5A2Qb

Structure of the hcv ires bound to the human ribosome
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
82
structure length
82
Chain Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qb00
5IT9b 5LL6f 3J81b 3J80b 5FLXb 5A2Qb 3JAMb 3J7A4
chains in the Genus database with same CATH superfamily
2RBLA 1RO0A 1VQNZ 3CC41 3J81f 2E2HI 3HOWI 2KPIA 2R92I 1VQL1 2QR1B 3NH5A 3CXCZ 4RVHA 1KRLA 1VQMZ 1Q16A 2QKDA 4TNUA 4HH4A 2W04A 3NH4A 3F3FC 1X0TA 1AA6A 4NB9A 2WB1A 2KI7B 3H0GI 3G6EZ 3CMEZ 1K9M1 2JMOA 2JIPA 1VQ81 4QTUA 3GTOI 3CCVZ 4BY7I 3S14I 3H3VJ 2F4MA 3FQMA 3CC71 2NAPA 1VQOZ 2EGTA 1Q7Y1 1K83I 2G2KA 1M902 1VQ91 1S7MA 1VQ71 4Y7NI 2E9HA 3PO3S 2VPWA 3NDJA 3CMA1 1NP6A 3S2DI 3S2HI 2YU9I 4E32A 3TE5B 1YJ9Z 1Q861 3I56Z 2DE5A 1YHQZ 1Y8CA 1M1K2 2OTLZ 3CCLZ 2V45A 1VQ51 2OOYB 2VUMI 2JS4A 1KC81 2NVQI 5D1PA 1VQN1 3M3YI 3CPWY 3HOYI 4NBAA 2AYDA 1TFIA 2RIQA 1YUKA 4A3MI 2NVYI 2OTJ1 2M48A 4NBCA 2F4OA 1QVGZ 2QRCB 3GTMS 1YI2Z 2OOXB 3VMIA 1TWCI 4A3FI 3D2LA 2E2JI 3CCV1 3CCMZ 3G71Z 1QXFA 2E7ZA 1QVFY 1W2BY 1N8R2 3CCE1 4MD8A 1Z02A 2VPXA 4RV9A 4A3GI 1L1OC 4NBEA 2JNYA 4NFRA 1YJ91 3BG0B 3I561 4MRIA 4DGLA 3CPWZ 3NDIA 5FLXb 5FLXf 1JJ2Y 4CL1A 1VQ6Z 1TWFI 3HOVI 3IX0A 2IV2X 1S721 3CC21 4NH1C 2PK7A 4RVGA 1KD12 3RZDI 3VB9A 3HOUI 3VMGA 1Q822 1M901 3I4NI 2H85A 1USPA 4A3JI 1ZB8A 5CM2M 1QVFZ 1VQ4Z 2R6MA 3S17I 3KIHA 4BY1I 4A3LI 2DE6A 1KQSY 3HKZA 3CD6Z 4NOZA 1VQKZ 2JIQA 3CCUZ 2B63I 3D6WA 5AN9F 3PO3I 4A93I 1M1K1 4E2XA 1YIT1 3I551 2V8JA 1Z01A 1RNIA 3Q87A 3VTNA 3CCQZ 4A3DI 5FLMI 3G4SZ 4MONA 2Y0SA 2I3CA 4E31A 4NBFA 3CCRZ 4E2YA 4BBSI 1JWHC 1RQFA 1VQ61 3IFUA 2LEXA 4E33A 4XX2A 2JR6A 5IP7I 1N8R1 3M4OI 4A3KI 3F3PC 1I50I 2P28A 1P9NA 1X3WA 4E2ZA 4A3EI 1VQM1 1TWGI 5A2Qb 3CD61 1VQK1 2R93I 3OW2Y 3CCU1 3CCSZ 3GTGI 5IP9I 2AKLA 1RO4A 1YUAA 2JIOA 5C4XI 2QEXZ 1Q812 1Z03A 3G6E1 3CME1 4S1TA 3JAMb 1K9M2 3CCQ1 2LFUA 1I6HI 1YJNZ 1VQO1 1I3QI 