3CC41

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc4100
1YI21 1K8A1 1VQN1 1S721 3CCLZ 1VQ5Z 2OTLZ 3OW2Y 1VQ81 3G4SZ 3G6E1 1YHQZ 3CPWY 2QEX1 1VQO1 3CC21 3CD6Z 3CCMZ 1K9M2 3I56Z 1M1K2 3OW2Z 3CCR1 1VQ4Z 1YJ91 3CPWZ 1YIJ1 1M1K1 3CCV1 3CCSZ 1Q862 3CC41 2OTJZ 1K8A2 1VQ9Z 1Q861 3CC71 1VQP1 1QVFY 3CMAZ 1YITZ 2QA4Z 3CCQ1 1VQLZ 1VQNZ 1VQ8Z 1VQM1 3CCJ1 3CCU1 1N8R2 1QVFZ 3I551 1KQSY 1VQOZ 3CCEZ 3CC2Z 1VQKZ 3CXCY 1YJ9Z 1K9M1 1KQSZ 3CCL1 1VQ6Z 1VQ51 1YJWZ 3G71Z 3G4S1 3CME1 1YHQ1 3CCVZ 1VQ7Z 3CXCZ 1YJNZ 1Q822 1KC82 3CCM1 3I561 1YI2Z 1QVGY 1S72Z 1Q812 1VQPZ 1W2BY 1Q821 1KC81 1K732 3G6EZ 1QVGZ 2QEXZ 1Q7Y2 1VQMZ 1KD12 1W2BZ 1Q811 2OTJ1 3CCRZ 1VQ91 1K731 1N8R1 1YIJZ 1Q7Y1 1NJI2 1YIT1 3CMA1 1VQ71 2OTL1 2QA41 1KD11 1VQL1 1JJ2Y 1M902 3CC4Z 3CD61 3CMEZ 1NJI1 3CCE1 1VQ41 1VQK1 1JJ2Z 1M901 3CC7Z 1VQ61 1YJW1 3CCS1 3G711 3CCQZ 3CCJZ 3CCUZ 1YJN1 3I55Z
chains in the Genus database with same CATH superfamily
4RVHA 3HOVI 3S14I 1TWFI 2GTIA 3GKQA 2OTLZ 3G6E1 2Y0SA 4E33A 1VQO1 1VLAA 2DE5A 3JAMb 3CD6Z 2LFUA 3NH4A 3CCMZ 1YIJ1 4NBGA 3M4OI 2O4HA 2AYDA 2QREB 1Q862 4A3II 3S2HI 3BG1B 2NVYI 1VQP1 5T64A 3CQZI 2QA4Z 2JA6I 5D1OA 1VQLZ 3FKII 5C4XI 3HOXI 3GTMS 4BBRI 3F3FC 3CCJ1 3I551 3RZDI 3U50C 5IT9f 5D1PA 1KQSZ 1VQ6Z 1VQ51 4Y7NI 3G4S1 4S1TA 4MONA 2RIQA 1NUIA 3CCVZ 1DL6A 1Q822 3HOWI 5A2Qf 1QVGY 4MD9A 3S15I 1Q812 2RBLA 4A3BI 3G6EZ 3S1QI 3VMGA 4MD7A 1Y8CA 1WZNA 2IZ3A 3Q87A 1VQ91 2IZ4A 1K731 4RVFA 5FLXf 1WCMI 1YIJZ 2P3YA 1Q7Y1 1YIT1 2OTL1 4BY7I 1ML8A 2R7ZI 1ZB9A 1USPA 3CD61 4RVGA 4E30A 3CMEZ 1NJI1 2NVQI 2F4OA 2J6AA 3ESWA 2VF1A 3PO3I 1M901 2GU2A 1NP6A 2VPZA 3G711 3MZKB 1YUKA 2M6NA 3CCJZ 1YJN1 3I55Z 1X3WA 3EERA 2DE7A 2ZAEB 3D6WA 2LEXA 3IFUA 1Y1WI 1Y1VS 4A3FI 3RZOI 4AYBA 1VQ5Z 4E31A 3G4SZ 2JIQA 1K9M2 3OW2Z 4RV9A 1VQ4Z 2OZKA 1Z02A 1M1K1 2RHBA 3CCV1 2PK7A 4NBAA 1Z01A 3GTOI 1ZB8A 1VQ9Z 2V8JA 2JR6A 2JNYA 1YITZ 3J80f 2M48A 3GTKI 3CCQ1 1VQNZ 3IR7A 1S7MA 4E2WA 3KIFA 1QVFZ 1KQSY 4E2YA 4NBHA 2V8IA 1YJ9Z 1K9M1 3CCL1 4E2XA 3G71Z 3M3YI 2H85A 1TWCI 3CME1 4XX2A 4DGLA 2PM9A 1YJNZ 3FQMA 2HU9A 1RLYA 3I07A 2EGTA 