5A2Qb

Structure of the hcv ires bound to the human ribosome
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
82
structure length
82
Chain Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
total genus 8
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qb00
3J81b 5LL6f 3J80b 3J7A4 5A2Qb 3JAMb 5IT9b 5FLXb
chains in the Genus database with same CATH superfamily
5CM2M 3GTKI 3GTQI 2NVQI 3JAMb 3NH4A 3CMEZ 1KC82 2HU9A 3OW2Y 3CCM1 3H3VJ 4BBSI 1M902 4MH4A 2WB1A 2V8KA 1VQ6Z 3HOUI 5A2Qf 3S17I 3NDJA 1VQ71 4NBBA 4RVHA 4TNUA 2E2JI 1NP6A 1RO2A 1YJW1 3MZLB 3CPWY 4QTTA 3J81f 3M4OI 3G711 1Q862 2J6AA 1S7MA 2P28A 4A3KI 2K5RA 1VQ5Z 1YIT1 2QEX1 4MD9A 1YJWZ 2E2HI 2O53A 4A3LI 1VQK1 3PO3I 3G4S1 2P3YA 2QEXZ 3CCJ1 1Q822 1YHQZ 2F4OA 1RQFA 2NVYI 3S16I 3IF8A 3S1RI 3G4SZ 4NOZA 3CCJZ 1ML8A 3HOZI 1Q16A 4BXXI 2WAQA 2OTLZ 1VQMZ 3PO2I 3MONA 2VPZA 1VQ4Z 2QRDB 3CCR1 1Y8CA 2LEXA 2I3CA 2JMOA 1K8A2 4A3GI 2PMZA 2JA5I 2QA4Z 4CL1A 4E30A 3HKZA 3CCRZ 4NFRA 3CCQZ 4E2WA 2E9HA 2V45A 1M901 4A3MI 3HOVI 1TWGI 2B63I 3CXCZ 2YU9I 1K732 1K9M2 3CCV1 1DL6A 3GKQA 2JR6A 4S1TA 3J80f 3VMIA 4MXUA 3I551 3P5JB 5D1OA 4RVDA 2R7ZI 1X3ZA 3IX0A 1M1K1 3CCE1 4DGLA 1X0TA 3CCVZ 3BG0B 4NBFA 4NBCA 3S1NI 1USPB 1YUAA 1NJI2 2QRCB 3GTLI 1VLAA 1VQ9Z 4HH4A 4EWCA 1Q7Y2 2DE6A 3S14I 2IZ4A 3CD6Z 1N2FA 1VQ61 3I07A 3OW2Z 2QR1B 1WZNA 3CQZI 3H0GI 1Q821 1KRLA 5IT9f 4X6AI 2RT9A 4DQYB 1ZB9A 3NFZA 2F4MA 1QF8A 2PK7A 5C4JI 4E2ZA 2JNYA 1VQ51 3CC2Z 3CPWZ 1Y1VS 2JIRA 2JIQA 2NAPA 4NBEA 1W2BY 2RHBA 3VMGA 3RZDI 1RO0A 3IFUA 3EEDA 2QREB 3IR7A 4RS4A 4AYBA 3VTNA 4HGYA 4MRIA 4Y7NI 4E32A 4NB9A 3JAMf 4E33A 1VQL1 1K8A1 1YHQ1 1WCMI 3NH8A 1JJ2Y 3D9XA 3CC7Z 4HGZA 2W03A 1VQLZ 1KD12 3F3PC 5AN9F 2GTIA 3U50C 3NH5A 2O4HA 3HOWI 3FQMA 1K731 3CC4Z 2OTL1 1VQM1 3I4MI 2VUMI 4Y52I 2LFUA 4MD8A 2E2II 1WIIA 1VQ41 1RO4A 1I3QI 1X3WA 1ZH1A 4RVFA 1AA6A 1VQ8Z 2QA41 1S72Z 2VF1A 4A93I 1NJI1 4A3DI 4MD7A 