4NBHA 3CCJZ 3FKII 1KD11 5IT9b 1Q821 2RPRA 3CC4Z 3D9XA 3K7AI 1X3ZA 3PO2I 2VPYA 3EERA 3MZLB 1Y1VS 2JA6I 1YHQ1 2OTL1 3GCFA 3GTJI 3CCL1 3HOZI 3HOXI 2V8IA 1FDOA 2PMZA 3OW2Z 4NBGA 3VMHA 5D1OA 3TDHB 1K732 4RVFA 1FDIA 3S1RI 3I07A 1VQ8Z 2RT9A 3CCS1 4HGYA 2V8KA 1SIWA 2HU9A 3ESWA 2K5RA 5D1OB 2ZAEB 3GTQI 2E2II 1VQ7Z 1W2BZ 2Q4ZA 1DL6A 2LIYA 1YI21 4X6AI 3EEDA 3GTKI 1YJN1 3GKQA 4E2WA 3CCM1 3G711 1ZB9A 1USPB 2IZ3A 1WJ2A 3FQQA 3CCJ1 1VQ5Z 3J80b 3J80f 4NB8A 2QLVB 3MONA 3KIFA 1R9TI 2DE7A 1TWHI 5C4JI 3J81b 2GU2A 4DQYB 1JJ2Z 4NBBA 1YIJZ 2WAQA 1RO2A 2QA4Z 3I4MI 5C44I 2GTHA 4NBDA 2K3RA 3S15I 3U50C 3P5JB 3NH8A 4DK1A 2OTJZ 4HGZA 1WZNA 2QRDB 3S1NI 1Q811 5T64A 2JUBA 5T67A 4MH4A 1NJI2 4RVDA 1N2FA 2JIMA 2W03A 4BXXI 1QYPA 2R7ZI 1QVGY 1K8A2 3CCEZ 3GTMI 2JA5I 1KQSZ 1ML8A 1VQ41 4RS4A 3IF8A 2Q51A 5A2Qf 3CQZI 2RHBA 4A3CI 5C3EI 1VLAA 2V3VA 5LL6f 5T6BA 3J7A4 3JAMf 1PFTA 3T4NB 1Y1VI 4AYBA 3S16I 4MD9A 1S72Z 1WIIA 2P3YA 1VQPZ 3G4S1 1TWAI 3CC2Z 1K731 1YIJ1 3QWUA 2QA41 1QF8A 2YADA 3NFZA 3RZOI 1LQLA 1Q7Y2 3CCR1 2VF1A 2PM9A 4Y52I 3LUSA 1WCMI 1YJWZ 2NVXI 5IT9f 3BG1B 2BJOA 2J6AA 1VQLZ 2NVTI 2O4HA 2QREB 2VPZA 4MXUA 4A3BI 1Q862 2M6NA 2OZKA 4QTTA 3S1MI 3CXCY 1YITZ 3I55Z 1KC82 4A3II 1NUIA 1WW9A 1SFOI 4BBRI 2JA8I 2HF1A 1ZH1A 4E30A 3CC7Z 2O53A 2IZ4A 2JIRA 2QEX1 4MD7A 3GTLI 1VQ9Z 1RLYA 2JA7I 2GTIA 4EWCA 1Y1WI 3CMAZ 1VQP1 1NJI1 3MZKB 2VUGA 1K8A1 3S1QI 3IR7A 1YJW1 3GTPI
chains in the Genus database with same CATH topology
2RBLA 1RO0A 1VQNZ 3CC41 3J81f 2E2HI 3HOWI 2KPIA 2R92I 1VQL1 2QR1B 3NH5A 3CXCZ 4RVHA 1KRLA 1VQMZ 2QKDA 4TNUA 4HH4A 2W04A 3NH4A 3F3FC 1X0TA 4NB9A 2WB1A 2KI7B 3H0GI 3G6EZ 3CMEZ 1K9M1 2JMOA 1VQ81 4QTUA 3GTOI 3CCVZ 4BY7I 3S14I 3H3VJ 2F4MA 3FQMA 3CC71 1VQOZ 2EGTA 1Q7Y1 1K83I 2G2KA 1M902 1VQ91 1S7MA 1VQ71 4Y7NI 2E9HA 3PO3S 3CMA1 3NDJA 3S2DI 1NP6A 3S2HI 2YU9I 4E32A 3TE5B 1YJ9Z 1Q861 3I56Z 2DE5A 1YHQZ 1M1K2 2OTLZ 