5A2Qb

Structure of the hcv ires bound to the human ribosome
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
82
structure length
82
Chain Sequence
b'PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qb00
5FLXb 5LL6f 3JAMb 5A2Qb 5IT9b 3J7A4 3J80b 3J81b
chains in the Genus database with same CATH superfamily
1YIT1 3Q87A 4A3JI 3CMEZ 1NUIA 4MONA 4E2YA 3MZLB 3GTQI 5IP9I 3G71Z 3CCJ1 3HOVI 1WIIA 1K8A2 1KRLA 4BBSI 3G6E1 3MZKB 4DQYB 3FQQA 5FLXf 3IFUA 2E2JI 3S16I 3CCV1 4BXXI 2OTLZ 2JUBA 1TWCI 4BBRI 1YHQZ 1I6HI 4HH4A 1W2BZ 5T67A 2R6MA 2NVXI 3S1MI 4NBFA 4A3II 4A3KI 1YITZ 1S7MA 2W04A 2ZAEB 5FLMI 1M1K2 3CPWZ 3CC2Z 3T4NB 4NBHA 3CCM1 3CCEZ 3GTMI 3FKII 3HOWI 3NDIA 3IR7A 1NJI1 3G6EZ 3GTMS 3F3PC 5FLXb 1L1OC 2LIYA 2JA7I 2JNYA 1K731 1TWGI 1VQLZ 3CCVZ 2V8KA 1YJ9Z 2P3YA 1QYPA 3CCL1 1VQ91 2E7ZA 1KQSY 2NVQI 3S1NI 2Q51A 1Y1WI 4NBBA 1FDIA 1YUKA 2W03A 1QXFA 3VMHA 1QVFZ 3GKQA 1WZNA 1RQFA 3FQMA 3I4MI 3CCMZ 3GCFA 4NBAA 3S1RI 2VF1A 3GTPI 1PFTA 3RZOI 1WCMI 4A3DI 2VPXA 2VUMI 3GTGI 3M3YI 3PO3I 3NH4A 3S15I 4E2WA 2JA8I 1Z02A 4MD7A 3S1QI 2JIRA 1Z03A 3PO3S 4A93I 3CCLZ 3U50C 3HOZI 1RO0A 4X6AI 2NVTI 2G2KA 1Y8CA 3EERA 3TE5B 3I561 4E30A 2QLVB 1FDOA 1NJI2 2OOXB 3D6WA 3JAMf 1K732 3CC41 2QKDA 2QRCB 1I50I 4RVHA 2QRDB 1YIJ1 1R9TI 2BJOA 2EGTA 3S17I 3H0GI 5D1OA 4QTTA 1VQ5Z 4RVGA 4HGZA 2DE5A 3I07A 2OTJ1 3IX0A 2V3VA 3EEDA 3I56Z 2F4OA 1VQO1 2E9HA 3S14I 3ESWA 4A3MI 4A3LI 1JWHC 4MXUA 3I4NI 3JAMb 2AYDA 4RV9A 2H85A 1K9M2 3CC4Z 2R7ZI 3CCS1 1JJ2Y 2PK7A 1YIJZ 3CCQ1 1VQM1 4XX2A 5C4JI 4CL1A 3LUSA 5CM2M 2E2HI 4Y7NI 4RS4A 2O53A 3I551 1VQ41 3S2HI 1X0TA 3F3FC 2O4HA 3CCJZ 5A2Qf 2DE6A 3CC71 1WW9A 4A3FI 5C44I 3OW2Z 1YJN1 4RVDA 2HU9A 1VLAA 2GU2A 1RNIA 2VPYA 2OZKA 3RZDI 3CCSZ 4EWCA 2Y0SA 2PMZA 1M902 2QEX1 3CCQZ 1VQMZ 1KC81 3TDHB 2WAQA 2OOYB 1RLYA 4NH1C 5AN9F 2JS4A 2E2II 3BG1B 2DE7A 3G4S1 2JIQA 1QF8A 2PM9A 2QA41 2VUGA 1W2BY 5A2Qb 5D1PA 