2OTJZ 2OOXB 3CCQ1 1ZB8A 3VB9A 1Q7Y1 3I4NI 2IV2X 2Y0SA 4MONA 3G6EZ 3S15I 4RV9A 3GTMS 2R93I 1NUIA 3I561 1KC81 2JUBA 5FLXb 1VQOZ 1KQSZ 3D6WA 3NDIA 4QTUA 2KI7B 1KQSY 4NBHA 1PFTA 3GTJI 1SIWA 3BG1B 3I56Z 1VQNZ 4A3FI 4BY7I 3CCSZ 1VQ91 2QLVB 4DK1A 3F3FC 5FLMI 2Q51A 1FDOA 2K3RA 1Q861 1QYPA 2PM9A 3CD61 4NBDA 2JA8I 3FKII 1YIJ1 2W04A 5C4XI 2IZ3A 1YI2Z 2AYDA 2JIPA 2DE7A 4RVGA 2RIQA 5D1OB 1P9NA 4E2XA 1YIJZ 1KD11 2RBLA 1TWAI 1Z01A 3CC21 3CCUZ 5A2Qb 4BBRI 1QVFZ 3S2HI 1L1OC 4E31A 2EGTA 1YJ9Z 5IP9I 2M48A 1QVFY 5T64A 1W2BZ 4BY1I 3J81b 3S1QI 3PO3S 1I50I 3CCLZ 2E7ZA 2VPXA 1Q812 1QVGY 1JWHC 1K83I 3KIFA 2V3VA 1RLYA 2RPRA 3D2LA 2V8JA 3CC71 1N8R2 3HOYI 3TE5B 1LQLA 1JJ2Z 2JIMA 1TWCI 5D1PA 1FDIA 3CCMZ 2JIOA 2NVXI 4A3EI 2QKDA 3GTGI 3CC41 2JA7I 1M1K2 2JS4A 4NB8A 2R6MA 4A3BI 3MZKB 2BJOA 1VQ7Z 3LUSA 1Y1WI 4NBGA 1RNIA 3M3YI 2VPWA 3GCFA 1K9M1 1TFIA 4NBAA 4A3II 1VQ81 3TDHB 2OOYB 3G71Z 1S721 2LIYA 1YITZ 2OTJ1 4NH1C 1Y1VI 1Z03A 2GU2A 5C3EI 3J7A4 1YUKA 2Q4ZA 3CMA1 3Q87A 3G6E1 2JA6I 1WJ2A 5T6BA 1VQKZ 5T67A 3VMHA 1VQO1 5LL6f 2HF1A 3K7AI 3CMAZ 3KIHA 1Z02A 1R9TI 2VPYA 4A3CI 3RZOI 1VQN1 2ZAEB 3GTOI 3CCS1 3J80b 3GTPI 2G2KA 3EERA 3FQQA 2OZKA 5C44I 3HOXI 1I6HI 1Q811 2R92I 3S1MI 1YI21 1VQP1 1QXFA 1USPA 1N8R1 5FLXf 2KPIA 2M6NA 4E2YA 3CCU1 1YJN1 1VQPZ 3CXCY 1YJ91 5IT9b 2AKLA 3QWUA 2VUGA 2GTHA 3ESWA 2DE5A 3GTMI 1TWFI 3CCL1 1YJNZ 5IP7I 3I55Z 4XX2A 1WW9A 2V8IA 3CME1 3T4NB 1TWHI 1QVGZ 2NVTI 3CCEZ 1SFOI 3S2DI 2YADA 4A3JI 2H85A
chains in the Genus database with same CATH topology
5CM2M 3GTKI 3GTQI 2NVQI 3JAMb 3NH4A 3CMEZ 1KC82 2HU9A 3OW2Y 3CCM1 3H3VJ 4BBSI 1M902 4MH4A 2WB1A 2V8KA 1VQ6Z 3HOUI 5A2Qf 3S17I 3NDJA 1VQ71 4NBBA 4RVHA 4TNUA 2E2JI 1NP6A 1RO2A 1YJW1 3MZLB 3CPWY 4QTTA 3J81f 3M4OI 3G711 1Q862 2J6AA 1S7MA 2P28A 4A3KI 2K5RA 1VQ5Z 1YIT1 2QEX1 4MD9A 1YJWZ 2E2HI 2O53A 4A3LI 1VQK1 3PO3I 3G4S1 2P3YA 2QEXZ 3CCJ1 1Q822 1YHQZ 2F4OA 1RQFA 