5A2Qb

Structure of the hcv ires bound to the human ribosome
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
82
structure length
82
Chain Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qb00
5IT9b 3J80b 3J81b 5FLXb 3JAMb 5LL6f 3J7A4 5A2Qb
chains in the Genus database with same CATH superfamily
2JIRA 1VQM1 3CCV1 2JUBA 2I3CA 4NBGA 3RZDI 1VQO1 3OW2Y 1Z02A 3S2HI 2QA41 1JJ2Z 2RIQA 5A2Qb 1Y1WI 3IR7A 1VQOZ 3D6WA 2V8JA 4NBHA 4NH1C 4DGLA 1USPB 2Y0SA 2QA4Z 2VF1A 2V3VA 2PK7A 4NBFA 3GTGI 1M901 1YUKA 2R93I 2QKDA 3PO3S 2YADA 1SFOI 3G71Z 3GTLI 1Q7Y1 2QLVB 3H3VJ 3HOXI 4HGZA 1YIJ1 1N8R1 5T67A 3CC2Z 1P9NA 2RHBA 4A3CI 3IX0A 3MZLB 2OOXB 3KIFA 3CMA1 2VUGA 4NBCA 1QVGY 1NUIA 1LQLA 1WIIA 1KC81 4MH4A 3HOYI 1K8A2 4MD7A 3CXCZ 3EERA 2E2II 1ZB9A 3FQQA 1JWHC 2P3YA 2GU2A 3CCSZ 1Y1VI 3G6E1 1I3QI 2GTHA 2JS4A 2DE5A 2V45A 3G6EZ 3GKQA 1RNIA 1WZNA 3ESWA 1Q861 4TNUA 4RVHA 3S14I 3I07A 3CCR1 3D9XA 4DK1A 2E2JI 1FDIA 1TWFI 4RS4A 1M1K2 4MD8A 3CCRZ 1VQ51 2JA5I 5D1OA 3CC4Z 5CM2M 1TFIA 4E2XA 3TDHB 2PM9A 3CPWY 1PFTA 1AA6A 1VQ5Z 1VQK1 2E2HI 2YU9I 4A3BI 1S721 3HOWI 4A3EI 5AN9F 2QREB 1VQKZ 4BBSI 1K9M1 1ZB8A 1Q812 4MRIA 3GTQI 2F4MA 1Z03A 5D1OB 1S72Z 4MXUA 1S7MA 1QF8A 3GTPI 1VQLZ 3F3FC 1QVFZ 3GTKI 2V8KA 3VB9A 5IT9f 1Q822 4QTUA 1YJW1 5FLXf 1RO0A 1YI21 3S1RI 3J80f 1YJWZ 1NJI2 1YI2Z 4RV9A 5IT9b 3MONA 4A3MI 5FLXb 4RVFA 1W2BY 3G4SZ 1DL6A 4MONA 3J80b 2M6NA 2JIOA 4NB8A 1VQMZ 3CCVZ 1VQN1 2OZKA 4NBDA 2IZ3A 4S1TA 2O53A 3D2LA 1WJ2A 1YJ91 1VQNZ 3BG0B 1WCMI 3CCQ1 1YJN1 3CQZI 4BY7I 1X0TA 3CCQZ 1YJNZ 4NB9A 3BG1B 2V8IA 4A3DI 2WB1A 1QXFA 2JA7I 2Q51A 2AYDA 2NAPA 3CCE1 4A3GI 3S1NI 1R9TI 2H85A 1K8A1 1YIJZ 2JIQA 2LEXA 3CCEZ 2R92I 1K732 3I4MI 1YHQ1 2JR6A 2IV2X 1Z01A 3CMAZ 2WAQA 3T4NB 3IF8A 1YHQZ 3NH5A 4HH4A 4NBBA 3HOVI 3S1MI 3J81f 5D1PA 2OTL1 3S2DI 3CC71 2NVTI 2R6MA 2AKLA 2OTLZ 2E9HA 2KPIA 3I551 2HU9A 2NVXI 2JA8I 1TWGI 1M1K1 3J81b 5IP7I 