2GTIA 1VQP1 5C3EI 1P9NA 1Z01A 2YU9I 3CC7Z 3H3VJ 1Q861 1VQK1 2QREB 4NBCA 3NFZA 1I3QI 1Q811 1K9M1 1USPB 3CMA1 1YJNZ 1VQN1 2YADA 3NH5A 3GTLI 3GTOI 2K3RA 2VPZA 4TNUA 3CXCY 1VQ9Z 1TWAI 2IV2X 2V45A 1Q821 4QTUA 2JA5I 3GTKI 4BY1I 1TWHI 2QR1B 1YUAA 4NBEA 2NVYI 3VB9A 3S2DI 3KIFA 4E31A 5C4XI 1SFOI 3CCU1 1Y1VI 2KI7B 3IF8A 2P28A 2KPIA 1VQKZ 4DK1A 1Y1VS 1QVFY 4NB8A 1VQNZ 2F4MA 1N8R2 3G711 3D9XA 3MONA 2JR6A 1JJ2Z 1KD11 3CCR1 2JMOA 1KC82 2JA6I 1M901 3NDJA 2RHBA 1K83I 1ZH1A 4Y52I 3P5JB 1YHQ1 2V8IA 3NH8A 4RVFA 1S721 3CD61 3CCUZ 1Q862 4NBDA 2LEXA 1Q812 3CC21 2RT9A 4AYBA 1RO4A 3J80f 1DL6A 3CCE1 1TFIA 2NAPA 4E33A 3HOUI 3CCRZ 1Q822 1X3ZA 1Q16A 3PO2I 1KQSZ 2Q4ZA 3HKZA 4MRIA 1QVGY 4MD9A 5LL6f 4A3CI 1VQL1 2OTJZ 2JIOA 1YJ91 1VQ81 3KIHA 1YI21 3HOYI 1VQOZ 2K5RA 1S72Z 2GTHA 3CD6Z 4A3EI 4S1TA 2R93I 3J80b 5T64A 3BG0B 4HGYA 2HF1A 1KD12 1YJW1 1N8R1 3VMIA 2B63I 5T6BA 2M48A 3J81f 4MH4A 2M6NA 3CXCZ 1AA6A 4BY7I 4NFRA 3I55Z 1VQ61 4E2XA 3J7A4 1VQ4Z 4MD8A 4E32A 1VQ8Z 1YI2Z 4E2ZA 1Q7Y1 3VMGA 2IZ4A 5IP7I 1LQLA 3CPWY 2WB1A 4A3BI 5IT9f 4A3GI 2RPRA 3QWUA 1VQ71 1YJWZ 3J81b 2JIMA 2RIQA 3GTJI 2J6AA 1K8A1 1ZB9A 3D2LA 1SIWA 2QEXZ 3VTNA 1USPA 3OW2Y 4NB9A 3G4SZ 2QA4Z 1VQ6Z 2JIPA 3CQZI 1VQPZ 3CME1 5IT9b 1VQ51 1M1K1 2I3CA 1ML8A 4NOZA 3HOXI 3CMAZ 4NBGA 2VPWA 1VQ7Z 1N2FA 1RO2A 3K7AI 4DGLA 1TWFI 3M4OI 1WJ2A 2RBLA 1NP6A 2V8JA 2R92I 2OTL1 1QVGZ 5D1OB 1ZB8A 2AKLA 1Q7Y2 2IZ3A 1X3WA 2LFUA
chains in the Genus database with same CATH topology
1YIT1 3Q87A 4A3JI 3CMEZ 1NUIA 4MONA 4E2YA 3MZLB 3GTQI 5IP9I 3G71Z 3CCJ1 3HOVI 1WIIA 1K8A2 1KRLA 4BBSI 3G6E1 3MZKB 4DQYB 3FQQA 5FLXf 3IFUA 2E2JI 3S16I 3CCV1 4BXXI 2OTLZ 2JUBA 1TWCI 4BBRI 1YHQZ 1I6HI 4HH4A 1W2BZ 5T67A 2R6MA 2NVXI 3S1MI 4NBFA 4A3II 4A3KI 1YITZ 1S7MA 2W04A 2ZAEB 5FLMI 1M1K2 3CPWZ 3CC2Z 3T4NB 4NBHA 3CCM1 3CCEZ 3GTMI 3FKII 3HOWI 3NDIA 1NJI1 3G6EZ 3GTMS 3F3PC 5FLXb 1L1OC 2LIYA 2JA7I 2JNYA 