2NVYI 3S16I 3IF8A 3S1RI 3G4SZ 4NOZA 3CCJZ 1ML8A 3HOZI 4BXXI 2WAQA 2OTLZ 1VQMZ 3PO2I 3MONA 1VQ4Z 2QRDB 3CCR1 2I3CA 2JMOA 1K8A2 4A3GI 2PMZA 2JA5I 2QA4Z 4CL1A 4E30A 3HKZA 3CCRZ 4NFRA 3CCQZ 4E2WA 2E9HA 1M901 4A3MI 3HOVI 1TWGI 2B63I 3CXCZ 2YU9I 1K732 1K9M2 3CCV1 1DL6A 3GKQA 2JR6A 4S1TA 3J80f 3VMIA 4MXUA 3I551 3P5JB 5D1OA 4RVDA 2R7ZI 1X3ZA 3IX0A 1M1K1 3CCE1 4DGLA 1X0TA 3CCVZ 3BG0B 4NBFA 4NBCA 3S1NI 1USPB 1YUAA 1NJI2 2QRCB 3GTLI 1VLAA 1VQ9Z 4HH4A 4EWCA 1Q7Y2 2DE6A 3S14I 2IZ4A 3CD6Z 1N2FA 1VQ61 3I07A 3OW2Z 2QR1B 3CQZI 3H0GI 1Q821 1KRLA 5IT9f 4X6AI 2RT9A 4DQYB 1ZB9A 3NFZA 2F4MA 1QF8A 2PK7A 5C4JI 4E2ZA 2JNYA 1VQ51 3CC2Z 3CPWZ 1Y1VS 4NBEA 1W2BY 2RHBA 3VMGA 3RZDI 1RO0A 3IFUA 3EEDA 2QREB 4RS4A 4AYBA 3VTNA 4HGYA 4MRIA 4Y7NI 4E32A 4NB9A 3JAMf 4E33A 1VQL1 1K8A1 1YHQ1 1WCMI 3NH8A 1JJ2Y 3D9XA 3CC7Z 4HGZA 2W03A 1VQLZ 1KD12 3F3PC 5AN9F 2GTIA 3U50C 3NH5A 2O4HA 3HOWI 3FQMA 1K731 3CC4Z 2OTL1 1VQM1 3I4MI 2VUMI 4Y52I 2LFUA 4MD8A 2E2II 1WIIA 1VQ41 1RO4A 1I3QI 1X3WA 1ZH1A 4RVFA 1VQ8Z 2QA41 1S72Z 2VF1A 4A93I 1NJI1 4A3DI 4MD7A 2OTJZ 2OOXB 3CCQ1 1ZB8A 3VB9A 1Q7Y1 3I4NI 2Y0SA 4MONA 3G6EZ 3S15I 4RV9A 3GTMS 2R93I 1NUIA 3I561 1KC81 2JUBA 5FLXb 1VQOZ 1KQSZ 3D6WA 3NDIA 4QTUA 2KI7B 1KQSY 4NBHA 1PFTA 3GTJI 3BG1B 3I56Z 1VQNZ 4A3FI 4BY7I 3CCSZ 1VQ91 2QLVB 4DK1A 3F3FC 5FLMI 2Q51A 2K3RA 1Q861 1QYPA 2PM9A 3CD61 4NBDA 2JA8I 3FKII 1YIJ1 2W04A 5C4XI 2IZ3A 1YI2Z 2DE7A 4RVGA 2RIQA 5D1OB 1P9NA 4E2XA 1YIJZ 1KD11 2RBLA 1TWAI 1Z01A 3CC21 3CCUZ 5A2Qb 4BBRI 1QVFZ 3S2HI 1L1OC 4E31A 2EGTA 1YJ9Z 5IP9I 2M48A 1QVFY 5T64A 1W2BZ 4BY1I 3J81b 3S1QI 3PO3S 1I50I 3CCLZ 1Q812 1QVGY 1JWHC 1K83I 3KIFA 1RLYA 2RPRA 2V8JA 3CC71 1N8R2 3HOYI 3TE5B 1LQLA 1JJ2Z 1TWCI 5D1PA 3CCMZ 2NVXI 4A3EI 2QKDA 3GTGI 3CC41 2JA7I 1M1K2 2JS4A 4NB8A 2R6MA 4A3BI 3MZKB 2BJOA 1VQ7Z 3LUSA 1Y1WI 4NBGA 1RNIA 3M3YI 3GCFA 1K9M1 1TFIA 4NBAA 4A3II 1VQ81 3TDHB 2OOYB 3G71Z 1S721 2LIYA 