4Y52I 4NOZA 3S15I 3CME1 3M3YI 5C44I 2OTJ1 4BBRI 1FDOA 3I55Z 1Y8CA 1VQ71 3F3PC 3CMEZ 4EWCA 2OTJZ 1TWCI 1KQSZ 3FQMA 3JAMf 1VQ7Z 2W04A 3CXCY 2VPZA 1VQ61 2GTIA 2HF1A 1Q811 4Y7NI 1TWAI 1X3ZA 1X3WA 4A3LI 3EEDA 3S17I 3Q87A 1WW9A 1VQ6Z 3H0GI 1VLAA 2NVYI 3JAMb 1Q821 1Q16A 4A3II 2JNYA 3GTMS 1VQ41 2K5RA 1VQP1 1NJI1 3VTNA 5IP9I 3K7AI 3OW2Z 1VQ4Z 4E32A 2JIMA 1VQPZ 1YIT1 2O4HA 2F4OA 4E2YA 4E2WA 2QR1B 3S1QI 3IFUA 1N2FA 3HOZI 1YITZ 3CCL1 1ZH1A 3CCJ1 4BXXI 4QTTA 3CCJZ 3U50C 2VUMI 3J7A4 3NFZA 4E30A 2DE7A 3VMHA 3PO3I 4NBAA 2JA6I 1KD12 4E2ZA 2OOYB 2K3RA 3M4OI 1QVFY 1YJ9Z 1K83I 2JMOA 1QVGZ 4A3FI 2RBLA 3NDIA 1SIWA 1K731 4CL1A 5C3EI 2BJOA 3G711 4BY1I 2E7ZA 5C4JI 1I6HI 3CC21 2W03A 3HKZA 2VPYA 3MZKB 3TE5B 2QRCB 1VQ81 2NVQI 1RO4A 4A3KI 1JJ2Y 1NP6A 4RVDA 5FLMI 1M902 3VMIA 1VQ8Z 2ZAEB 2RPRA 4MD9A 3KIHA 3GTOI 4AYBA 2PMZA 3CCM1 5T64A 3CCU1 1Q7Y2 3I4NI 3NDJA 1N8R2 4XX2A 2LFUA 3NH4A 1L1OC 3CCMZ 3CCUZ 1ML8A 3CC7Z 2P28A 3CPWZ 3CCS1 1RQFA 1KC82 4RVGA 2IZ4A 3P5JB 3S16I 2B63I 2JIPA 5C4XI 3PO2I 3FKII 1RLYA 2KI7B 3GTMI 1Y1VS 2Q4ZA 3I561 1KRLA 1QYPA 3GTJI 1YUAA 3VMGA 3I56Z 3CC41 3RZOI 1Q862 2J6AA 2DE6A 4NBEA 2G2KA 2R7ZI 4E33A 2QRDB 1W2BZ 5LL6f 5T6BA 3GCFA 1VQ91 4DQYB 2EGTA 4A93I 1VQL1 3NH8A 1VQ9Z 2RT9A 3HOUI 2VPXA 1KQSY 3CD61 4X6AI 3CCLZ 4A3JI 3LUSA 1K9M2 3QWUA 2QEX1 1KD11 3CD6Z 2M48A 4E31A 2VPWA 1RO2A 4HGYA 1I50I 4NFRA 2QEXZ 1TWHI 2LIYA 3G4S1 1USPA 5A2Qf
chains in the Genus database with same CATH topology
1VQM1 3CCV1 2JUBA 2I3CA 4NBGA 3RZDI 1VQO1 3OW2Y 1Z02A 3S2HI 2QA41 1JJ2Z 2RIQA 5A2Qb 1Y1WI 1VQOZ 3D6WA 2V8JA 4NBHA 4NH1C 4DGLA 1USPB 2Y0SA 2QA4Z 2VF1A 2PK7A 4NBFA 3GTGI 1M901 1YUKA 2R93I 2QKDA 3PO3S 2YADA 1SFOI 3G71Z 3GTLI 1Q7Y1 2QLVB 3H3VJ 3HOXI 4HGZA 1YIJ1 1N8R1 5T67A 3CC2Z 1P9NA 2RHBA 4A3CI 3IX0A 3MZLB 2OOXB 3KIFA 3CMA1 2VUGA 4NBCA 1QVGY 1NUIA 1LQLA 1WIIA 1KC81 4MH4A 3HOYI 1K8A2 4MD7A 3CXCZ 3EERA 2E2II 