2NVYI

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 16
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvyI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvyI02
3S2HI 1VLAA 1WCMI 2DE6A 4A3LI 3S1QI 4NBGA 1YUAA 1DL6A 3M3YI 3RZOI 2DE5A 3H3VJ 1L1OC 3HOUI 1TFIA 2F4OA 3FKII 3VMIA 2B63I 1Y1VS 4A3BI 4Y7NI 1SFOI 4A3FI 2R93I 1N2FA 1USPB 2P3YA 4NBFA 4NBHA 1X3ZA 3S15I 4A93I 1TWGI 2E2HI 1WW9A 3S17I 4BY7I 3CQZI 3GTJI 2NVTI 5FLMI 3PO3S 4NBDA 3S14I 3HOYI 4BBSI 1Y1WI 4NBEA 4NBCA 3GTGI 3GTMS 1I50I 3EERA 3H0GI 5C3EI 2JA8I 1RLYA 5IP7I 3S16I 4A3CI 4BBRI 4A3JI 1USPA 2RBLA 2JNYA 3GTKI 1TWAI 4NB8A 2JA5I 5C44I 2R7ZI 4X6AI 2F4MA 2NVQI 1Y1VI 4A3MI 3HOVI 4A3II 1X3WA 1ZB9A 3LUSA 2YU9I 4A3DI 3S1NI 1RO4A 1I3QI 3PO3I 3RZDI 2HF1A 2JR6A 4A3GI 4A3EI 5IP9I 1QYPA 4NOZA 3GTOI 3GTQI 1I6HI 3GTMI 2JA7I 1TWCI 3GCFA 1ML8A 4MH4A 3D6WA 3GTLI 3M4OI 3GKQA 2K5RA 3S2DI 2VUMI 3GTPI 5C4XI 1LQLA 1K83I 4NBAA 3I4MI 4XX2A 4QTTA 1TWHI 4BXXI 4A3KI 3VB9A 5C4JI 3Q87A 3I07A 2JA6I 3I4NI 2KPIA 4BY1I 3VMGA 3S1MI 3ESWA 3VMHA 5CM2M 2E2JI 1PFTA 2AKLA 1TWFI 2J6AA 2JS4A 3U50C 4QTUA 4Y52I 4NB9A 2NVYI 1R9TI 2PK7A 2DE7A 2E2II 2R92I 3HOWI 3HOZI 1NUIA 4NBBA 3K7AI 2NVXI 3S1RI 1ZB8A 3HOXI 2BJOA 3PO2I
chains in the Genus database with same CATH superfamily
1VLAA 2DE6A 3KIFA 4A3LI 3S1QI 3G6EZ 2M48A 1VQ4Z 2LIYA 2JIOA 2DE5A 3OW2Y 4E32A 1Q811 2OTL1 3CXCY 1VQ9Z 1VQ61 4A3BI 2B63I 2R6MA 3J81b 1Y8CA 4RS4A 2R93I 1VQ8Z 1FDOA 2P3YA 3NDIA 4A93I 1TWGI 2OOXB 3P5JB 2H85A 2NVTI 3CME1 3CXCZ 4NBDA 4E2WA 3GTGI 1VQNZ 3EERA 5T64A 3CCL1 4BBRI 1USPA 2RBLA 1TWAI 4NB8A 1RQFA 4A3MI 3KIHA 3HOVI 4MRIA 3IF8A 1ZB9A 3LUSA 5FLXf 1YIT1 4A3DI 2GTIA 3S1NI 4DK1A 1I3QI 2V3VA 1RNIA 3PO3I 3CCM1 1X0TA 5IP9I 1QYPA 3CC41 2JMOA 3GTQI 1TWCI 3D6WA 2K5RA 3CC71 3TDHB 2V8KA 2E9HA 4E31A 3I4MI 1Q821 4DGLA 3CPWY 3I07A 2JUBA 3S1MI 3MZKB 3G6E1 1TWFI 1Q7Y1 1VQ41 5T6BA 2JIRA 4Y52I 1R9TI 2E2II 2GTHA 3IR7A 1KQSY 2R92I 3HOWI 1VQ91 3CPWZ 2OZKA 1NUIA 1KD11 2W03A 1ZB8A 1VQ81 3FQMA 2QRDB 1RO0A 3HKZA 2PMZA 1M901 2PM9A 3M3YI 1KQSZ 3RZOI 2V8JA 3H3VJ 4HGYA 4MD9A 4E33A 2QKDA 2QEXZ 1VQN1 3VMIA 1YJNZ 4A3FI 2VPZA 1X3ZA 2Q51A 1KC81 1QXFA 1VQ7Z 1QF8A 3CQZI 2RIQA 3PO3S 2NAPA 4E2YA 4BBSI 