1K731 1TWGI 1VQLZ 3CCVZ 2V8KA 1YJ9Z 2P3YA 1QYPA 3CCL1 1VQ91 1KQSY 2NVQI 3S1NI 2Q51A 1Y1WI 4NBBA 1YUKA 2W03A 3VMHA 1QVFZ 3GKQA 1RQFA 3FQMA 3I4MI 3CCMZ 3GCFA 4NBAA 3S1RI 2VF1A 3GTPI 1PFTA 3RZOI 1WCMI 4A3DI 2VUMI 3GTGI 3M3YI 3PO3I 3NH4A 3S15I 4E2WA 2JA8I 1Z02A 4MD7A 3S1QI 1Z03A 3PO3S 4A93I 3CCLZ 3U50C 3HOZI 1RO0A 4X6AI 2NVTI 2G2KA 3EERA 3TE5B 3I561 4E30A 2QLVB 1NJI2 2OOXB 3D6WA 3JAMf 1K732 3CC41 2QKDA 2QRCB 1I50I 4RVHA 2QRDB 1YIJ1 1R9TI 2BJOA 2EGTA 3S17I 3H0GI 5D1OA 4QTTA 1VQ5Z 4RVGA 4HGZA 2DE5A 3I07A 2OTJ1 3IX0A 3EEDA 3I56Z 2F4OA 1VQO1 2E9HA 3S14I 3ESWA 4A3MI 4A3LI 1JWHC 4MXUA 3I4NI 3JAMb 4RV9A 2H85A 1K9M2 3CC4Z 2R7ZI 3CCS1 1JJ2Y 2PK7A 1YIJZ 3CCQ1 1VQM1 4XX2A 5C4JI 4CL1A 3LUSA 5CM2M 2E2HI 4Y7NI 4RS4A 2O53A 3I551 1VQ41 3S2HI 1X0TA 3F3FC 2O4HA 3CCJZ 5A2Qf 2DE6A 3CC71 1WW9A 4A3FI 5C44I 3OW2Z 1YJN1 4RVDA 2HU9A 1VLAA 2GU2A 1RNIA 2OZKA 3RZDI 3CCSZ 4EWCA 2Y0SA 2PMZA 1M902 2QEX1 3CCQZ 1VQMZ 1KC81 3TDHB 2WAQA 2OOYB 1RLYA 4NH1C 5AN9F 2JS4A 2E2II 3BG1B 2DE7A 3G4S1 1QF8A 2PM9A 2QA41 2VUGA 1W2BY 5A2Qb 5D1PA 2GTIA 1VQP1 5C3EI 1P9NA 1Z01A 2YU9I 3CC7Z 3H3VJ 1Q861 1VQK1 2QREB 4NBCA 3NFZA 1I3QI 1Q811 1K9M1 1USPB 3CMA1 1YJNZ 1VQN1 2YADA 3NH5A 3GTLI 3GTOI 2K3RA 4TNUA 3CXCY 1VQ9Z 1TWAI 1Q821 4QTUA 2JA5I 3GTKI 4BY1I 1TWHI 2QR1B 1YUAA 4NBEA 2NVYI 3VB9A 3S2DI 3KIFA 4E31A 5C4XI 1SFOI 3CCU1 1Y1VI 2KI7B 3IF8A 2P28A 2KPIA 1VQKZ 4DK1A 1Y1VS 1QVFY 4NB8A 1VQNZ 2F4MA 1N8R2 3G711 3D9XA 3MONA 2JR6A 1JJ2Z 1KD11 3CCR1 2JMOA 1KC82 2JA6I 1M901 3NDJA 2RHBA 1K83I 1ZH1A 4Y52I 3P5JB 1YHQ1 2V8IA 3NH8A 4RVFA 1S721 3CD61 3CCUZ 1Q862 4NBDA 1Q812 3CC21 2RT9A 4AYBA 1RO4A 3J80f 1DL6A 3CCE1 1TFIA 4E33A 3HOUI 3CCRZ 1Q822 1X3ZA 3PO2I 1KQSZ 2Q4ZA 3HKZA 4MRIA 1QVGY 4MD9A 5LL6f 4A3CI 1VQL1 2OTJZ 1YJ91 1VQ81 3KIHA 1YI21 3HOYI 1VQOZ 2K5RA 1S72Z 2GTHA 3CD6Z 4A3EI 4S1TA 2R93I 3J80b 5T64A 3BG0B 4HGYA 2HF1A 1KD12 1YJW1 1N8R1 3VMIA 