1ZB9A 3FQQA 1JWHC 2P3YA 2GU2A 3CCSZ 1Y1VI 3G6E1 1I3QI 2GTHA 2JS4A 2DE5A 3G6EZ 3GKQA 1RNIA 3ESWA 1Q861 4TNUA 4RVHA 3S14I 3I07A 3CCR1 3D9XA 4DK1A 2E2JI 1TWFI 4RS4A 1M1K2 4MD8A 3CCRZ 1VQ51 2JA5I 5D1OA 3CC4Z 5CM2M 1TFIA 4E2XA 3TDHB 2PM9A 3CPWY 1PFTA 1VQ5Z 1VQK1 2E2HI 2YU9I 4A3BI 1S721 3HOWI 4A3EI 5AN9F 2QREB 1VQKZ 4BBSI 1K9M1 1ZB8A 1Q812 4MRIA 3GTQI 2F4MA 1Z03A 5D1OB 1S72Z 4MXUA 1S7MA 1QF8A 3GTPI 1VQLZ 3F3FC 1QVFZ 3GTKI 2V8KA 3VB9A 5IT9f 1Q822 4QTUA 1YJW1 5FLXf 1RO0A 1YI21 3S1RI 3J80f 1YJWZ 1NJI2 1YI2Z 4RV9A 5IT9b 3MONA 4A3MI 5FLXb 4RVFA 1W2BY 3G4SZ 1DL6A 4MONA 3J80b 2M6NA 4NB8A 1VQMZ 3CCVZ 1VQN1 2OZKA 4NBDA 2IZ3A 4S1TA 2O53A 1YJ91 1VQNZ 3BG0B 1WCMI 3CCQ1 1YJN1 3CQZI 4BY7I 1X0TA 3CCQZ 1YJNZ 4NB9A 3BG1B 2V8IA 4A3DI 2WB1A 2JA7I 2Q51A 3CCE1 4A3GI 3S1NI 1R9TI 2H85A 1K8A1 1YIJZ 3CCEZ 2R92I 1K732 3I4MI 1YHQ1 2JR6A 1Z01A 3CMAZ 2WAQA 3T4NB 3IF8A 1YHQZ 3NH5A 4HH4A 4NBBA 3HOVI 3S1MI 3J81f 5D1PA 2OTL1 3S2DI 3CC71 2NVTI 2R6MA 2AKLA 2OTLZ 2E9HA 2KPIA 3I551 2HU9A 2NVXI 2JA8I 1TWGI 1M1K1 3J81b 5IP7I 4Y52I 4NOZA 3S15I 3CME1 3M3YI 5C44I 2OTJ1 4BBRI 3I55Z 1VQ71 3F3PC 3CMEZ 4EWCA 2OTJZ 1TWCI 1KQSZ 3FQMA 1VQ7Z 3JAMf 2W04A 3CXCY 1VQ61 2GTIA 2HF1A 1Q811 4Y7NI 1TWAI 1X3ZA 1X3WA 4A3LI 3EEDA 3S17I 3Q87A 1WW9A 1VQ6Z 3H0GI 1VLAA 2NVYI 3JAMb 1Q821 4A3II 2JNYA 3GTMS 1VQ41 2K5RA 1VQP1 1NJI1 3VTNA 5IP9I 3K7AI 3OW2Z 1VQ4Z 4E32A 1VQPZ 1YIT1 2O4HA 2F4OA 4E2YA 4E2WA 2QR1B 3S1QI 3IFUA 1N2FA 3HOZI 1YITZ 3CCL1 1ZH1A 3CCJ1 4BXXI 4QTTA 3CCJZ 3U50C 2VUMI 3J7A4 3NFZA 4E30A 2DE7A 3VMHA 3PO3I 4NBAA 2JA6I 1KD12 4E2ZA 2OOYB 2K3RA 3M4OI 1QVFY 1YJ9Z 1K83I 2JMOA 1QVGZ 4A3FI 2RBLA 3NDIA 1K731 4CL1A 5C3EI 2BJOA 3G711 4BY1I 5C4JI 1I6HI 3CC21 2W03A 3HKZA 3MZKB 3TE5B 2QRCB 1VQ81 2NVQI 1RO4A 4A3KI 1JJ2Y 1NP6A 4RVDA 5FLMI 1M902 3VMIA 1VQ8Z 2ZAEB 2RPRA 4MD9A 3KIHA 3GTOI 4AYBA 2PMZA 3CCM1 5T64A 3CCU1 1Q7Y2 3I4NI 3NDJA 1N8R2 4XX2A 2LFUA 