3CCLZ 1VQ51 2OOYB 2VUMI 2JS4A 1KC81 2NVQI 5D1PA 1VQN1 3M3YI 3CPWY 3HOYI 4NBAA 1TFIA 2RIQA 1YUKA 4A3MI 2NVYI 2OTJ1 2M48A 4NBCA 2F4OA 1QVGZ 2QRCB 3GTMS 1YI2Z 2OOXB 3VMIA 1TWCI 4A3FI 2E2JI 3CCV1 3CCMZ 3G71Z 1QVFY 1W2BY 1N8R2 3CCE1 4MD8A 1Z02A 4RV9A 4A3GI 1L1OC 4NBEA 2JNYA 4NFRA 1YJ91 3BG0B 3I561 4MRIA 4DGLA 3CPWZ 3NDIA 5FLXb 5FLXf 1JJ2Y 4CL1A 1VQ6Z 1TWFI 3HOVI 3IX0A 1S721 3CC21 4NH1C 2PK7A 4RVGA 1KD12 3RZDI 3VB9A 3HOUI 3VMGA 1Q822 1M901 3I4NI 2H85A 1USPA 4A3JI 1ZB8A 5CM2M 1QVFZ 1VQ4Z 2R6MA 3S17I 3KIHA 4BY1I 4A3LI 2DE6A 1KQSY 3HKZA 3CD6Z 4NOZA 1VQKZ 3CCUZ 2B63I 3D6WA 5AN9F 3PO3I 4A93I 1M1K1 4E2XA 1YIT1 3I551 2V8JA 1Z01A 1RNIA 3Q87A 3VTNA 3CCQZ 4A3DI 5FLMI 3G4SZ 4MONA 2Y0SA 2I3CA 4E31A 4NBFA 3CCRZ 4E2YA 4BBSI 1JWHC 1RQFA 1VQ61 3IFUA 4E33A 4XX2A 2JR6A 5IP7I 1N8R1 3M4OI 4A3KI 3F3PC 1I50I 2P28A 1P9NA 1X3WA 4E2ZA 4A3EI 1VQM1 1TWGI 5A2Qb 3CD61 1VQK1 2R93I 3OW2Y 3CCU1 3CCSZ 3GTGI 5IP9I 2AKLA 1RO4A 1YUAA 5C4XI 2QEXZ 1Q812 1Z03A 3G6E1 3CME1 4S1TA 3JAMb 1K9M2 3CCQ1 2LFUA 1I6HI 1YJNZ 1VQO1 1I3QI 4NBHA 3CCJZ 3FKII 1KD11 5IT9b 1Q821 2RPRA 3CC4Z 3D9XA 3K7AI 1X3ZA 3PO2I 3EERA 3MZLB 1Y1VS 2JA6I 1YHQ1 2OTL1 3GCFA 3GTJI 3CCL1 3HOZI 3HOXI 2V8IA 2PMZA 3OW2Z 4NBGA 3VMHA 5D1OA 3TDHB 1K732 4RVFA 3S1RI 1VQ8Z 3I07A 2RT9A 3CCS1 4HGYA 2V8KA 2HU9A 3ESWA 2K5RA 5D1OB 2ZAEB 3GTQI 2E2II 1VQ7Z 1W2BZ 2Q4ZA 1DL6A 2LIYA 1YI21 4X6AI 3EEDA 3GTKI 1YJN1 3GKQA 4E2WA 3CCM1 3G711 1ZB9A 1USPB 2IZ3A 3FQQA 3CCJ1 1VQ5Z 3J80b 3J80f 4NB8A 2QLVB 3MONA 3KIFA 1R9TI 2DE7A 1TWHI 5C4JI 3J81b 2GU2A 4DQYB 1JJ2Z 4NBBA 1YIJZ 2WAQA 1RO2A 2QA4Z 3I4MI 5C44I 2GTHA 4NBDA 2K3RA 3S15I 3U50C 3P5JB 3NH8A 4DK1A 2OTJZ 4HGZA 2QRDB 3S1NI 1Q811 5T64A 2JUBA 5T67A 4MH4A 1NJI2 4RVDA 1N2FA 2W03A 4BXXI 1QYPA 2R7ZI 1QVGY 1K8A2 3CCEZ 3GTMI 2JA5I 1KQSZ 1ML8A 1VQ41 4RS4A 3IF8A 2Q51A 5A2Qf 3CQZI 2RHBA 4A3CI 5C3EI 1VLAA 5LL6f 5T6BA 3J7A4 3JAMf 1PFTA 3T4NB 1Y1VI 