1Y1WI 1I50I 1W2BZ 2Q4ZA 3NFZA 3J80f 3CCSZ 1ZH1A 3S16I 4RVHA 4X6AI 5C44I 3F3PC 3CCEZ 1WIIA 2F4MA 2NVQI 1Y1VI 3MONA 4HGZA 4A3II 1X3WA 2V45A 3OW2Z 3CC2Z 4MD7A 1RO4A 3CCJZ 5D1OB 1VQ5Z 3G4SZ 4NOZA 3GTOI 1NJI2 3GTMI 2JA7I 1K9M2 3GTLI 3S2DI 3GTPI 4S1TA 3J81f 3G71Z 2OOYB 2ZAEB 4A3KI 3VB9A 5C4JI 3Q87A 2JA6I 2OTJZ 3D9XA 4HH4A 4BY1I 4MXUA 4RVFA 2JIPA 2QREB 2IV2X 3VMHA 2V8IA 5IT9b 5CM2M 1YIJZ 1PFTA 2AKLA 2AYDA 2J6AA 4NB9A 3JAMb 2PK7A 3IFUA 1Z02A 1N8R2 2QEX1 1Q862 1YHQZ 2YADA 1YJN1 2BJOA 3CMAZ 2KI7B 3PO2I 2RHBA 3CCRZ 2QLVB 1WJ2A 1VQ71 1DL6A 3CCVZ 1YI2Z 1L1OC 2O4HA 3HOUI 5D1PA 3FKII 2G2KA 1Z01A 1Y1VS 4MONA 4Y7NI 1N2FA 3CCS1 3JAMf 2QA4Z 1WW9A 1VQOZ 3CCE1 1K732 1P9NA 3S14I 3HOYI 3CD6Z 4NBEA 3GTMS 1RO2A 2HU9A 3H0GI 3CC21 3CCJ1 1K8A2 2JA8I 5A2Qb 4A3JI 1VQ51 2JNYA 3GTKI 1NP6A 1YJWZ 1VQLZ 3G4S1 2R7ZI 1JWHC 1AA6A 1FDIA 1VQMZ 4RV9A 2VPYA 3G711 2YU9I 3NH8A 2IZ3A 3RZDI 2OTJ1 4A3EI 3F3FC 1JJ2Y 3TE5B 2IZ4A 3GCFA 4DQYB 1YJ9Z 1YIJ1 3M4OI 2VUMI 3CCUZ 4RVDA 4TNUA 5C4XI 1LQLA 4NBAA 4XX2A 4QTTA 3I56Z 3CCQZ 3I55Z 2Y0SA 4MD8A 4BXXI 3MZLB 1Q812 1YHQ1 3I4NI 5D1OA 1VQPZ 1JJ2Z 1M1K2 3CMA1 3CCR1 4EWCA 2E2JI 1S7MA 2RT9A 1M1K1 3D2LA 3U50C 2VPWA 3CCV1 2NVYI 1YI21 2LEXA 2K3RA 3NH5A 2EGTA 5FLXb 1NJI1 2NVXI 5LL6f 1K9M1 4E2ZA 2RPRA 2QR1B 2QA41 3S15I 4AYBA 2QRCB 3S2HI 1WCMI 2VF1A 2E7ZA 1S72Z 4NBGA 1VQO1 1YUAA 2GU2A 1QVGY 2P28A 2W04A 3CD61 1TFIA 2F4OA 1SFOI 1USPB 3FQQA 3NH4A 3BG1B 4NBFA 4NBHA 1VQKZ 2E2HI 3S17I 1YJW1 1VQL1 4BY7I 4NH1C 3GTJI 3EEDA 1QVGZ 1N8R1 3NDJA 5FLMI 1Q861 2OTLZ 1VQM1 1VQ6Z 4NBCA 1SIWA 5C3EI 2LFUA 1RLYA 5IP7I 4A3CI 5T67A 2JA5I 5IT9f 1Q822 4RVGA 3CMEZ 2VUGA 1YJ91 3VTNA 3CCU1 4NFRA 1QVFY 2WAQA 3CCLZ 3I561 3CCQ1 1Q7Y2 3I551 1K731 2HF1A 2JR6A 1VQP1 4A3GI 4CL1A 1KD12 1I6HI 1ML8A 4MH4A 3GKQA 1QVFZ 5AN9F 1K8A1 3QWUA 1YITZ 1K83I 1M902 2O53A 3IX0A 1KRLA 1TWHI 4E30A 2WB1A 2KPIA 2M6NA 3CCMZ 3VMGA 3J80b 1Q16A 3CC4Z 2I3CA 3ESWA 2JIMA 3T4NB 1S721 3J7A4 4E2XA 2JS4A 3CC7Z 4QTUA 2JIQA 1KC82 2DE7A 1Z03A 1W2BY 2VPXA 5A2Qf 3HOZI 4NBBA 1WZNA 3K7AI 3S1RI 3HOXI 3BG0B 1YUKA 1VQK1
chains in the Genus database with same CATH topology