3NH4A 1L1OC 3CCMZ 3CCUZ 1ML8A 3CC7Z 2P28A 3CPWZ 3CCS1 1RQFA 1KC82 4RVGA 2IZ4A 3P5JB 3S16I 2B63I 5C4XI 3PO2I 3FKII 1RLYA 2KI7B 3GTMI 1Y1VS 2Q4ZA 3I561 1KRLA 1QYPA 3GTJI 1YUAA 3VMGA 3I56Z 3CC41 3RZOI 1Q862 2J6AA 2DE6A 4NBEA 2G2KA 2R7ZI 4E33A 2QRDB 1W2BZ 5LL6f 5T6BA 3GCFA 1VQ91 4DQYB 2EGTA 4A93I 1VQL1 3NH8A 1VQ9Z 2RT9A 3HOUI 1KQSY 3CD61 4X6AI 3CCLZ 4A3JI 3LUSA 1K9M2 3QWUA 2QEX1 1KD11 3CD6Z 2M48A 4E31A 1RO2A 4HGYA 1I50I 4NFRA 2QEXZ 1TWHI 2LIYA 3G4S1 1USPA 5A2Qf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  3J80 b;  3J81 b;  5FLX b;  3JAM b;  5LL6 f;  3J7A 4;  5A2Q b; 
#chains in the Genus database with same CATH topology
 2JIR A;  1VQM 1;  3CCV 1;  2JUB A;  2I3C A;  4NBG A;  3RZD I;  1VQO 1;  3OW2 Y;  1Z02 A;  3S2H I;  2QA4 1;  1JJ2 Z;  2RIQ A;  5A2Q b;  1Y1W I;  3IR7 A;  1VQO Z;  3D6W A;  2V8J A;  4NBH A;  4NH1 C;  4DGL A;  1USP B;  2Y0S A;  2QA4 Z;  2VF1 A;  2V3V A;  2PK7 A;  4NBF A;  3GTG I;  1M90 1;  1YUK A;  2R93 I;  2QKD A;  3PO3 S;  2YAD A;  1SFO I;  3G71 Z;  3GTL I;  1Q7Y 1;  2QLV B;  3H3V J;  3HOX I;  4HGZ A;  1YIJ 1;  1N8R 1;  5T67 A;  3CC2 Z;  1P9N A;  2RHB A;  4A3C I;  3IX0 A;  3MZL B;  2OOX B;  3KIF A;  3CMA 1;  2VUG A;  4NBC A;  1QVG Y;  1NUI A;  1LQL A;  1WII A;  1KC8 1;  4MH4 A;  3HOY I;  1K8A 2;  4MD7 A;  3CXC Z;  3EER A;  2E2I I;  1ZB9 A;  3FQQ A;  1JWH C;  2P3Y A;  2GU2 A;  3CCS Z;  1Y1V I;  3G6E 1;  1I3Q I;  2GTH A;  2JS4 A;  2DE5 A;  2V45 A;  3G6E Z;  3GKQ A;  1RNI A;  1WZN A;  3ESW A;  1Q86 1;  4TNU A;  4RVH A;  3S14 I;  3I07 A;  3CCR 1;  3D9X A;  4DK1 A;  2E2J I;  1FDI A;  1TWF I;  4RS4 A;  1M1K 2;  4MD8 A;  3CCR Z;  1VQ5 1;  2JA5 I;  5D1O A;  3CC4 Z;  5CM2 M;  1TFI A;  4E2X A;  3TDH B;  2PM9 A;  3CPW Y;  1PFT A;  1AA6 A;  1VQ5 Z;  1VQK 1;  2E2H I;  2YU9 I;  4A3B I;  1S72 1;  3HOW I;  4A3E I;  5AN9 F;  2QRE B;  1VQK Z;  4BBS I;  1K9M 1;  1ZB8 