2B63I 5T6BA 2M48A 3J81f 4MH4A 2M6NA 3CXCZ 4BY7I 4NFRA 3I55Z 1VQ61 4E2XA 3J7A4 1VQ4Z 4MD8A 4E32A 1VQ8Z 1YI2Z 4E2ZA 1Q7Y1 3VMGA 2IZ4A 5IP7I 1LQLA 3CPWY 2WB1A 4A3BI 5IT9f 4A3GI 2RPRA 3QWUA 1VQ71 1YJWZ 3J81b 2RIQA 3GTJI 2J6AA 1K8A1 1ZB9A 2QEXZ 3VTNA 1USPA 3OW2Y 4NB9A 3G4SZ 2QA4Z 1VQ6Z 3CQZI 1VQPZ 3CME1 5IT9b 1VQ51 1M1K1 2I3CA 1ML8A 4NOZA 3HOXI 3CMAZ 4NBGA 1VQ7Z 1N2FA 1RO2A 3K7AI 4DGLA 1TWFI 3M4OI 2RBLA 2R92I 1NP6A 2V8JA 2OTL1 1QVGZ 5D1OB 1ZB8A 2AKLA 1Q7Y2 2IZ3A 1X3WA 2LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX b;  5LL6 f;  3JAM b;  5A2Q b;  5IT9 b;  3J7A 4;  3J80 b;  3J81 b; 
#chains in the Genus database with same CATH topology
 1YIT 1;  3Q87 A;  4A3J I;  3CME Z;  1NUI A;  4MON A;  4E2Y A;  3MZL B;  3GTQ I;  5IP9 I;  3G71 Z;  3CCJ 1;  3HOV I;  1WII A;  1K8A 2;  1KRL A;  4BBS I;  3G6E 1;  3MZK B;  4DQY B;  3FQQ A;  5FLX f;  3IFU A;  2E2J I;  3S16 I;  3CCV 1;  4BXX I;  2OTL Z;  2JUB A;  1TWC I;  4BBR I;  1YHQ Z;  1I6H I;  4HH4 A;  1W2B Z;  5T67 A;  2R6M A;  2NVX I;  3S1M I;  4NBF A;  4A3I I;  4A3K I;  1YIT Z;  1S7M A;  2W04 A;  2ZAE B;  5FLM I;  1M1K 2;  3CPW Z;  3CC2 Z;  3T4N B;  4NBH A;  3CCM 1;  3CCE Z;  3GTM I;  3FKI I;  3HOW I;  3NDI A;  3IR7 A;  1NJI 1;  3G6E Z;  3GTM S;  3F3P C;  5FLX b;  1L1O C;  2LIY A;  2JA7 I;  2JNY A;  1K73 1;  1TWG I;  1VQL Z;  3CCV Z;  2V8K A;  1YJ9 Z;  2P3Y A;  1QYP A;  3CCL 1;  1VQ9 1;  2E7Z A;  1KQS Y;  2NVQ I;  3S1N I;  2Q51 A;  1Y1W I;  4NBB A;  1FDI A;  1YUK A;  2W03 A;  1QXF A;  3VMH A;  1QVF Z;  3GKQ A;  1WZN A;  1RQF A;  3FQM A;  3I4M I;  3CCM Z;  3GCF A;  4NBA A;  3S1R I;  2VF1 A;  3GTP I;  1PFT A;  3RZO I;  1WCM I;  4A3D I;  2VPX A;  2VUM I;  3GTG I;  3M3Y I;  3PO3 I;  3NH4 A;  3S15 I;  4E2W A;  2JA8 I;  1Z02 A;  4MD7 A;  3S1Q I;  2JIR A;  1Z03 A;  3PO3 S;  4A93 I;  3CCL Z;  3U50 C;  3HOZ I;  1RO0 A;  4X6A I;  2NVT I;  2G2K