1VLAA 2DE6A 3KIFA 4A3LI 3S1QI 3G6EZ 2M48A 1VQ4Z 2LIYA 2DE5A 3OW2Y 4E32A 1Q811 2OTL1 3CXCY 1VQ9Z 1VQ61 4A3BI 2B63I 2R6MA 3J81b 4RS4A 2R93I 1VQ8Z 2P3YA 3NDIA 4A93I 1TWGI 2OOXB 3P5JB 2H85A 2NVTI 3CME1 3CXCZ 4NBDA 4E2WA 3GTGI 1VQNZ 3EERA 5T64A 3CCL1 4BBRI 1USPA 2RBLA 1TWAI 4NB8A 1RQFA 4A3MI 3KIHA 3HOVI 4MRIA 3IF8A 1ZB9A 3LUSA 5FLXf 1YIT1 4A3DI 2GTIA 3S1NI 4DK1A 1I3QI 1RNIA 3PO3I 3CCM1 1X0TA 5IP9I 1QYPA 3CC41 2JMOA 3GTQI 1TWCI 3D6WA 2K5RA 3CC71 3TDHB 2V8KA 2E9HA 4E31A 3I4MI 1Q821 4DGLA 3CPWY 3I07A 2JUBA 3S1MI 3MZKB 3G6E1 1TWFI 1Q7Y1 1VQ41 5T6BA 4Y52I 1R9TI 2E2II 2GTHA 1KQSY 2R92I 3HOWI 1VQ91 3CPWZ 2OZKA 1NUIA 1KD11 2W03A 1ZB8A 1VQ81 3FQMA 2QRDB 1RO0A 3HKZA 2PMZA 1M901 2PM9A 3M3YI 1KQSZ 3RZOI 2V8JA 3H3VJ 4HGYA 4MD9A 4E33A 2QKDA 2QEXZ 1VQN1 3VMIA 1YJNZ 4A3FI 1X3ZA 2Q51A 1KC81 1VQ7Z 1QF8A 3CQZI 2RIQA 3PO3S 4E2YA 4BBSI 1Y1WI 1I50I 1W2BZ 2Q4ZA 3NFZA 3J80f 3CCSZ 1ZH1A 3S16I 4RVHA 4X6AI 5C44I 3F3PC 3CCEZ 1WIIA 2F4MA 2NVQI 1Y1VI 3MONA 4HGZA 4A3II 1X3WA 3OW2Z 3CC2Z 4MD7A 1RO4A 3CCJZ 5D1OB 1VQ5Z 3G4SZ 4NOZA 3GTOI 1NJI2 3GTMI 2JA7I 1K9M2 3GTLI 3S2DI 3GTPI 4S1TA 3J81f 3G71Z 2OOYB 2ZAEB 4A3KI 3VB9A 5C4JI 3Q87A 2JA6I 2OTJZ 3D9XA 4HH4A 4BY1I 4MXUA 4RVFA 2QREB 3VMHA 2V8IA 5IT9b 5CM2M 1YIJZ 1PFTA 2AKLA 2J6AA 4NB9A 3JAMb 2PK7A 3IFUA 1Z02A 1N8R2 2QEX1 1Q862 1YHQZ 2YADA 1YJN1 2BJOA 3CMAZ 2KI7B 3PO2I 2RHBA 3CCRZ 2QLVB 1VQ71 1DL6A 3CCVZ 1YI2Z 1L1OC 2O4HA 3HOUI 5D1PA 3FKII 2G2KA 1Z01A 1Y1VS 4MONA 4Y7NI 1N2FA 3CCS1 3JAMf 2QA4Z 1WW9A 1VQOZ 3CCE1 1K732 1P9NA 3S14I 3HOYI 3CD6Z 4NBEA 3GTMS 1RO2A 2HU9A 3H0GI 3CC21 3CCJ1 1K8A2 2JA8I 5A2Qb 4A3JI 1VQ51 2JNYA 3GTKI 1NP6A 1YJWZ 1VQLZ 3G4S1 2R7ZI 1JWHC 1VQMZ 4RV9A 3G711 2YU9I 3NH8A 2IZ3A 3RZDI 2OTJ1 4A3EI 3F3FC 1JJ2Y 3TE5B 2IZ4A 3GCFA 4DQYB 1YJ9Z 1YIJ1 3M4OI 2VUMI 3CCUZ 4RVDA 4TNUA 5C4XI 1LQLA 4NBAA 4XX2A 4QTTA 3I56Z 3CCQZ 3I55Z 2Y0SA 4MD8A 4BXXI 3MZLB 1Q812 1YHQ1 3I4NI 5D1OA 1VQPZ 1JJ2Z 1M1K2 3CMA1 3CCR1 4EWCA 2E2JI 1S7MA 2RT9A 1M1K1 3U50C 3CCV1 2NVYI 1YI21 2K3RA 3NH5A 2EGTA 5FLXb 1NJI1 2NVXI 5LL6f 1K9M1 4E2ZA 2RPRA 2QR1B 2QA41 3S15I 4AYBA 2QRCB 3S2HI 1WCMI 2VF1A 1S72Z 4NBGA 1VQO1 1YUAA 2GU2A 1QVGY 2P28A 2W04A 3CD61 1TFIA 2F4OA 1SFOI 1USPB 3FQQA 3NH4A 3BG1B 4NBFA 4NBHA 1VQKZ 2E2HI 3S17I 1YJW1 1VQL1 4BY7I 4NH1C 3GTJI 