A;  1Q81 2;  4MRI A;  3GTQ I;  2F4M A;  1Z03 A;  5D1O B;  1S72 Z;  4MXU A;  1S7M A;  1QF8 A;  3GTP I;  1VQL Z;  3F3F C;  1QVF Z;  3GTK I;  2V8K A;  3VB9 A;  5IT9 f;  1Q82 2;  4QTU A;  1YJW 1;  5FLX f;  1RO0 A;  1YI2 1;  3S1R I;  3J80 f;  1YJW Z;  1NJI 2;  1YI2 Z;  4RV9 A;  5IT9 b;  3MON A;  4A3M I;  5FLX b;  4RVF A;  1W2B Y;  3G4S Z;  1DL6 A;  4MON A;  3J80 b;  2M6N A;  2JIO A;  4NB8 A;  1VQM Z;  3CCV Z;  1VQN 1;  2OZK A;  4NBD A;  2IZ3 A;  4S1T A;  2O53 A;  3D2L A;  1WJ2 A;  1YJ9 1;  1VQN Z;  3BG0 B;  1WCM I;  3CCQ 1;  1YJN 1;  3CQZ I;  4BY7 I;  1X0T A;  3CCQ Z;  1YJN Z;  4NB9 A;  3BG1 B;  2V8I A;  4A3D I;  2WB1 A;  1QXF A;  2JA7 I;  2Q51 A;  2AYD A;  2NAP A;  3CCE 1;  4A3G I;  3S1N I;  1R9T I;  2H85 A;  1K8A 1;  1YIJ Z;  2JIQ A;  2LEX A;  3CCE Z;  2R92 I;  1K73 2;  3I4M I;  1YHQ 1;  2JR6 A;  2IV2 X;  1Z01 A;  3CMA Z;  2WAQ A;  3T4N B;  3IF8 A;  1YHQ Z;  3NH5 A;  4HH4 A;  4NBB A;  3HOV I;  3S1M I;  3J81 f;  5D1P A;  2OTL 1;  3S2D I;  3CC7 1;  2NVT I;  2R6M A;  2AKL A;  2OTL Z;  2E9H A;  2KPI A;  3I55 1;  2HU9 A;  2NVX I;  2JA8 I;  1TWG I;  1M1K 1;  3J81 b;  5IP7 I;  4Y52 I;  4NOZ A;  3S15 I;  3CME 1;  3M3Y I;  5C44 I;  2OTJ 1;  4BBR I;  1FDO A;  3I55 Z;  1Y8C A;  1VQ7 1;  3F3P C;  3CME Z;  4EWC A;  2OTJ Z;  1TWC I;  1KQS Z;  3FQM A;  3JAM f;  1VQ7 Z;  2W04 A;  3CXC Y;  2VPZ A;  1VQ6 1;  2GTI A;  2HF1 A;  1Q81 1;  4Y7N I;  1TWA I;  1X3Z A;  1X3W A;  4A3L I;  3EED A;  3S17 I;  3Q87 A;  1WW9 A;  1VQ6 Z;  3H0G I;  1VLA A;  2NVY I;  3JAM b;  1Q82 1;  1Q16 A;  4A3I I;  2JNY A;  3GTM S;  1VQ4 1;  2K5R A;  1VQP 1;  1NJI 1;  3VTN A;  5IP9 I;  3K7A I;  3OW2 Z;  1VQ4 Z;  4E32 A;  2JIM A;  1VQP Z;  1YIT 1;  2O4H A;  2F4O A;  4E2Y A;  4E2W A;  2QR1 B;  3S1Q I;  3IFU A;  1N2F A;  3HOZ I;  1YIT Z;  3CCL 1;  1ZH1 A;  3CCJ 1;  4BXX I;  4QTT A;  3CCJ Z;  3U50 C;  2VUM I;  3J7A 4;  3NFZ A;  