1YITZ 2OTJ1 4NH1C 1Y1VI 1Z03A 2GU2A 5C3EI 3J7A4 1YUKA 2Q4ZA 3CMA1 3Q87A 3G6E1 2JA6I 5T6BA 1VQKZ 5T67A 3VMHA 1VQO1 5LL6f 2HF1A 3K7AI 3CMAZ 3KIHA 1Z02A 1R9TI 4A3CI 3RZOI 1VQN1 2ZAEB 3GTOI 3CCS1 3J80b 3GTPI 2G2KA 3EERA 3FQQA 2OZKA 5C44I 3HOXI 1I6HI 1Q811 2R92I 3S1MI 1YI21 1VQP1 1USPA 1N8R1 5FLXf 2KPIA 2M6NA 4E2YA 3CCU1 1YJN1 1VQPZ 3CXCY 1YJ91 5IT9b 2AKLA 3QWUA 2VUGA 2GTHA 3ESWA 2DE5A 3GTMI 1TWFI 3CCL1 1YJNZ 5IP7I 3I55Z 4XX2A 1WW9A 2V8IA 3CME1 3T4NB 1TWHI 1QVGZ 2NVTI 3CCEZ 1SFOI 3S2DI 2YADA 4A3JI 2H85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 b;  5LL6 f;  3J80 b;  3J7A 4;  5A2Q b;  3JAM b;  5IT9 b;  5FLX b; 
#chains in the Genus database with same CATH topology
 5CM2 M;  3GTK I;  3GTQ I;  2NVQ I;  3JAM b;  3NH4 A;  3CME Z;  1KC8 2;  2HU9 A;  3OW2 Y;  3CCM 1;  3H3V J;  4BBS I;  1M90 2;  4MH4 A;  2WB1 A;  2V8K A;  1VQ6 Z;  3HOU I;  5A2Q f;  3S17 I;  3NDJ A;  1VQ7 1;  4NBB A;  4RVH A;  4TNU A;  2E2J I;  1NP6 A;  1RO2 A;  1YJW 1;  3MZL B;  3CPW Y;  4QTT A;  3J81 f;  3M4O I;  3G71 1;  1Q86 2;  2J6A A;  1S7M A;  2P28 A;  4A3K I;  2K5R A;  1VQ5 Z;  1YIT 1;  2QEX 1;  4MD9 A;  1YJW Z;  2E2H I;  2O53 A;  4A3L I;  1VQK 1;  3PO3 I;  3G4S 1;  2P3Y A;  2QEX Z;  3CCJ 1;  1Q82 2;  1YHQ Z;  2F4O A;  1RQF A;  2NVY I;  3S16 I;  3IF8 A;  3S1R I;  3G4S Z;  4NOZ A;  3CCJ Z;  1ML8 A;  3HOZ I;  1Q16 A;  4BXX I;  2WAQ A;  2OTL Z;  1VQM Z;  3PO2 I;  3MON A;  2VPZ A;  1VQ4 Z;  2QRD B;  3CCR 1;  1Y8C A;  2LEX A;  2I3C A;  2JMO A;  1K8A 2;  4A3G I;  2PMZ A;  2JA5 I;  2QA4 Z;  4CL1 A;  4E30 A;  3HKZ A;  3CCR Z;  4NFR A;  3CCQ Z;  4E2W A;  2E9H A;  2V45 A;  1M90 1;  4A3M I;  3HOV I;  1TWG I;  2B63 I;  3CXC Z;  2YU9 I;  1K73 2;  1K9M 2;  3CCV 1;  1DL6 A;  3GKQ A;  2JR6 A;  4S1T A;  3J80 f;  3VMI A;  4MXU A;  3I55 1;  3P5J B;  5D1O A;  4RVD A;  2R7Z I;  1X3Z A;  3IX0 A;  1M1K 1;  3CCE 1;  4DGL A;  1X0T