3EEDA 1QVGZ 1N8R1 3NDJA 5FLMI 1Q861 2OTLZ 1VQM1 1VQ6Z 4NBCA 5C3EI 2LFUA 1RLYA 5IP7I 4A3CI 5T67A 2JA5I 5IT9f 1Q822 4RVGA 3CMEZ 2VUGA 1YJ91 3VTNA 3CCU1 4NFRA 1QVFY 2WAQA 3CCLZ 3I561 3CCQ1 1Q7Y2 3I551 1K731 2HF1A 2JR6A 1VQP1 4A3GI 4CL1A 1KD12 1I6HI 1ML8A 4MH4A 3GKQA 1QVFZ 5AN9F 1K8A1 3QWUA 1YITZ 1K83I 1M902 2O53A 3IX0A 1KRLA 1TWHI 4E30A 2WB1A 2KPIA 2M6NA 3CCMZ 3VMGA 3J80b 3CC4Z 2I3CA 3ESWA 3T4NB 1S721 3J7A4 4E2XA 2JS4A 3CC7Z 4QTUA 1KC82 2DE7A 1Z03A 1W2BY 5A2Qf 3HOZI 4NBBA 3K7AI 3S1RI 3HOXI 3BG0B 1YUKA 1VQK1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H I;  1VLA A;  1WCM I;  2DE6 A;  4A3L I;  3S1Q I;  4NBG A;  1YUA A;  1DL6 A;  3M3Y I;  3RZO I;  2DE5 A;  3H3V J;  1L1O C;  3HOU I;  1TFI A;  2F4O A;  3FKI I;  3VMI A;  2B63 I;  1Y1V S;  4A3B I;  4Y7N I;  1SFO I;  4A3F I;  2R93 I;  1N2F A;  1USP B;  2P3Y A;  4NBF A;  4NBH A;  1X3Z A;  3S15 I;  4A93 I;  1TWG I;  2E2H I;  1WW9 A;  3S17 I;  4BY7 I;  3CQZ I;  3GTJ I;  2NVT I;  5FLM I;  3PO3 S;  4NBD A;  3S14 I;  3HOY I;  4BBS I;  1Y1W I;  4NBE A;  4NBC A;  3GTG I;  3GTM S;  1I50 I;  3EER A;  3H0G I;  5C3E I;  2JA8 I;  1RLY A;  5IP7 I;  3S16 I;  4A3C I;  4BBR I;  4A3J I;  1USP A;  2RBL A;  2JNY A;  3GTK I;  1TWA I;  4NB8 A;  2JA5 I;  5C44 I;  2R7Z I;  4X6A I;  2F4M A;  2NVQ I;  1Y1V I;  4A3M I;  3HOV I;  4A3I I;  1X3W A;  1ZB9 A;  3LUS A;  2YU9 I;  4A3D I;  3S1N I;  1RO4 A;  1I3Q I;  3PO3 I;  3RZD I;  2HF1 A;  2JR6 A;  4A3G I;  4A3E I;  5IP9 I;  1QYP A;  4NOZ A;  3GTO I;  3GTQ I;  1I6H I;  3GTM I;  2JA7 I;  1TWC I;  3GCF A;  1ML8 A;  4MH4 A;  3D6W A;  3GTL I;  3M4O I;  3GKQ A;  2K5R A;  3S2D I;  2VUM I;  3GTP I;  5C4X I;  1LQL A;  1K83 I;  4NBA A;  3I4M I;  4XX2 A;  4QTT A;  1TWH I;  4BXX I;  4A3K I;  3VB9 A;  5C4J I;  3Q87 A;  3I07 A;  2JA6 I;  3I4N I;  2KPI A;  4BY1 I;  3VMG A;  3S1M I;  3ESW A;  3VMH A;  5CM2 M;  2E2J I;  1PFT A;  2AKL A;  1TWF I;  2J6A A;  2JS4 A;  3U50 C;  4QTU A;  4Y52 I;  4NB9 A;  2NVY I;  1R9T I;  2PK7 A;  2DE7 A;  2E2I I;  2R92 I;  3HOW I;  3HOZ I;  1NUI A;  4NBB A;  3K7A I;  2NVX I;  3S1R I;  1ZB8 A;  3HOX I;  2BJO A;  3PO2 I; 
#chains in the Genus database with same CATH topology
