 Z;  2OTL 1;  1QVF Y;  3VTN A;  3M4O I;  3S2D I;  1VQ9 Z;  1I3Q I;  4E31 A;  5IT9 f;  3G71 1;  2LEX A;  3IR7 A;  3GTL I;  3CC2 Z;  1Q82 1;  1Q81 1;  3CCL Z;  4NBE A;  1K73 1;  3GTJ I;  3G71 Z;  1X3Z A;  1FDO A;  2QRC B;  1RLY A;  3JAM b;  1VQP 1;  1NJI 1;  1S7M A;  1YJW 1;  4DK1 A;  4DQY B;  2Y0S A;  3GTQ I;  1WW9 A;  5C3E I;  1JJ2 Z;  3CXC Z;  2RIQ A;  3J81 f;  1YHQ Z;  4RVH A;  4RV9 A;  3IX0 A;  3I56 1;  1KQS Z;  1VQ4 Z;  2LIY A;  1N8R 2;  1VLA A;  1Y1W I;  1VQ6 1;  3IFU A;  3CMA 1;  3CQZ I;  2JA5 I;  1Q86 2;  4HGZ A;  4MRI A;  3EED A;  1M90 1;  5A2Q b;  3PO3 S;  3GTO I;  4NBG A;  2NVY I;  1KC8 2;  3MON A;  4NB9 A;  3JAM f; 
#chains in the Genus database with same CATH homology
 5FLX b;  3CCU 1;  1RO2 A;  4Y7N I;  2VUM I;  1ML8 A;  1JJ2 Y;  4CL1 A;  3CXC Y;  1KD1 2;  2JA6 I;  4DGL A;  1QVF Z;  1M1K 2;  3I55 1;  1QF8 A;  1Z02 A;  4BBS I;  2M48 A;  1VQM 1;  4MH4 A;  5T6B A;  1KQS Y;  2B63 I;  4RS4 A;  3CCV Z;  4RVD A;  1YIJ 1;  3NH4 A;  3G4S Z;  3GCF A;  3S14 I;  2F4M A;  4MD7 A;  2PMZ A;  3D9X A;  3IF8 A;  1Q82 2;  3I4N I;  1Q81 2;  4A3G I;  2AKL A;  2R93 I;  3CCM 1;  1K73 2;  4BXX I;  1ZH1 A;  2P28 A;  4NBB A;  3CCQ 1;  5A2Q f;  1KRL A;  3CCJ Z;  1NJI 2;  1TWC I;  1VQ7 Z;  4E2W A;  5FLM I;  3HOX I;  1YI2 1;  1VQL Z;  3PO3 I;  1YJ9 1;  3GTG I;  2RHB A;  1VQ9 1;  2G2K A;  2EGT A;  2F4O A;  2RPR A;  5FLX f;  1TFI A;  1TWF I;  4MD9 A;  3CC2 1;  4A3D I;  3S1N I;  3S1Q I;  4HH4 A;  3CCL 1;  3GKQ A;  2R7Z I;  1VQ5 Z;  3P5J B;  2BJO A;  3CCS Z;  1QVG Z;  2IZ3 A;  3NH8 A;  1S72 Z;  1RNI A;  3GTK I;  2E2J I;  4E33 A;  2V8I A;  3ESW A;  1M90 2;  1P9N A;  2JMO A;  4NBD A;  4NH1 C;  1ZB8 A;  3I4M I;  4NOZ A;  1W2B Z;  1YHQ 1;  4A3K I;  2QRD B;  3HOY I;  4S1T A;  3LUS A;  2IZ4 A;  3BG1 B;  1VQ4 1;  4NFR A;  1X3W A;  2QLV B;  2H85 A;  2Q51 A;  2JR6 A;  2O4H A;  3BG0 B;  3H0G I;  3QWU A;  1K9M 1;  1QYP A;  3CME Z;  3S2H I;  3VB9 A;  4A3C I;  2VF1 A;  3G6E Z;  1QVG Y;  4A93 I;  4MD8 A;  2Q4Z A;  4X6A I;  3GTP I;  3S17 I;  2JS4 A;  3I07 A;  3S1M I;  3CD6 Z;  1YJN Z;  3RZO I;  2M6N A;  2P3Y A;  1VQK Z;  3S16 I;  2VUG A;  1K83 I;  5AN9 F;  3NDJ A;  2GTH A;  1W2B Y;  3OW2 Z;  3K7A I;  1NP6 A;  1WCM I;  4MXU A;  3CC7 1;  3U50 C;  4AYB A;  3CCV 1;  3CCR Z;  3F3P C;  3G4S 1;  2RBL A;  3TE5 B;  5IP7 I;  2R92 I;  3F3F C;  5D1P A;  3FKI I;  1LQL A;  2YU9 I;  3EER A;  1VQ8 Z;  3CC7 Z;  2JNY A;  3CCE Z;  3CCJ 1;  2OTJ Z;  3KIH A;  5IP9 I;  1SFO I;  2HF1 A;  4HGY