4E30 A;  2DE7 A;  3VMH A;  3PO3 I;  4NBA A;  2JA6 I;  1KD1 2;  4E2Z A;  2OOY B;  2K3R A;  3M4O I;  1QVF Y;  1YJ9 Z;  1K83 I;  2JMO A;  1QVG Z;  4A3F I;  2RBL A;  3NDI A;  1SIW A;  1K73 1;  4CL1 A;  5C3E I;  2BJO A;  3G71 1;  4BY1 I;  2E7Z A;  5C4J I;  1I6H I;  3CC2 1;  2W03 A;  3HKZ A;  2VPY A;  3MZK B;  3TE5 B;  2QRC B;  1VQ8 1;  2NVQ I;  1RO4 A;  4A3K I;  1JJ2 Y;  1NP6 A;  4RVD A;  5FLM I;  1M90 2;  3VMI A;  1VQ8 Z;  2ZAE B;  2RPR A;  4MD9 A;  3KIH A;  3GTO I;  4AYB A;  2PMZ A;  3CCM 1;  5T64 A;  3CCU 1;  1Q7Y 2;  3I4N I;  3NDJ A;  1N8R 2;  4XX2 A;  2LFU A;  3NH4 A;  1L1O C;  3CCM Z;  3CCU Z;  1ML8 A;  3CC7 Z;  2P28 A;  3CPW Z;  3CCS 1;  1RQF A;  1KC8 2;  4RVG A;  2IZ4 A;  3P5J B;  3S16 I;  2B63 I;  2JIP A;  5C4X I;  3PO2 I;  3FKI I;  1RLY A;  2KI7 B;  3GTM I;  1Y1V S;  2Q4Z A;  3I56 1;  1KRL A;  1QYP A;  3GTJ I;  1YUA A;  3VMG A;  3I56 Z;  3CC4 1;  3RZO I;  1Q86 2;  2J6A A;  2DE6 A;  4NBE A;  2G2K A;  2R7Z I;  4E33 A;  2QRD B;  1W2B Z;  5LL6 f;  5T6B A;  3GCF A;  1VQ9 1;  4DQY B;  2EGT A;  4A93 I;  1VQL 1;  3NH8 A;  1VQ9 Z;  2RT9 A;  3HOU I;  2VPX A;  1KQS Y;  3CD6 1;  4X6A I;  3CCL Z;  4A3J I;  3LUS A;  1K9M 2;  3QWU A;  2QEX 1;  1KD1 1;  3CD6 Z;  2M48 A;  4E31 A;  2VPW A;  1RO2 A;  4HGY A;  1I50 I;  4NFR A;  2QEX Z;  1TWH I;  2LIY A;  3G4S 1;  1USP A;  5A2Q f; 
#chains in the Genus database with same CATH homology
 1VQM 1;  3CCV 1;  2JUB A;  2I3C A;  4NBG A;  3RZD I;  1VQO 1;  3OW2 Y;  1Z02 A;  3S2H I;  2QA4 1;  1JJ2 Z;  2RIQ A;  5A2Q b;  1Y1W I;  1VQO Z;  3D6W A;  2V8J A;  4NBH A;  4NH1 C;  4DGL A;  1USP B;  2Y0S A;  2QA4 Z;  2VF1 A;  2PK7 A;  4NBF A;  3GTG I;  1M90 1;  1YUK A;  2R93 I;  2QKD A;  3PO3 S;  2YAD A;  1SFO I;  3G71 Z;  3GTL I;  1Q7Y 1;  2QLV B;  3H3V J;  3HOX I;  4HGZ A;  1YIJ 1;  1N8R 1;  5T67 A;  3CC2 Z;  1P9N A;  2RHB A;  4A3C I;  3IX0 A;  3MZL B;  