4AYBA 3S16I 4MD9A 1S72Z 1WIIA 2P3YA 1VQPZ 3G4S1 1TWAI 3CC2Z 1K731 1YIJ1 3QWUA 2QA41 1QF8A 2YADA 3NFZA 3RZOI 1LQLA 1Q7Y2 3CCR1 2VF1A 2PM9A 4Y52I 3LUSA 1WCMI 1YJWZ 2NVXI 5IT9f 3BG1B 2BJOA 2J6AA 1VQLZ 2NVTI 2O4HA 2QREB 4MXUA 4A3BI 1Q862 2M6NA 2OZKA 4QTTA 3S1MI 3CXCY 1YITZ 3I55Z 1KC82 4A3II 1NUIA 1WW9A 1SFOI 4BBRI 2JA8I 2HF1A 1ZH1A 4E30A 3CC7Z 2O53A 2IZ4A 2QEX1 4MD7A 3GTLI 1VQ9Z 1RLYA 2JA7I 2GTIA 4EWCA 1Y1WI 3CMAZ 1VQP1 1NJI1 3MZKB 2VUGA 1K8A1 3S1QI 1YJW1 3GTPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  5LL6 f;  3J81 b;  3J80 b;  5FLX b;  5A2Q b;  3JAM b;  3J7A 4; 
#chains in the Genus database with same CATH topology
 2RBL A;  1RO0 A;  1VQN Z;  3CC4 1;  3J81 f;  2E2H I;  3HOW I;  2KPI A;  2R92 I;  1VQL 1;  2QR1 B;  3NH5 A;  3CXC Z;  4RVH A;  1KRL A;  1VQM Z;  1Q16 A;  2QKD A;  4TNU A;  4HH4 A;  2W04 A;  3NH4 A;  3F3F C;  1X0T A;  1AA6 A;  4NB9 A;  2WB1 A;  2KI7 B;  3H0G I;  3G6E Z;  3CME Z;  1K9M 1;  2JMO A;  2JIP A;  1VQ8 1;  4QTU A;  3GTO I;  3CCV Z;  4BY7 I;  3S14 I;  3H3V J;  2F4M A;  3FQM A;  3CC7 1;  2NAP A;  1VQO Z;  2EGT A;  1Q7Y 1;  1K83 I;  2G2K A;  1M90 2;  1VQ9 1;  1S7M A;  1VQ7 1;  4Y7N I;  2E9H A;  3PO3 S;  2VPW A;  3NDJ A;  3CMA 1;  1NP6 A;  3S2D I;  3S2H I;  2YU9 I;  4E32 A;  3TE5 B;  1YJ9 Z;  1Q86 1;  3I56 Z;  2DE5 A;  1YHQ Z;  1Y8C A;  1M1K 2;  2OTL Z;  3CCL Z;  2V45 A;  1VQ5 1;  2OOY B;  2VUM I;  2JS4 A;  1KC8 1;  2NVQ I;  5D1P A;  1VQN 1;  3M3Y I;  3CPW Y;  3HOY I;  4NBA A;  2AYD A;  1TFI A;  2RIQ A;  1YUK A;  4A3M I;  2NVY I;  2OTJ 1;  2M48 A;  4NBC A;  2F4O A;  1QVG Z;  2QRC B;  3GTM S;  1YI2 Z;  2OOX B;  3VMI A;  1TWC I;  4A3F I;  3D2L A;  2E2J I;  3CCV 1;  3CCM Z;  3G71 Z;  1QXF A;  2E7Z A;  1QVF Y;  1W2B Y;  1N8R 2;  3CCE 1;  4MD8 A;  1Z02 A;  2VPX A;  4RV9 A;  4A3G I;  1L1O C;  4NBE A;  2JNY A;  4NFR A;  1YJ9 1;  3BG0 B;  3I56 1;  4MRI