 1VLA A;  2DE6 A;  3KIF A;  4A3L I;  3S1Q I;  3G6E Z;  2M48 A;  1VQ4 Z;  2LIY A;  2JIO A;  2DE5 A;  3OW2 Y;  4E32 A;  1Q81 1;  2OTL 1;  3CXC Y;  1VQ9 Z;  1VQ6 1;  4A3B I;  2B63 I;  2R6M A;  3J81 b;  1Y8C A;  4RS4 A;  2R93 I;  1VQ8 Z;  1FDO A;  2P3Y A;  3NDI A;  4A93 I;  1TWG I;  2OOX B;  3P5J B;  2H85 A;  2NVT I;  3CME 1;  3CXC Z;  4NBD A;  4E2W A;  3GTG I;  1VQN Z;  3EER A;  5T64 A;  3CCL 1;  4BBR I;  1USP A;  2RBL A;  1TWA I;  4NB8 A;  1RQF A;  4A3M I;  3KIH A;  3HOV I;  4MRI A;  3IF8 A;  1ZB9 A;  3LUS A;  5FLX f;  1YIT 1;  4A3D I;  2GTI A;  3S1N I;  4DK1 A;  1I3Q I;  2V3V A;  1RNI A;  3PO3 I;  3CCM 1;  1X0T A;  5IP9 I;  1QYP A;  3CC4 1;  2JMO A;  3GTQ I;  1TWC I;  3D6W A;  2K5R A;  3CC7 1;  3TDH B;  2V8K A;  2E9H A;  4E31 A;  3I4M I;  1Q82 1;  4DGL A;  3CPW Y;  3I07 A;  2JUB A;  3S1M I;  3MZK B;  3G6E 1;  1TWF I;  1Q7Y 1;  1VQ4 1;  5T6B A;  2JIR A;  4Y52 I;  1R9T I;  2E2I I;  2GTH A;  3IR7 A;  1KQS Y;  2R92 I;  3HOW I;  1VQ9 1;  3CPW Z;  2OZK A;  1NUI A;  1KD1 1;  2W03 A;  1ZB8 A;  1VQ8 1;  3FQM A;  2QRD B;  1RO0 A;  3HKZ A;  2PMZ A;  1M90 1;  2PM9 A;  3M3Y I;  1KQS Z;  3RZO I;  2V8J A;  3H3V J;  4HGY A;  4MD9 A;  4E33 A;  2QKD A;  2QEX Z;  1VQN 1;  3VMI A;  1YJN Z;  4A3F I;  2VPZ A;  1X3Z A;  2Q51 A;  1KC8 1;  1QXF A;  1VQ7 Z;  1QF8 A;  3CQZ I;  2RIQ A;  3PO3 S;  2NAP A;  4E2Y A;  4BBS I;  1Y1W I;  1I50 I;  1W2B Z;  2Q4Z A;  3NFZ A;  3J80 f;  3CCS Z;  1ZH1 A;  3S16 I;  4RVH A;  4X6A I;  5C44 I;  3F3P C;  3CCE Z;  1WII A;  2F4M A;  2NVQ I;  1Y1V I;  3MON A;  4HGZ A;  4A3I I;  1X3W A;  2V45 A;  3OW2 Z;  3CC2 Z;  4MD7 A;  1RO4 A;  3CCJ Z;  5D1O B;  1VQ5 Z;  3G4S Z;  4NOZ A;  3GTO I;  1NJI 2;  3GTM I;  2JA7 I;  1K9M 2;  3GTL I;  3S2D I;  3GTP I;  4S1T A;  3J81 f;  3G71 Z;  2OOY B;  2ZAE B;  4A3K I;  3VB9 A;  5C4J I;  3Q87 A;  2JA6 I;  2OTJ Z;  3D9X A;  4HH4 A;  4BY1 I;  4MXU A;  4RVF A;  2JIP A;  2QRE B;  2IV2 X;  3VMH A;  2V8I A;  5IT9 b;  5CM2 M;  1YIJ Z;  1PFT A;  2AKL A;  2AYD A;  2J6A A;  4NB9 A;  3JAM b;  2PK7 A;  3IFU A;  1Z02 A;  1N8R 2;  2QEX 1;  1Q86 2;  1YHQ Z;  2YAD A;  1YJN 1;  2BJO A;  3CMA Z;  2KI7 B;  3PO2 I;  2RHB A;  3CCR Z;  2QLV B;  1WJ2 A;  