A;  1Y8C A;  3EER A;  3TE5 B;  3I56 1;  4E30 A;  2QLV B;  1FDO A;  1NJI 2;  2OOX B;  3D6W A;  3JAM f;  1K73 2;  3CC4 1;  2QKD A;  2QRC B;  1I50 I;  4RVH A;  2QRD B;  1YIJ 1;  1R9T I;  2BJO A;  2EGT A;  3S17 I;  3H0G I;  5D1O A;  4QTT A;  1VQ5 Z;  4RVG A;  4HGZ A;  2DE5 A;  3I07 A;  2OTJ 1;  3IX0 A;  2V3V A;  3EED A;  3I56 Z;  2F4O A;  1VQO 1;  2E9H A;  3S14 I;  3ESW A;  4A3M I;  4A3L I;  1JWH C;  4MXU A;  3I4N I;  3JAM b;  2AYD A;  4RV9 A;  2H85 A;  1K9M 2;  3CC4 Z;  2R7Z I;  3CCS 1;  1JJ2 Y;  2PK7 A;  1YIJ Z;  3CCQ 1;  1VQM 1;  4XX2 A;  5C4J I;  4CL1 A;  3LUS A;  5CM2 M;  2E2H I;  4Y7N I;  4RS4 A;  2O53 A;  3I55 1;  1VQ4 1;  3S2H I;  1X0T A;  3F3F C;  2O4H A;  3CCJ Z;  5A2Q f;  2DE6 A;  3CC7 1;  1WW9 A;  4A3F I;  5C44 I;  3OW2 Z;  1YJN 1;  4RVD A;  2HU9 A;  1VLA A;  2GU2 A;  1RNI A;  2VPY A;  2OZK A;  3RZD I;  3CCS Z;  4EWC A;  2Y0S A;  2PMZ A;  1M90 2;  2QEX 1;  3CCQ Z;  1VQM Z;  1KC8 1;  3TDH B;  2WAQ A;  2OOY B;  1RLY A;  4NH1 C;  5AN9 F;  2JS4 A;  2E2I I;  3BG1 B;  2DE7 A;  3G4S 1;  2JIQ A;  1QF8 A;  2PM9 A;  2QA4 1;  2VUG A;  1W2B Y;  5A2Q b;  5D1P A;  2GTI A;  1VQP 1;  5C3E I;  1P9N A;  1Z01 A;  2YU9 I;  3CC7 Z;  3H3V J;  1Q86 1;  1VQK 1;  2QRE B;  4NBC A;  3NFZ A;  1I3Q I;  1Q81 1;  1K9M 1;  1USP B;  3CMA 1;  1YJN Z;  1VQN 1;  2YAD A;  3NH5 A;  3GTL I;  3GTO I;  2K3R A;  2VPZ A;  4TNU A;  3CXC Y;  1VQ9 Z;  1TWA I;  2IV2 X;  2V45 A;  1Q82 1;  4QTU A;  2JA5 I;  3GTK I;  4BY1 I;  1TWH I;  2QR1 B;  1YUA A;  4NBE A;  2NVY I;  3VB9 A;  3S2D I;  3KIF A;  4E31 A;  5C4X I;  1SFO I;  3CCU 1;  1Y1V I;  2KI7 B;  3IF8 A;  2P28 A;  2KPI A;  1VQK Z;  4DK1 A;  1Y1V S;  1QVF Y;  4NB8 A;  1VQN Z;  2F4M A;  1N8R 2;  3G71 1;  3D9X A;  3MON A;  2JR6 A;  1JJ2 Z;  1KD1 1;  3CCR 1;  2JMO A;  1KC8 2;  2JA6 I;  1M90 1;  3NDJ A;  2RHB A;  1K83 I;  1ZH1 A;  4Y52 I;  3P5J B;  1YHQ 1;  2V8I A;  