A;  3CPW Z;  3D6W A;  2K5R A;  1VQ7 1;  3J7A 4;  1VQL 1;  4A3F I;  3FQM A;  2DE7 A;  2QA4 Z;  1YUA A;  3S15 I;  4QTT A;  1VQO Z;  3NFZ A;  2I3C A;  3OW2 Y;  4E32 A;  3RZD I;  1Y1V S;  2W03 A;  4E2X A;  3KIF A;  5C4J I;  1VQ5 1;  2NVX I;  3CCS 1;  2DE6 A;  2NVT I;  1S72 1;  5D1O B;  1K9M 2;  1YIT Z;  4E2Y A;  5CM2 M;  5C44 I;  2QEX Z;  2GU2 A;  2E2I I;  1TWA I;  3VMH A;  3CC4 Z;  1Z03 A;  2ZAE B;  3CPW Y;  5T64 A;  1TWG I;  1K8A 1;  4NBC A;  3NDI A;  3M3Y I;  1VQN Z;  2OOX B;  1L1O C;  5T67 A;  1Q7Y 1;  4E30 A;  3HOV I;  3CME 1;  1ZB9 A;  4XX2 A;  2OTL Z;  3MZL B;  4BY1 I;  1NUI A;  1WII A;  3G6E 1;  4NBA A;  3HOW I;  2V8K A;  1Z01 A;  2OOY B;  1Y1V I;  4BBR I;  4NBH A;  3CD6 1;  3MZK B;  1YJN 1;  2OZK A;  2PK7 A;  2JA8 I;  1VQK 1;  1VQP Z;  3GTM S;  1PFT A;  1R9T I;  1YJW Z;  1TWH I;  1RO4 A;  2GTI A;  2QKD A;  1JWH C;  4NBF A;  1YUK A;  2R6M A;  4QTU A;  4A3E I;  3CCR 1;  2QRE B;  4A3J I;  3PO2 I;  4NB8 A;  4Y52 I;  2O53 A;  3HKZ A;  1VQ8 1;  3I56 Z;  3CCE 1;  4EWC A;  1USP B;  2OTJ 1;  1VQ6 Z;  2NVQ I;  1DL6 A;  1I50 I;  3CMA Z;  3J80 b;  2KI7 B;  2QA4 1;  1RO0 A;  2PM9 A;  1VQO 1;  2KPI A;  1N2F A;  1USP A;  2WAQ A;  1K8A 2;  3H3V J;  5IT9 b;  3CCU Z;  1RQF A;  2LFU A;  4A3B I;  3GTM I;  1N8R 1;  1Q7Y 2;  4A3I I;  1YIT 1;  3I55 Z;  1Q86 1;  4RVG A;  3S1R I;  3Q87 A;  2JA7 I;  3VMI A;  4E2Z A;  1VQM Z;  5LL6 f;  2QEX 1;  2HU9 A;  2V8J A;  2WB1 A;  2JUB A;  3TDH B;  1KC8 1;  2DE5 A;  1YIJ Z;  3CC4 1;  3NH5 A;  3VMG A;  4A3L I;  2QR1 B;  1I6H I;  3HOU I;  3HOZ I;  4TNU A;  2YAD A;  4A3M I;  2RT9 A;  3J80 f;  3T4N B;  3CCM Z;  1VQN 1;  3J81 b;  3CCQ Z;  3FQQ A;  1KD1 1;  4RVF A;  5C4X I;  1X0T A;  5D1O A;  2W04 A;  1YI2 Z;  1M1K 1;  2K3R A;  4MON A;  4BY7 I;  2E2H I;  2E9H A;  2J6A A;  1YJ9 Z;  2OTL 1;  1QVF Y;  3VTN A;  3M4O I;  3S2D I;  1VQ9 Z;  1I3Q I;  4E31 A;  5IT9 f;  3G71 1;  3GTL I;  3CC2 Z;  1Q82 1;  1Q81 1;  3CCL Z;  4NBE A;  1K73 1;  3GTJ I;  3G71 Z;  1X3Z A;  2QRC B;  1RLY A;  3JAM b;  1VQP 1;  1NJI 1;  1S7M A;  1YJW 1;  4DK1 A;  4DQY B;  2Y0S A;  3GTQ I;  1WW9 A;  5C3E I;  1JJ2 Z;  3CXC Z;  2RIQ A;  3J81 f;  1YHQ Z;  4RVH A;  4RV9 A;  3IX0 A;  3I56 1;  1KQS Z;  1VQ4 Z;  2LIY A;  1N8R 2;  1VLA A;  1Y1W I;  1VQ6 1;  3IFU A;  3CMA 1;  3CQZ I;  2JA5 I;  1Q86 2;  4HGZ A;  4MRI A;  3EED A;  1M90 1;  5A2Q b;  3PO3 S;  3GTO I;  4NBG A;  2NVY I;  1KC8 2;  3MON A;  4NB9 A;  3JAM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...