1VQ7 1;  1DL6 A;  3CCV Z;  1YI2 Z;  1L1O C;  2O4H A;  3HOU I;  5D1P A;  3FKI I;  2G2K A;  1Z01 A;  1Y1V S;  4MON A;  4Y7N I;  1N2F A;  3CCS 1;  3JAM f;  2QA4 Z;  1WW9 A;  1VQO Z;  3CCE 1;  1K73 2;  1P9N A;  3S14 I;  3HOY I;  3CD6 Z;  4NBE A;  3GTM S;  1RO2 A;  2HU9 A;  3H0G I;  3CC2 1;  3CCJ 1;  1K8A 2;  2JA8 I;  5A2Q b;  4A3J I;  1VQ5 1;  2JNY A;  3GTK I;  1NP6 A;  1YJW Z;  1VQL Z;  3G4S 1;  2R7Z I;  1JWH C;  1AA6 A;  1FDI A;  1VQM Z;  4RV9 A;  2VPY A;  3G71 1;  2YU9 I;  3NH8 A;  2IZ3 A;  3RZD I;  2OTJ 1;  4A3E I;  3F3F C;  1JJ2 Y;  3TE5 B;  2IZ4 A;  3GCF A;  4DQY B;  1YJ9 Z;  1YIJ 1;  3M4O I;  2VUM I;  3CCU Z;  4RVD A;  4TNU A;  5C4X I;  1LQL A;  4NBA A;  4XX2 A;  4QTT A;  3I56 Z;  3CCQ Z;  3I55 Z;  2Y0S A;  4MD8 A;  4BXX I;  3MZL B;  1Q81 2;  1YHQ 1;  3I4N I;  5D1O A;  1VQP Z;  1JJ2 Z;  1M1K 2;  3CMA 1;  3CCR 1;  4EWC A;  2E2J I;  1S7M A;  2RT9 A;  1M1K 1;  3D2L A;  3U50 C;  2VPW A;  3CCV 1;  2NVY I;  1YI2 1;  2LEX A;  2K3R A;  3NH5 A;  2EGT A;  5FLX b;  1NJI 1;  2NVX I;  5LL6 f;  1K9M 1;  4E2Z A;  2RPR A;  2QR1 B;  2QA4 1;  3S15 I;  4AYB A;  2QRC B;  3S2H I;  1WCM I;  2VF1 A;  2E7Z A;  1S72 Z;  4NBG A;  1VQO 1;  1YUA A;  2GU2 A;  1QVG Y;  2P28 A;  2W04 A;  3CD6 1;  1TFI A;  2F4O A;  1SFO I;  1USP B;  3FQQ A;  3NH4 A;  3BG1 B;  4NBF A;  4NBH A;  1VQK Z;  2E2H I;  3S17 I;  1YJW 1;  1VQL 1;  4BY7 I;  4NH1 C;  3GTJ I;  3EED A;  1QVG Z;  1N8R 1;  3NDJ A;  5FLM I;  1Q86 1;  2OTL Z;  1VQM 1;  1VQ6 Z;  4NBC A;  1SIW A;  5C3E I;  2LFU A;  1RLY A;  5IP7 I;  4A3C I;  5T67 A;  2JA5 I;  5IT9 f;  1Q82 2;  4RVG A;  3CME Z;  2VUG A;  1YJ9 1;  3VTN A;  3CCU 1;  4NFR A;  1QVF Y;  2WAQ A;  3CCL Z;  3I56 1;  3CCQ 1;  1Q7Y 2;  3I55 1;  1K73 1;  2HF1 A;  2JR6 A;  1VQP 1;  4A3G I;  4CL1 A;  1KD1 2;  1I6H I;  1ML8 A;  4MH4 A;  3GKQ A;  1QVF Z;  5AN9 F;  1K8A 1;  3QWU A;  1YIT Z;  1K83 I;  1M90 2;  2O53 A;  3IX0 A;  1KRL A;  1TWH I;  4E30 A;  2WB1 A;  2KPI A;  2M6N A;  3CCM Z;  3VMG A;  3J80 b;  1Q16 A;  3CC4 Z;  2I3C A;  3ESW A;  2JIM A;  3T4N B;  1S72 1;  3J7A 4;  4E2X A;  2JS4 A;  3CC7 Z;  4QTU A;  2JIQ A;  1KC8 2;  2DE7 A;  1Z03 A;  1W2B Y;  2VPX A;  5A2Q f;  3HOZ I;  4NBB A;  1WZN A;  3K7A I;  3S1R I;  3HOX I;  3BG0 B;  1YUK A;  1VQK 1; 