3NH8 A;  4RVF A;  1S72 1;  3CD6 1;  3CCU Z;  1Q86 2;  4NBD A;  2LEX A;  1Q81 2;  3CC2 1;  2RT9 A;  4AYB A;  1RO4 A;  3J80 f;  1DL6 A;  3CCE 1;  1TFI A;  2NAP A;  4E33 A;  3HOU I;  3CCR Z;  1Q82 2;  1X3Z A;  1Q16 A;  3PO2 I;  1KQS Z;  2Q4Z A;  3HKZ A;  4MRI A;  1QVG Y;  4MD9 A;  5LL6 f;  4A3C I;  1VQL 1;  2OTJ Z;  2JIO A;  1YJ9 1;  1VQ8 1;  3KIH A;  1YI2 1;  3HOY I;  1VQO Z;  2K5R A;  1S72 Z;  2GTH A;  3CD6 Z;  4A3E I;  4S1T A;  2R93 I;  3J80 b;  5T64 A;  3BG0 B;  4HGY A;  2HF1 A;  1KD1 2;  1YJW 1;  1N8R 1;  3VMI A;  2B63 I;  5T6B A;  2M48 A;  3J81 f;  4MH4 A;  2M6N A;  3CXC Z;  1AA6 A;  4BY7 I;  4NFR A;  3I55 Z;  1VQ6 1;  4E2X A;  3J7A 4;  1VQ4 Z;  4MD8 A;  4E32 A;  1VQ8 Z;  1YI2 Z;  4E2Z A;  1Q7Y 1;  3VMG A;  2IZ4 A;  5IP7 I;  1LQL A;  3CPW Y;  2WB1 A;  4A3B I;  5IT9 f;  4A3G I;  2RPR A;  3QWU A;  1VQ7 1;  1YJW Z;  3J81 b;  2JIM A;  2RIQ A;  3GTJ I;  2J6A A;  1K8A 1;  1ZB9 A;  3D2L A;  1SIW A;  2QEX Z;  3VTN A;  1USP A;  3OW2 Y;  4NB9 A;  3G4S Z;  2QA4 Z;  1VQ6 Z;  2JIP A;  3CQZ I;  1VQP Z;  3CME 1;  5IT9 b;  1VQ5 1;  1M1K 1;  2I3C A;  1ML8 A;  4NOZ A;  3HOX I;  3CMA Z;  4NBG A;  2VPW A;  1VQ7 Z;  1N2F A;  1RO2 A;  3K7A I;  4DGL A;  1TWF I;  3M4O I;  1WJ2 A;  2RBL A;  1NP6 A;  2V8J A;  2R92 I;  2OTL 1;  1QVG Z;  5D1O B;  1ZB8 A;  2AKL A;  1Q7Y 2;  2IZ3 A;  1X3W A;  2LFU A; 
#chains in the Genus database with same CATH homology
 1YIT 1;  3Q87 A;  4A3J I;  3CME Z;  1NUI A;  4MON A;  4E2Y A;  3MZL B;  3GTQ I;  5IP9 I;  3G71 Z;  3CCJ 1;  3HOV I;  1WII A;  1K8A 2;  1KRL A;  4BBS I;  3G6E 1;  3MZK B;  4DQY B;  3FQQ A;  5FLX f;  3IFU A;  2E2J I;  3S16 I;  3CCV 1;  4BXX I;  2OTL Z;  2JUB A;  1TWC I;  4BBR I;  1YHQ Z;  1I6H I;  4HH4 A;  1W2B Z;  5T67 A;  2R6M A;  2NVX I;  3S1M I;  4NBF A;  4A3I I;  4A3K I;  1YIT Z;  1S7M A;  2W04 A;  2ZAE B;  5FLM I;  1M1K 2;  3CPW Z;  3CC2 Z;  3T4N