2OOX B;  3KIF A;  3CMA 1;  2VUG A;  4NBC A;  1QVG Y;  1NUI A;  1LQL A;  1WII A;  1KC8 1;  4MH4 A;  3HOY I;  1K8A 2;  4MD7 A;  3CXC Z;  3EER A;  2E2I I;  1ZB9 A;  3FQQ A;  1JWH C;  2P3Y A;  2GU2 A;  3CCS Z;  1Y1V I;  3G6E 1;  1I3Q I;  2GTH A;  2JS4 A;  2DE5 A;  3G6E Z;  3GKQ A;  1RNI A;  3ESW A;  1Q86 1;  4TNU A;  4RVH A;  3S14 I;  3I07 A;  3CCR 1;  3D9X A;  4DK1 A;  2E2J I;  1TWF I;  4RS4 A;  1M1K 2;  4MD8 A;  3CCR Z;  1VQ5 1;  2JA5 I;  5D1O A;  3CC4 Z;  5CM2 M;  1TFI A;  4E2X A;  3TDH B;  2PM9 A;  3CPW Y;  1PFT A;  1VQ5 Z;  1VQK 1;  2E2H I;  2YU9 I;  4A3B I;  1S72 1;  3HOW I;  4A3E I;  5AN9 F;  2QRE B;  1VQK Z;  4BBS I;  1K9M 1;  1ZB8 A;  1Q81 2;  4MRI A;  3GTQ I;  2F4M A;  1Z03 A;  5D1O B;  1S72 Z;  4MXU A;  1S7M A;  1QF8 A;  3GTP I;  1VQL Z;  3F3F C;  1QVF Z;  3GTK I;  2V8K A;  3VB9 A;  5IT9 f;  1Q82 2;  4QTU A;  1YJW 1;  5FLX f;  1RO0 A;  1YI2 1;  3S1R I;  3J80 f;  1YJW Z;  1NJI 2;  1YI2 Z;  4RV9 A;  5IT9 b;  3MON A;  4A3M I;  5FLX b;  4RVF A;  1W2B Y;  3G4S Z;  1DL6 A;  4MON A;  3J80 b;  2M6N A;  4NB8 A;  1VQM Z;  3CCV Z;  1VQN 1;  2OZK A;  4NBD A;  2IZ3 A;  4S1T A;  2O53 A;  1YJ9 1;  1VQN Z;  3BG0 B;  1WCM I;  3CCQ 1;  1YJN 1;  3CQZ I;  4BY7 I;  1X0T A;  3CCQ Z;  1YJN Z;  4NB9 A;  3BG1 B;  2V8I A;  4A3D I;  2WB1 A;  2JA7 I;  2Q51 A;  3CCE 1;  4A3G I;  3S1N I;  1R9T I;  2H85 A;  1K8A 1;  1YIJ Z;  3CCE Z;  2R92 I;  1K73 2;  3I4M I;  1YHQ 1;  2JR6 A;  1Z01 A;  3CMA Z;  2WAQ A;  3T4N B;  3IF8 A;  1YHQ Z;  3NH5 A;  4HH4 A;  4NBB A;  3HOV I;  3S1M I;  3J81 f;  5D1P A;  2OTL 1;  3S2D I;  3CC7 1;  2NVT I;  2R6M A;  2AKL A;  2OTL Z;  2E9H A;  2KPI A;  3I55 1;  2HU9 A;  2NVX I;  2JA8 I;  1TWG I;  1M1K 1;  3J81 b;  5IP7 I;  4Y52 I;  4NOZ A;  3S15 I;  3CME 1;  3M3Y I;  5C44 I;  2OTJ 1;  4BBR I;  3I55 Z;  1VQ7 1;  3F3P C;  3CME Z;  4EWC A;  2OTJ Z;  1TWC I;  1KQS Z;  3FQM A;  1VQ7 