A;  4DGL A;  3CPW Z;  3NDI A;  5FLX b;  5FLX f;  1JJ2 Y;  4CL1 A;  1VQ6 Z;  1TWF I;  3HOV I;  3IX0 A;  2IV2 X;  1S72 1;  3CC2 1;  4NH1 C;  2PK7 A;  4RVG A;  1KD1 2;  3RZD I;  3VB9 A;  3HOU I;  3VMG A;  1Q82 2;  1M90 1;  3I4N I;  2H85 A;  1USP A;  4A3J I;  1ZB8 A;  5CM2 M;  1QVF Z;  1VQ4 Z;  2R6M A;  3S17 I;  3KIH A;  4BY1 I;  4A3L I;  2DE6 A;  1KQS Y;  3HKZ A;  3CD6 Z;  4NOZ A;  1VQK Z;  2JIQ A;  3CCU Z;  2B63 I;  3D6W A;  5AN9 F;  3PO3 I;  4A93 I;  1M1K 1;  4E2X A;  1YIT 1;  3I55 1;  2V8J A;  1Z01 A;  1RNI A;  3Q87 A;  3VTN A;  3CCQ Z;  4A3D I;  5FLM I;  3G4S Z;  4MON A;  2Y0S A;  2I3C A;  4E31 A;  4NBF A;  3CCR Z;  4E2Y A;  4BBS I;  1JWH C;  1RQF A;  1VQ6 1;  3IFU A;  2LEX A;  4E33 A;  4XX2 A;  2JR6 A;  5IP7 I;  1N8R 1;  3M4O I;  4A3K I;  3F3P C;  1I50 I;  2P28 A;  1P9N A;  1X3W A;  4E2Z A;  4A3E I;  1VQM 1;  1TWG I;  5A2Q b;  3CD6 1;  1VQK 1;  2R93 I;  3OW2 Y;  3CCU 1;  3CCS Z;  3GTG I;  5IP9 I;  2AKL A;  1RO4 A;  1YUA A;  2JIO A;  5C4X I;  2QEX Z;  1Q81 2;  1Z03 A;  3G6E 1;  3CME 1;  4S1T A;  3JAM b;  1K9M 2;  3CCQ 1;  2LFU A;  1I6H I;  1YJN Z;  1VQO 1;  1I3Q I;  4NBH A;  3CCJ Z;  3FKI I;  1KD1 1;  5IT9 b;  1Q82 1;  2RPR A;  3CC4 Z;  3D9X A;  3K7A I;  1X3Z A;  3PO2 I;  2VPY A;  3EER A;  3MZL B;  1Y1V S;  2JA6 I;  1YHQ 1;  2OTL 1;  3GCF A;  3GTJ I;  3CCL 1;  3HOZ I;  3HOX I;  2V8I A;  1FDO A;  2PMZ A;  3OW2 Z;  4NBG A;  3VMH A;  5D1O A;  3TDH B;  1K73 2;  4RVF A;  1FDI A;  3S1R I;  3I07 A;  1VQ8 Z;  2RT9 A;  3CCS 1;  4HGY A;  2V8K A;  1SIW A;  2HU9 A;  3ESW A;  2K5R A;  5D1O B;  2ZAE B;  3GTQ I;  2E2I I;  1VQ7 Z;  1W2B Z;  2Q4Z A;  1DL6 A;  2LIY A;  1YI2 1;  4X6A I;  3EED A;  3GTK I;  1YJN 1;  3GKQ A;  4E2W A;  3CCM 1;  3G71 1;  1ZB9 A;  1USP B;  2IZ3 A;  1WJ2 A;  3FQQ A;  3CCJ 1;  1VQ5 Z;  3J80 b;  3J80 f;  4NB8 A;  2QLV B;  3MON A;  3KIF A;  1R9T I;  2DE7 A;  1TWH I;  