B;  4NBH A;  3CCM 1;  3CCE Z;  3GTM I;  3FKI I;  3HOW I;  3NDI A;  1NJI 1;  3G6E Z;  3GTM S;  3F3P C;  5FLX b;  1L1O C;  2LIY A;  2JA7 I;  2JNY A;  1K73 1;  1TWG I;  1VQL Z;  3CCV Z;  2V8K A;  1YJ9 Z;  2P3Y A;  1QYP A;  3CCL 1;  1VQ9 1;  1KQS Y;  2NVQ I;  3S1N I;  2Q51 A;  1Y1W I;  4NBB A;  1YUK A;  2W03 A;  3VMH A;  1QVF Z;  3GKQ A;  1RQF A;  3FQM A;  3I4M I;  3CCM Z;  3GCF A;  4NBA A;  3S1R I;  2VF1 A;  3GTP I;  1PFT A;  3RZO I;  1WCM I;  4A3D I;  2VUM I;  3GTG I;  3M3Y I;  3PO3 I;  3NH4 A;  3S15 I;  4E2W A;  2JA8 I;  1Z02 A;  4MD7 A;  3S1Q I;  1Z03 A;  3PO3 S;  4A93 I;  3CCL Z;  3U50 C;  3HOZ I;  1RO0 A;  4X6A I;  2NVT I;  2G2K A;  3EER A;  3TE5 B;  3I56 1;  4E30 A;  2QLV B;  1NJI 2;  2OOX B;  3D6W A;  3JAM f;  1K73 2;  3CC4 1;  2QKD A;  2QRC B;  1I50 I;  4RVH A;  2QRD B;  1YIJ 1;  1R9T I;  2BJO A;  2EGT A;  3S17 I;  3H0G I;  5D1O A;  4QTT A;  1VQ5 Z;  4RVG A;  4HGZ A;  2DE5 A;  3I07 A;  2OTJ 1;  3IX0 A;  3EED A;  3I56 Z;  2F4O A;  1VQO 1;  2E9H A;  3S14 I;  3ESW A;  4A3M I;  4A3L I;  1JWH C;  4MXU A;  3I4N I;  3JAM b;  4RV9 A;  2H85 A;  1K9M 2;  3CC4 Z;  2R7Z I;  3CCS 1;  1JJ2 Y;  2PK7 A;  1YIJ Z;  3CCQ 1;  1VQM 1;  4XX2 A;  5C4J I;  4CL1 A;  3LUS A;  5CM2 M;  2E2H I;  4Y7N I;  4RS4 A;  2O53 A;  3I55 1;  1VQ4 1;  3S2H I;  1X0T A;  3F3F C;  2O4H A;  3CCJ Z;  5A2Q f;  2DE6 A;  3CC7 1;  1WW9 A;  4A3F I;  5C44 I;  3OW2 Z;  1YJN 1;  4RVD A;  2HU9 A;  1VLA A;  2GU2 A;  1RNI A;  2OZK A;  3RZD I;  3CCS Z;  4EWC A;  2Y0S A;  2PMZ A;  1M90 2;  2QEX 1;  3CCQ Z;  1VQM Z;  1KC8 1;  3TDH B;  2WAQ A;  2OOY B;  1RLY A;  4NH1 C;  5AN9 F;  2JS4 A;  2E2I I;  3BG1 B;  2DE7 A;  3G4S 1;  1QF8 A;  2PM9 A;  2QA4 1;  2VUG A;  1W2B Y;  5A2Q b;  5D1P A;  2GTI A;  1VQP 1;  5C3E I;  1P9N A;  1Z01 A;  2YU9 I;  3CC7 Z;  3H3V J;  1Q86 1;  1VQK 1;  2QRE B;  4NBC A;  3NFZ A;  1I3Q I;  1Q81 1;  1K9M 1;  