Z;  3JAM f;  2W04 A;  3CXC Y;  1VQ6 1;  2GTI A;  2HF1 A;  1Q81 1;  4Y7N I;  1TWA I;  1X3Z A;  1X3W A;  4A3L I;  3EED A;  3S17 I;  3Q87 A;  1WW9 A;  1VQ6 Z;  3H0G I;  1VLA A;  2NVY I;  3JAM b;  1Q82 1;  4A3I I;  2JNY A;  3GTM S;  1VQ4 1;  2K5R A;  1VQP 1;  1NJI 1;  3VTN A;  5IP9 I;  3K7A I;  3OW2 Z;  1VQ4 Z;  4E32 A;  1VQP Z;  1YIT 1;  2O4H A;  2F4O A;  4E2Y A;  4E2W A;  2QR1 B;  3S1Q I;  3IFU A;  1N2F A;  3HOZ I;  1YIT Z;  3CCL 1;  1ZH1 A;  3CCJ 1;  4BXX I;  4QTT A;  3CCJ Z;  3U50 C;  2VUM I;  3J7A 4;  3NFZ A;  4E30 A;  2DE7 A;  3VMH A;  3PO3 I;  4NBA A;  2JA6 I;  1KD1 2;  4E2Z A;  2OOY B;  2K3R A;  3M4O I;  1QVF Y;  1YJ9 Z;  1K83 I;  2JMO A;  1QVG Z;  4A3F I;  2RBL A;  3NDI A;  1K73 1;  4CL1 A;  5C3E I;  2BJO A;  3G71 1;  4BY1 I;  5C4J I;  1I6H I;  3CC2 1;  2W03 A;  3HKZ A;  3MZK B;  3TE5 B;  2QRC B;  1VQ8 1;  2NVQ I;  1RO4 A;  4A3K I;  1JJ2 Y;  1NP6 A;  4RVD A;  5FLM I;  1M90 2;  3VMI A;  1VQ8 Z;  2ZAE B;  2RPR A;  4MD9 A;  3KIH A;  3GTO I;  4AYB A;  2PMZ A;  3CCM 1;  5T64 A;  3CCU 1;  1Q7Y 2;  3I4N I;  3NDJ A;  1N8R 2;  4XX2 A;  2LFU A;  3NH4 A;  1L1O C;  3CCM Z;  3CCU Z;  1ML8 A;  3CC7 Z;  2P28 A;  3CPW Z;  3CCS 1;  1RQF A;  1KC8 2;  4RVG A;  2IZ4 A;  3P5J B;  3S16 I;  2B63 I;  5C4X I;  3PO2 I;  3FKI I;  1RLY A;  2KI7 B;  3GTM I;  1Y1V S;  2Q4Z A;  3I56 1;  1KRL A;  1QYP A;  3GTJ I;  1YUA A;  3VMG A;  3I56 Z;  3CC4 1;  3RZO I;  1Q86 2;  2J6A A;  2DE6 A;  4NBE A;  2G2K A;  2R7Z I;  4E33 A;  2QRD B;  1W2B Z;  5LL6 f;  5T6B A;  3GCF A;  1VQ9 1;  4DQY B;  2EGT A;  4A93 I;  1VQL 1;  3NH8 A;  1VQ9 Z;  2RT9 A;  3HOU I;  1KQS Y;  3CD6 1;  4X6A I;  3CCL Z;  4A3J I;  3LUS A;  1K9M 2;  3QWU A;  2QEX 1;  1KD1 1;  3CD6 Z;  2M48 A;  4E31 A;  1RO2 A;  4HGY A;  1I50 I;  4NFR A;  2QEX Z;  1TWH I;  2LIY A;  3G4S 1;  1USP A;  5A2Q f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...