A;  3CCV Z;  3BG0 B;  4NBF A;  4NBC A;  3S1N I;  1USP B;  1YUA A;  1NJI 2;  2QRC B;  3GTL I;  1VLA A;  1VQ9 Z;  4HH4 A;  4EWC A;  1Q7Y 2;  2DE6 A;  3S14 I;  2IZ4 A;  3CD6 Z;  1N2F A;  1VQ6 1;  3I07 A;  3OW2 Z;  2QR1 B;  1WZN A;  3CQZ I;  3H0G I;  1Q82 1;  1KRL A;  5IT9 f;  4X6A I;  2RT9 A;  4DQY B;  1ZB9 A;  3NFZ A;  2F4M A;  1QF8 A;  2PK7 A;  5C4J I;  4E2Z A;  2JNY A;  1VQ5 1;  3CC2 Z;  3CPW Z;  1Y1V S;  2JIR A;  2JIQ A;  2NAP A;  4NBE A;  1W2B Y;  2RHB A;  3VMG A;  3RZD I;  1RO0 A;  3IFU A;  3EED A;  2QRE B;  3IR7 A;  4RS4 A;  4AYB A;  3VTN A;  4HGY A;  4MRI A;  4Y7N I;  4E32 A;  4NB9 A;  3JAM f;  4E33 A;  1VQL 1;  1K8A 1;  1YHQ 1;  1WCM I;  3NH8 A;  1JJ2 Y;  3D9X A;  3CC7 Z;  4HGZ A;  2W03 A;  1VQL Z;  1KD1 2;  3F3P C;  5AN9 F;  2GTI A;  3U50 C;  3NH5 A;  2O4H A;  3HOW I;  3FQM A;  1K73 1;  3CC4 Z;  2OTL 1;  1VQM 1;  3I4M I;  2VUM I;  4Y52 I;  2LFU A;  4MD8 A;  2E2I I;  1WII A;  1VQ4 1;  1RO4 A;  1I3Q I;  1X3W A;  1ZH1 A;  4RVF A;  1AA6 A;  1VQ8 Z;  2QA4 1;  1S72 Z;  2VF1 A;  4A93 I;  1NJI 1;  4A3D I;  4MD7 A;  2OTJ Z;  2OOX B;  3CCQ 1;  1ZB8 A;  3VB9 A;  1Q7Y 1;  3I4N I;  2IV2 X;  2Y0S A;  4MON A;  3G6E Z;  3S15 I;  4RV9 A;  3GTM S;  2R93 I;  1NUI A;  3I56 1;  1KC8 1;  2JUB A;  5FLX b;  1VQO Z;  1KQS Z;  3D6W A;  3NDI A;  4QTU A;  2KI7 B;  1KQS Y;  4NBH A;  1PFT A;  3GTJ I;  1SIW A;  3BG1 B;  3I56 Z;  1VQN Z;  4A3F I;  4BY7 I;  3CCS Z;  1VQ9 1;  2QLV B;  4DK1 A;  3F3F C;  5FLM I;  2Q51 A;  1FDO A;  2K3R A;  1Q86 1;  1QYP A;  2PM9 A;  3CD6 1;  4NBD A;  2JA8 I;  3FKI I;  1YIJ 1;  2W04 A;  5C4X I;  2IZ3 A;  1YI2 Z;  2AYD A;  2JIP A;  2DE7 A;  4RVG A;  2RIQ A;  5D1O B;  1P9N A;  4E2X A;  1YIJ Z;  1KD1 1;  2RBL A;  1TWA I;  1Z01 A;  3CC2 1;  3CCU Z;  5A2Q b;  4BBR I;  1QVF Z;  3S2H I;  1L1O C;  4E31 A;  2EGT A;  1YJ9 Z;  5IP9 I;  2M48 A;  1QVF Y;  5T64 A;  1W2B Z;  4BY1 I;  3J81 b;  