#chains in the Genus database with same CATH homology
 1VLA A;  2DE6 A;  3KIF A;  4A3L I;  3S1Q I;  3G6E Z;  2M48 A;  1VQ4 Z;  2LIY A;  2DE5 A;  3OW2 Y;  4E32 A;  1Q81 1;  2OTL 1;  3CXC Y;  1VQ9 Z;  1VQ6 1;  4A3B I;  2B63 I;  2R6M A;  3J81 b;  4RS4 A;  2R93 I;  1VQ8 Z;  2P3Y A;  3NDI A;  4A93 I;  1TWG I;  2OOX B;  3P5J B;  2H85 A;  2NVT I;  3CME 1;  3CXC Z;  4NBD A;  4E2W A;  3GTG I;  1VQN Z;  3EER A;  5T64 A;  3CCL 1;  4BBR I;  1USP A;  2RBL A;  1TWA I;  4NB8 A;  1RQF A;  4A3M I;  3KIH A;  3HOV I;  4MRI A;  3IF8 A;  1ZB9 A;  3LUS A;  5FLX f;  1YIT 1;  4A3D I;  2GTI A;  3S1N I;  4DK1 A;  1I3Q I;  1RNI A;  3PO3 I;  3CCM 1;  1X0T A;  5IP9 I;  1QYP A;  3CC4 1;  2JMO A;  3GTQ I;  1TWC I;  3D6W A;  2K5R A;  3CC7 1;  3TDH B;  2V8K A;  2E9H A;  4E31 A;  3I4M I;  1Q82 1;  4DGL A;  3CPW Y;  3I07 A;  2JUB A;  3S1M I;  3MZK B;  3G6E 1;  1TWF I;  1Q7Y 1;  1VQ4 1;  5T6B A;  4Y52 I;  1R9T I;  2E2I I;  2GTH A;  1KQS Y;  2R92 I;  3HOW I;  1VQ9 1;  3CPW Z;  2OZK A;  1NUI A;  1KD1 1;  2W03 A;  1ZB8 A;  1VQ8 1;  3FQM A;  2QRD B;  1RO0 A;  3HKZ A;  2PMZ A;  1M90 1;  2PM9 A;  3M3Y I;  1KQS Z;  3RZO I;  2V8J A;  3H3V J;  4HGY A;  4MD9 A;  4E33 A;  2QKD A;  2QEX Z;  1VQN 1;  3VMI A;  1YJN Z;  4A3F I;  1X3Z A;  2Q51 A;  1KC8 1;  1VQ7 Z;  1QF8 A;  3CQZ I;  2RIQ A;  3PO3 S;  4E2Y A;  4BBS I;  1Y1W I;  1I50 I;  1W2B Z;  2Q4Z A;  3NFZ A;  3J80 f;  3CCS Z;  1ZH1 A;  3S16 I;  4RVH A;  4X6A I;  5C44 I;  3F3P C;  3CCE Z;  1WII A;  2F4M A;  2NVQ I;  1Y1V I;  3MON A;  4HGZ A;  4A3I I;  1X3W A;  3OW2 Z;  3CC2 Z;  4MD7 A;  1RO4 A;  3CCJ Z;  5D1O B;  1VQ5 Z;  3G4S Z;  4NOZ A;  3GTO I;  1NJI 2;  3GTM I;  2JA7 I;  1K9M 2;  3GTL I;  3S2D I;  3GTP I;  4S1T A;  3J81 f;  3G71 Z;  2OOY B;  2ZAE B;  4A3K I;  3VB9 A;  5C4J I;  3Q87 A;  2JA6 I;  2OTJ Z;  3D9X A;  4HH4 A;  4BY1 I;  4MXU A;  4RVF A;  2QRE B;  3VMH A;  2V8I A;  5IT9 b;  5CM2 M;  1YIJ Z;  1PFT A;  2AKL A;  2J6A A;  4NB9 A;  3JAM b;  2PK7 A;  3IFU A;  1Z02 A;  1N8R 2;  2QEX 1;  1Q86 2;  1YHQ Z;  2YAD A;  1YJN 1;  2BJO A;  3CMA Z;  2KI7 B;  3PO2 I;  2RHB A;  3CCR Z;  2QLV B;  