5C4J I;  3J81 b;  2GU2 A;  4DQY B;  1JJ2 Z;  4NBB A;  1YIJ Z;  2WAQ A;  1RO2 A;  2QA4 Z;  3I4M I;  5C44 I;  2GTH A;  4NBD A;  2K3R A;  3S15 I;  3U50 C;  3P5J B;  3NH8 A;  4DK1 A;  2OTJ Z;  4HGZ A;  1WZN A;  2QRD B;  3S1N I;  1Q81 1;  5T64 A;  2JUB A;  5T67 A;  4MH4 A;  1NJI 2;  4RVD A;  1N2F A;  2JIM A;  2W03 A;  4BXX I;  1QYP A;  2R7Z I;  1QVG Y;  1K8A 2;  3CCE Z;  3GTM I;  2JA5 I;  1KQS Z;  1ML8 A;  1VQ4 1;  4RS4 A;  3IF8 A;  2Q51 A;  5A2Q f;  3CQZ I;  2RHB A;  4A3C I;  5C3E I;  1VLA A;  2V3V A;  5LL6 f;  5T6B A;  3J7A 4;  3JAM f;  1PFT A;  3T4N B;  1Y1V I;  4AYB A;  3S16 I;  4MD9 A;  1S72 Z;  1WII A;  2P3Y A;  1VQP Z;  3G4S 1;  1TWA I;  3CC2 Z;  1K73 1;  1YIJ 1;  3QWU A;  2QA4 1;  1QF8 A;  2YAD A;  3NFZ A;  3RZO I;  1LQL A;  1Q7Y 2;  3CCR 1;  2VF1 A;  2PM9 A;  4Y52 I;  3LUS A;  1WCM I;  1YJW Z;  2NVX I;  5IT9 f;  3BG1 B;  2BJO A;  2J6A A;  1VQL Z;  2NVT I;  2O4H A;  2QRE B;  2VPZ A;  4MXU A;  4A3B I;  1Q86 2;  2M6N A;  2OZK A;  4QTT A;  3S1M I;  3CXC Y;  1YIT Z;  3I55 Z;  1KC8 2;  4A3I I;  1NUI A;  1WW9 A;  1SFO I;  4BBR I;  2JA8 I;  2HF1 A;  1ZH1 A;  4E30 A;  3CC7 Z;  2O53 A;  2IZ4 A;  2JIR A;  2QEX 1;  4MD7 A;  3GTL I;  1VQ9 Z;  1RLY A;  2JA7 I;  2GTI A;  4EWC A;  1Y1W I;  3CMA Z;  1VQP 1;  1NJI 1;  3MZK B;  2VUG A;  1K8A 1;  3S1Q I;  3IR7 A;  1YJW 1;  3GTP I; 
#chains in the Genus database with same CATH homology
 2RBL A;  1RO0 A;  1VQN Z;  3CC4 1;  3J81 f;  2E2H I;  3HOW I;  2KPI A;  2R92 I;  1VQL 1;  2QR1 B;  3NH5 A;  3CXC Z;  4RVH A;  1KRL A;  1VQM Z;  2QKD A;  4TNU A;  4HH4 A;  2W04 A;  3NH4 A;  3F3F C;  1X0T A;  4NB9 A;  2WB1 A;  2KI7 B;  3H0G I;  3G6E Z;  3CME Z;  1K9M 1;  2JMO A;  1VQ8 1;  4QTU A;  3GTO I;  3CCV Z;  4BY7 I;  3S14 I;  3H3V J;  2F4M A;  3FQM A;  3CC7 1;  1VQO Z;  2EGT A;  1Q7Y 1;  1K83 I;  2G2K A;  1M90 2;  1VQ9 1;  1S7M A;  1VQ7 1;  4Y7N I;  