3S1Q I;  3PO3 S;  1I50 I;  3CCL Z;  2E7Z A;  2VPX A;  1Q81 2;  1QVG Y;  1JWH C;  1K83 I;  3KIF A;  2V3V A;  1RLY A;  2RPR A;  3D2L A;  2V8J A;  3CC7 1;  1N8R 2;  3HOY I;  3TE5 B;  1LQL A;  1JJ2 Z;  2JIM A;  1TWC I;  5D1P A;  1FDI A;  3CCM Z;  2JIO A;  2NVX I;  4A3E I;  2QKD A;  3GTG I;  3CC4 1;  2JA7 I;  1M1K 2;  2JS4 A;  4NB8 A;  2R6M A;  4A3B I;  3MZK B;  2BJO A;  1VQ7 Z;  3LUS A;  1Y1W I;  4NBG A;  1RNI A;  3M3Y I;  2VPW A;  3GCF A;  1K9M 1;  1TFI A;  4NBA A;  4A3I I;  1VQ8 1;  3TDH B;  2OOY B;  3G71 Z;  1S72 1;  2LIY A;  1YIT Z;  2OTJ 1;  4NH1 C;  1Y1V I;  1Z03 A;  2GU2 A;  5C3E I;  3J7A 4;  1YUK A;  2Q4Z A;  3CMA 1;  3Q87 A;  3G6E 1;  2JA6 I;  1WJ2 A;  5T6B A;  1VQK Z;  5T67 A;  3VMH A;  1VQO 1;  5LL6 f;  2HF1 A;  3K7A I;  3CMA Z;  3KIH A;  1Z02 A;  1R9T I;  2VPY A;  4A3C I;  3RZO I;  1VQN 1;  2ZAE B;  3GTO I;  3CCS 1;  3J80 b;  3GTP I;  2G2K A;  3EER A;  3FQQ A;  2OZK A;  5C44 I;  3HOX I;  1I6H I;  1Q81 1;  2R92 I;  3S1M I;  1YI2 1;  1VQP 1;  1QXF A;  1USP A;  1N8R 1;  5FLX f;  2KPI A;  2M6N A;  4E2Y A;  3CCU 1;  1YJN 1;  1VQP Z;  3CXC Y;  1YJ9 1;  5IT9 b;  2AKL A;  3QWU A;  2VUG A;  2GTH A;  3ESW A;  2DE5 A;  3GTM I;  1TWF I;  3CCL 1;  1YJN Z;  5IP7 I;  3I55 Z;  4XX2 A;  1WW9 A;  2V8I A;  3CME 1;  3T4N B;  1TWH I;  1QVG Z;  2NVT I;  3CCE Z;  1SFO I;  3S2D I;  2YAD A;  4A3J I;  2H85 A; 
#chains in the Genus database with same CATH homology
 5CM2 M;  3GTK I;  3GTQ I;  2NVQ I;  3JAM b;  3NH4 A;  3CME Z;  1KC8 2;  2HU9 A;  3OW2 Y;  3CCM 1;  3H3V J;  4BBS I;  1M90 2;  4MH4 A;  2WB1 A;  2V8K A;  1VQ6 Z;  3HOU I;  5A2Q f;  3S17 I;  3NDJ A;  1VQ7 1;  4NBB A;  4RVH A;  4TNU A;  2E2J I;  1NP6 A;  1RO2 A;  1YJW 1;  3MZL B;  3CPW Y;  4QTT A;  3J81 f;  3M4O I;  3G71 1;  1Q86 2;  2J6A A;  1S7M A;  2P28 A;  4A3K I;  2K5R A;  1VQ5 Z;  1YIT 1;  2QEX 1;  4MD9 A;  1YJW Z;  2E2H I;  2O53 A;  