1USP B;  3CMA 1;  1YJN Z;  1VQN 1;  2YAD A;  3NH5 A;  3GTL I;  3GTO I;  2K3R A;  4TNU A;  3CXC Y;  1VQ9 Z;  1TWA I;  1Q82 1;  4QTU A;  2JA5 I;  3GTK I;  4BY1 I;  1TWH I;  2QR1 B;  1YUA A;  4NBE A;  2NVY I;  3VB9 A;  3S2D I;  3KIF A;  4E31 A;  5C4X I;  1SFO I;  3CCU 1;  1Y1V I;  2KI7 B;  3IF8 A;  2P28 A;  2KPI A;  1VQK Z;  4DK1 A;  1Y1V S;  1QVF Y;  4NB8 A;  1VQN Z;  2F4M A;  1N8R 2;  3G71 1;  3D9X A;  3MON A;  2JR6 A;  1JJ2 Z;  1KD1 1;  3CCR 1;  2JMO A;  1KC8 2;  2JA6 I;  1M90 1;  3NDJ A;  2RHB A;  1K83 I;  1ZH1 A;  4Y52 I;  3P5J B;  1YHQ 1;  2V8I A;  3NH8 A;  4RVF A;  1S72 1;  3CD6 1;  3CCU Z;  1Q86 2;  4NBD A;  1Q81 2;  3CC2 1;  2RT9 A;  4AYB A;  1RO4 A;  3J80 f;  1DL6 A;  3CCE 1;  1TFI A;  4E33 A;  3HOU I;  3CCR Z;  1Q82 2;  1X3Z A;  3PO2 I;  1KQS Z;  2Q4Z A;  3HKZ A;  4MRI A;  1QVG Y;  4MD9 A;  5LL6 f;  4A3C I;  1VQL 1;  2OTJ Z;  1YJ9 1;  1VQ8 1;  3KIH A;  1YI2 1;  3HOY I;  1VQO Z;  2K5R A;  1S72 Z;  2GTH A;  3CD6 Z;  4A3E I;  4S1T A;  2R93 I;  3J80 b;  5T64 A;  3BG0 B;  4HGY A;  2HF1 A;  1KD1 2;  1YJW 1;  1N8R 1;  3VMI A;  2B63 I;  5T6B A;  2M48 A;  3J81 f;  4MH4 A;  2M6N A;  3CXC Z;  4BY7 I;  4NFR A;  3I55 Z;  1VQ6 1;  4E2X A;  3J7A 4;  1VQ4 Z;  4MD8 A;  4E32 A;  1VQ8 Z;  1YI2 Z;  4E2Z A;  1Q7Y 1;  3VMG A;  2IZ4 A;  5IP7 I;  1LQL A;  3CPW Y;  2WB1 A;  4A3B I;  5IT9 f;  4A3G I;  2RPR A;  3QWU A;  1VQ7 1;  1YJW Z;  3J81 b;  2RIQ A;  3GTJ I;  2J6A A;  1K8A 1;  1ZB9 A;  2QEX Z;  3VTN A;  1USP A;  3OW2 Y;  4NB9 A;  3G4S Z;  2QA4 Z;  1VQ6 Z;  3CQZ I;  1VQP Z;  3CME 1;  5IT9 b;  1VQ5 1;  1M1K 1;  2I3C A;  1ML8 A;  4NOZ A;  3HOX I;  3CMA Z;  4NBG A;  1VQ7 Z;  1N2F A;  1RO2 A;  3K7A I;  4DGL A;  1TWF I;  3M4O I;  2RBL A;  2R92 I;  1NP6 A;  2V8J A;  2OTL 1;  1QVG Z;  5D1O B;  1ZB8 A;  2AKL A;  1Q7Y 2;  2IZ3 A;  1X3W A;  2LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...