2E9H A;  3PO3 S;  3CMA 1;  3NDJ A;  3S2D I;  1NP6 A;  3S2H I;  2YU9 I;  4E32 A;  3TE5 B;  1YJ9 Z;  1Q86 1;  3I56 Z;  2DE5 A;  1YHQ Z;  1M1K 2;  2OTL Z;  3CCL Z;  1VQ5 1;  2OOY B;  2VUM I;  2JS4 A;  1KC8 1;  2NVQ I;  5D1P A;  1VQN 1;  3M3Y I;  3CPW Y;  3HOY I;  4NBA A;  1TFI A;  2RIQ A;  1YUK A;  4A3M I;  2NVY I;  2OTJ 1;  2M48 A;  4NBC A;  2F4O A;  1QVG Z;  2QRC B;  3GTM S;  1YI2 Z;  2OOX B;  3VMI A;  1TWC I;  4A3F I;  2E2J I;  3CCV 1;  3CCM Z;  3G71 Z;  1QVF Y;  1W2B Y;  1N8R 2;  3CCE 1;  4MD8 A;  1Z02 A;  4RV9 A;  4A3G I;  1L1O C;  4NBE A;  2JNY A;  4NFR A;  1YJ9 1;  3BG0 B;  3I56 1;  4MRI A;  4DGL A;  3CPW Z;  3NDI A;  5FLX b;  5FLX f;  1JJ2 Y;  4CL1 A;  1VQ6 Z;  1TWF I;  3HOV I;  3IX0 A;  1S72 1;  3CC2 1;  4NH1 C;  2PK7 A;  4RVG A;  1KD1 2;  3RZD I;  3VB9 A;  3HOU I;  3VMG A;  1Q82 2;  1M90 1;  3I4N I;  2H85 A;  1USP A;  4A3J I;  1ZB8 A;  5CM2 M;  1QVF Z;  1VQ4 Z;  2R6M A;  3S17 I;  3KIH A;  4BY1 I;  4A3L I;  2DE6 A;  1KQS Y;  3HKZ A;  3CD6 Z;  4NOZ A;  1VQK Z;  3CCU Z;  2B63 I;  3D6W A;  5AN9 F;  3PO3 I;  4A93 I;  1M1K 1;  4E2X A;  1YIT 1;  3I55 1;  2V8J A;  1Z01 A;  1RNI A;  3Q87 A;  3VTN A;  3CCQ Z;  4A3D I;  5FLM I;  3G4S Z;  4MON A;  2Y0S A;  2I3C A;  4E31 A;  4NBF A;  3CCR Z;  4E2Y A;  4BBS I;  1JWH C;  1RQF A;  1VQ6 1;  3IFU A;  4E33 A;  4XX2 A;  2JR6 A;  5IP7 I;  1N8R 1;  3M4O I;  4A3K I;  3F3P C;  1I50 I;  2P28 A;  1P9N A;  1X3W A;  4E2Z A;  4A3E I;  1VQM 1;  1TWG I;  5A2Q b;  3CD6 1;  1VQK 1;  2R93 I;  3OW2 Y;  3CCU 1;  3CCS Z;  3GTG I;  5IP9 I;  2AKL A;  1RO4 A;  1YUA A;  5C4X I;  2QEX Z;  1Q81 2;  1Z03 A;  3G6E 1;  3CME 1;  4S1T A;  3JAM b;  1K9M 2;  3CCQ 1;  2LFU A;  1I6H I;  1YJN Z;  1VQO 1;  1I3Q I;  4NBH A;  3CCJ Z;  3FKI I;  1KD1 1;  5IT9 b;  1Q82 1;  2RPR A;  3CC4 Z;  3D9X A;  3K7A I;  1X3Z A;  3PO2 I;  3EER A;  3MZL B;  1Y1V S;  2JA6 I;  1YHQ 1;  2OTL 