1VQ7 1;  1DL6 A;  3CCV Z;  1YI2 Z;  1L1O C;  2O4H A;  3HOU I;  5D1P A;  3FKI I;  2G2K A;  1Z01 A;  1Y1V S;  4MON A;  4Y7N I;  1N2F A;  3CCS 1;  3JAM f;  2QA4 Z;  1WW9 A;  1VQO Z;  3CCE 1;  1K73 2;  1P9N A;  3S14 I;  3HOY I;  3CD6 Z;  4NBE A;  3GTM S;  1RO2 A;  2HU9 A;  3H0G I;  3CC2 1;  3CCJ 1;  1K8A 2;  2JA8 I;  5A2Q b;  4A3J I;  1VQ5 1;  2JNY A;  3GTK I;  1NP6 A;  1YJW Z;  1VQL Z;  3G4S 1;  2R7Z I;  1JWH C;  1VQM Z;  4RV9 A;  3G71 1;  2YU9 I;  3NH8 A;  2IZ3 A;  3RZD I;  2OTJ 1;  4A3E I;  3F3F C;  1JJ2 Y;  3TE5 B;  2IZ4 A;  3GCF A;  4DQY B;  1YJ9 Z;  1YIJ 1;  3M4O I;  2VUM I;  3CCU Z;  4RVD A;  4TNU A;  5C4X I;  1LQL A;  4NBA A;  4XX2 A;  4QTT A;  3I56 Z;  3CCQ Z;  3I55 Z;  2Y0S A;  4MD8 A;  4BXX I;  3MZL B;  1Q81 2;  1YHQ 1;  3I4N I;  5D1O A;  1VQP Z;  1JJ2 Z;  1M1K 2;  3CMA 1;  3CCR 1;  4EWC A;  2E2J I;  1S7M A;  2RT9 A;  1M1K 1;  3U50 C;  3CCV 1;  2NVY I;  1YI2 1;  2K3R A;  3NH5 A;  2EGT A;  5FLX b;  1NJI 1;  2NVX I;  5LL6 f;  1K9M 1;  4E2Z A;  2RPR A;  2QR1 B;  2QA4 1;  3S15 I;  4AYB A;  2QRC B;  3S2H I;  1WCM I;  2VF1 A;  1S72 Z;  4NBG A;  1VQO 1;  1YUA A;  2GU2 A;  1QVG Y;  2P28 A;  2W04 A;  3CD6 1;  1TFI A;  2F4O A;  1SFO I;  1USP B;  3FQQ A;  3NH4 A;  3BG1 B;  4NBF A;  4NBH A;  1VQK Z;  2E2H I;  3S17 I;  1YJW 1;  1VQL 1;  4BY7 I;  4NH1 C;  3GTJ I;  3EED A;  1QVG Z;  1N8R 1;  3NDJ A;  5FLM I;  1Q86 1;  2OTL Z;  1VQM 1;  1VQ6 Z;  4NBC A;  5C3E I;  2LFU A;  1RLY A;  5IP7 I;  4A3C I;  5T67 A;  2JA5 I;  5IT9 f;  1Q82 2;  4RVG A;  3CME Z;  2VUG A;  1YJ9 1;  3VTN A;  3CCU 1;  4NFR A;  1QVF Y;  2WAQ A;  3CCL Z;  3I56 1;  3CCQ 1;  1Q7Y 2;  3I55 1;  1K73 1;  2HF1 A;  2JR6 A;  1VQP 1;  4A3G I;  4CL1 A;  1KD1 2;  1I6H I;  1ML8 A;  4MH4 A;  3GKQ A;  1QVF Z;  5AN9 F;  1K8A 1;  3QWU A;  1YIT Z;  1K83 I;  1M90 2;  2O53 A;  3IX0 A;  1KRL A;  1TWH I;  4E30 A;  2WB1 A;  2KPI A;  2M6N A;  3CCM Z;  3VMG A;  3J80 b;  3CC4 Z;  2I3C A;  3ESW A;  3T4N B;  1S72 1;  3J7A 4;  4E2X A;  2JS4 A;  3CC7 Z;  4QTU A;  1KC8 2;  2DE7 A;  1Z03 A;  1W2B Y;  5A2Q f;  3HOZ I;  4NBB A;  3K7A I;  3S1R I;  3HOX I;  3BG0 B;  1YUK A;  1VQK 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...