4A3L I;  1VQK 1;  3PO3 I;  3G4S 1;  2P3Y A;  2QEX Z;  3CCJ 1;  1Q82 2;  1YHQ Z;  2F4O A;  1RQF A;  2NVY I;  3S16 I;  3IF8 A;  3S1R I;  3G4S Z;  4NOZ A;  3CCJ Z;  1ML8 A;  3HOZ I;  4BXX I;  2WAQ A;  2OTL Z;  1VQM Z;  3PO2 I;  3MON A;  1VQ4 Z;  2QRD B;  3CCR 1;  2I3C A;  2JMO A;  1K8A 2;  4A3G I;  2PMZ A;  2JA5 I;  2QA4 Z;  4CL1 A;  4E30 A;  3HKZ A;  3CCR Z;  4NFR A;  3CCQ Z;  4E2W A;  2E9H A;  1M90 1;  4A3M I;  3HOV I;  1TWG I;  2B63 I;  3CXC Z;  2YU9 I;  1K73 2;  1K9M 2;  3CCV 1;  1DL6 A;  3GKQ A;  2JR6 A;  4S1T A;  3J80 f;  3VMI A;  4MXU A;  3I55 1;  3P5J B;  5D1O A;  4RVD A;  2R7Z I;  1X3Z A;  3IX0 A;  1M1K 1;  3CCE 1;  4DGL A;  1X0T A;  3CCV Z;  3BG0 B;  4NBF A;  4NBC A;  3S1N I;  1USP B;  1YUA A;  1NJI 2;  2QRC B;  3GTL I;  1VLA A;  1VQ9 Z;  4HH4 A;  4EWC A;  1Q7Y 2;  2DE6 A;  3S14 I;  2IZ4 A;  3CD6 Z;  1N2F A;  1VQ6 1;  3I07 A;  3OW2 Z;  2QR1 B;  3CQZ I;  3H0G I;  1Q82 1;  1KRL A;  5IT9 f;  4X6A I;  2RT9 A;  4DQY B;  1ZB9 A;  3NFZ A;  2F4M A;  1QF8 A;  2PK7 A;  5C4J I;  4E2Z A;  2JNY A;  1VQ5 1;  3CC2 Z;  3CPW Z;  1Y1V S;  4NBE A;  1W2B Y;  2RHB A;  3VMG A;  3RZD I;  1RO0 A;  3IFU A;  3EED A;  2QRE B;  4RS4 A;  4AYB A;  3VTN A;  4HGY A;  4MRI A;  4Y7N I;  4E32 A;  4NB9 A;  3JAM f;  4E33 A;  1VQL 1;  1K8A 1;  1YHQ 1;  1WCM I;  3NH8 A;  1JJ2 Y;  3D9X A;  3CC7 Z;  4HGZ A;  2W03 A;  1VQL Z;  1KD1 2;  3F3P C;  5AN9 F;  2GTI A;  3U50 C;  3NH5 A;  2O4H A;  3HOW I;  3FQM A;  1K73 1;  3CC4 Z;  2OTL 1;  1VQM 1;  3I4M I;  2VUM I;  4Y52 I;  2LFU A;  4MD8 A;  2E2I I;  1WII A;  1VQ4 1;  1RO4 A;  1I3Q I;  1X3W A;  1ZH1 A;  4RVF A;  1VQ8 Z;  2QA4 1;  1S72 Z;  2VF1 A;  4A93 I;  1NJI 1;  4A3D I;  4MD7 A;  2OTJ Z;  2OOX B;  3CCQ 1;  1ZB8 A;  3VB9 A;  1Q7Y 1;  3I4N I;  2Y0S A;  4MON A;  3G6E Z;  3S15 I;  4RV9 A;  3GTM S;  2R93 I;  1NUI A;  3I56 1;  1KC8 1;  2JUB A;  5FLX b;  1VQO Z;  1KQS Z;  3D6W