1;  3GCF A;  3GTJ I;  3CCL 1;  3HOZ I;  3HOX I;  2V8I A;  2PMZ A;  3OW2 Z;  4NBG A;  3VMH A;  5D1O A;  3TDH B;  1K73 2;  4RVF A;  3S1R I;  1VQ8 Z;  3I07 A;  2RT9 A;  3CCS 1;  4HGY A;  2V8K A;  2HU9 A;  3ESW A;  2K5R A;  5D1O B;  2ZAE B;  3GTQ I;  2E2I I;  1VQ7 Z;  1W2B Z;  2Q4Z A;  1DL6 A;  2LIY A;  1YI2 1;  4X6A I;  3EED A;  3GTK I;  1YJN 1;  3GKQ A;  4E2W A;  3CCM 1;  3G71 1;  1ZB9 A;  1USP B;  2IZ3 A;  3FQQ A;  3CCJ 1;  1VQ5 Z;  3J80 b;  3J80 f;  4NB8 A;  2QLV B;  3MON A;  3KIF A;  1R9T I;  2DE7 A;  1TWH I;  5C4J I;  3J81 b;  2GU2 A;  4DQY B;  1JJ2 Z;  4NBB A;  1YIJ Z;  2WAQ A;  1RO2 A;  2QA4 Z;  3I4M I;  5C44 I;  2GTH A;  4NBD A;  2K3R A;  3S15 I;  3U50 C;  3P5J B;  3NH8 A;  4DK1 A;  2OTJ Z;  4HGZ A;  2QRD B;  3S1N I;  1Q81 1;  5T64 A;  2JUB A;  5T67 A;  4MH4 A;  1NJI 2;  4RVD A;  1N2F A;  2W03 A;  4BXX I;  1QYP A;  2R7Z I;  1QVG Y;  1K8A 2;  3CCE Z;  3GTM I;  2JA5 I;  1KQS Z;  1ML8 A;  1VQ4 1;  4RS4 A;  3IF8 A;  2Q51 A;  5A2Q f;  3CQZ I;  2RHB A;  4A3C I;  5C3E I;  1VLA A;  5LL6 f;  5T6B A;  3J7A 4;  3JAM f;  1PFT A;  3T4N B;  1Y1V I;  4AYB A;  3S16 I;  4MD9 A;  1S72 Z;  1WII A;  2P3Y A;  1VQP Z;  3G4S 1;  1TWA I;  3CC2 Z;  1K73 1;  1YIJ 1;  3QWU A;  2QA4 1;  1QF8 A;  2YAD A;  3NFZ A;  3RZO I;  1LQL A;  1Q7Y 2;  3CCR 1;  2VF1 A;  2PM9 A;  4Y52 I;  3LUS A;  1WCM I;  1YJW Z;  2NVX I;  5IT9 f;  3BG1 B;  2BJO A;  2J6A A;  1VQL Z;  2NVT I;  2O4H A;  2QRE B;  4MXU A;  4A3B I;  1Q86 2;  2M6N A;  2OZK A;  4QTT A;  3S1M I;  3CXC Y;  1YIT Z;  3I55 Z;  1KC8 2;  4A3I I;  1NUI A;  1WW9 A;  1SFO I;  4BBR I;  2JA8 I;  2HF1 A;  1ZH1 A;  4E30 A;  3CC7 Z;  2O53 A;  2IZ4 A;  2QEX 1;  4MD7 A;  3GTL I;  1VQ9 Z;  1RLY A;  2JA7 I;  2GTI A;  4EWC A;  1Y1W I;  3CMA Z;  1VQP 1;  1NJI 1;  3MZK B;  2VUG A;  1K8A 1;  3S1Q I;  1YJW 1;  3GTP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...