A;  3NDI A;  4QTU A;  2KI7 B;  1KQS Y;  4NBH A;  1PFT A;  3GTJ I;  3BG1 B;  3I56 Z;  1VQN Z;  4A3F I;  4BY7 I;  3CCS Z;  1VQ9 1;  2QLV B;  4DK1 A;  3F3F C;  5FLM I;  2Q51 A;  2K3R A;  1Q86 1;  1QYP A;  2PM9 A;  3CD6 1;  4NBD A;  2JA8 I;  3FKI I;  1YIJ 1;  2W04 A;  5C4X I;  2IZ3 A;  1YI2 Z;  2DE7 A;  4RVG A;  2RIQ A;  5D1O B;  1P9N A;  4E2X A;  1YIJ Z;  1KD1 1;  2RBL A;  1TWA I;  1Z01 A;  3CC2 1;  3CCU Z;  5A2Q b;  4BBR I;  1QVF Z;  3S2H I;  1L1O C;  4E31 A;  2EGT A;  1YJ9 Z;  5IP9 I;  2M48 A;  1QVF Y;  5T64 A;  1W2B Z;  4BY1 I;  3J81 b;  3S1Q I;  3PO3 S;  1I50 I;  3CCL Z;  1Q81 2;  1QVG Y;  1JWH C;  1K83 I;  3KIF A;  1RLY A;  2RPR A;  2V8J A;  3CC7 1;  1N8R 2;  3HOY I;  3TE5 B;  1LQL A;  1JJ2 Z;  1TWC I;  5D1P A;  3CCM Z;  2NVX I;  4A3E I;  2QKD A;  3GTG I;  3CC4 1;  2JA7 I;  1M1K 2;  2JS4 A;  4NB8 A;  2R6M A;  4A3B I;  3MZK B;  2BJO A;  1VQ7 Z;  3LUS A;  1Y1W I;  4NBG A;  1RNI A;  3M3Y I;  3GCF A;  1K9M 1;  1TFI A;  4NBA A;  4A3I I;  1VQ8 1;  3TDH B;  2OOY B;  3G71 Z;  1S72 1;  2LIY A;  1YIT Z;  2OTJ 1;  4NH1 C;  1Y1V I;  1Z03 A;  2GU2 A;  5C3E I;  3J7A 4;  1YUK A;  2Q4Z A;  3CMA 1;  3Q87 A;  3G6E 1;  2JA6 I;  5T6B A;  1VQK Z;  5T67 A;  3VMH A;  1VQO 1;  5LL6 f;  2HF1 A;  3K7A I;  3CMA Z;  3KIH A;  1Z02 A;  1R9T I;  4A3C I;  3RZO I;  1VQN 1;  2ZAE B;  3GTO I;  3CCS 1;  3J80 b;  3GTP I;  2G2K A;  3EER A;  3FQQ A;  2OZK A;  5C44 I;  3HOX I;  1I6H I;  1Q81 1;  2R92 I;  3S1M I;  1YI2 1;  1VQP 1;  1USP A;  1N8R 1;  5FLX f;  2KPI A;  2M6N A;  4E2Y A;  3CCU 1;  1YJN 1;  1VQP Z;  3CXC Y;  1YJ9 1;  5IT9 b;  2AKL A;  3QWU A;  2VUG A;  2GTH A;  3ESW A;  2DE5 A;  3GTM I;  1TWF I;  3CCL 1;  1YJN Z;  5IP7 I;  3I55 Z;  4XX2 A;  1WW9 A;  2V8I A;  3CME 1;  3T4N B;  1TWH I;  1QVG Z;  2NVT I;  3CCE Z;  1SFO I;  3S2D I;  2YAD A;  4A3J I;  2H85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...