4A3KI 1KC81 4NBCA 1QXFA 1K732 3TDHB 4NFRA 1I6HI 1FDIA 1Q7Y2 1VQMZ 1W2BZ 2OTJ1 1AA6A 1I3QI 3VTNA 3H3VJ 4BY1I 1TWHI 5T6BA 1NJI2 2W03A 3HOUI 3T4NB 1I50I 1KD11 2JIRA 3IX0A 1RO4A 1M902 1TWAI 1YUAA 3HKZA 5FLMI 3CCE1 1VQ41 1VQK1 1JJ2Z 4NB9A 1R9TI 2O53A 1YJW1 3S17I 1JWHC 3CCQZ 1WJ2A 4NBFA 2Q4ZA 1YI21 2DE6A 3HOYI 2R6MA 2JA8I 1VQN1 1S721 1ZH1A 3CCLZ 4MRIA 3NH5A 3OW2Y 2R92I 1TFIA 2GTHA 1M1K2 4A3GI 1RO0A 3CCR1 2WB1A 3NH8A 1YJ91 3CPWZ 2JUBA 4TNUA 1WIIA 3NDIA 2VPXA 2E7ZA 3J81b 4A3EI 1Q16A 3LUSA 3CCSZ 2NVTI 4X6AI 2F4MA 4E32A 5IP9I 2PMZA 3PO3S 3CC41 2QKDA 2WAQA 3QWUA 2OTJZ 5AN9F 1TWGI 3S1MI 3CC71 5C44I 1QVFY 3IF8A 3D9XA 4A3CI 4QTUA 3I4MI 3MZLB 1VQ8Z 1VQM1 5C4JI 4DQYB 3CCU1 1N8R2 3FQQA 2QRDB 3CCEZ 3CC2Z 1LQLA 1VQKZ 3GTQI 4HGZA 3BG0B 3JAMf 1YJWZ 2QR1B 2K3RA 2JIOA 1YHQ1 2I3CA 2VPYA 3CXCZ 1KC82 3I561 1YI2Z 3S2DI 1P9NA 1S72Z 1W2BY 1QYPA 3S1RI 3GTPI 2B63I 4NBDA 1KD12 2KI7B 2QLVB 5CM2M 2V3VA 2LIYA 3CCRZ 2VUMI 1N8R1 3P5JB 3J7A4 1PFTA 3CMA1 3GCFA 2QRCB 3MONA 1JJ2Y 4A3JI 4NH1C 3CC4Z 2E2HI 1SIWA 4NBBA 2E2II 2NVXI 1SFOI 1X3ZA 5D1OB 3CC7Z 2OOYB 2JA5I 3CCS1 4CL1A 1FDOA 3EEDA 3H0GI 3CCUZ 1VQ71 4HGYA 3J80b 2AKLA 3GTMI 4A3LI 2VPWA 1K8A1 2W04A 1L1OC 1VQ81 3I4NI 2YU9I 1YHQZ 3CPWY 2QEX1 4NB8A 4RS4A 3PO2I 1X0TA 3CC21 3I56Z 1RQFA 2OOXB 2RT9A 5T67A 2NAPA 2HF1A 3GTLI 2K5RA 5C3EI 2KPIA 2E2JI 1Z03A 3J81f 4DK1A 4HH4A 1Q861 4A3DI 5LL6f 3CMAZ 5IT9b 3NDJA 1USPB 2JMOA 2R93I 2VUGA 4A93I 3VMIA 2V45A 3GTJI 1VQOZ 2P28A 2JIMA 4MXUA 5IP7I 1RO2A 3S16I 5A2Qb 1K83I 3D2LA 3CXCY 4BXXI 4NBEA 2IV2X 3TE5B 2E9HA 1VQ7Z 2G2KA 2V8KA 3CCM1 1QF8A 4RVDA 4QTTA 4NOZA 1VQPZ 1Q821 2Q51A 5FLXb 1QVGZ 2JIPA 2QEXZ 1Y1VI 1RNIA 3F3PC 1Q811 4EWCA 4Y52I 4MH4A 1WW9A 3VMHA 2YADA 2QA41 3NFZA 4E2ZA 3KIHA 1VQL1 3K7AI 2BJOA 3GTGI 3S1NI 1KRLA 2RPRA 3HOZI 3VB9A 2JA7I 4A3MI 1VQ61 2JS4A 1N2FA 4MD8A 1K8A2 4BBSI
chains in the Genus database with same CATH topology
4RVHA 3HOVI 3S14I 1TWFI 2GTIA 3GKQA 2OTLZ 3G6E1 2Y0SA 4E33A 1VQO1 1VLAA 2DE5A 3JAMb 3CD6Z 2LFUA 3NH4A 3CCMZ 1YIJ1 4NBGA 3M4OI 2O4HA 2QREB 1Q862 4A3II 3S2HI 3BG1B 2NVYI 1VQP1 5T64A 3CQZI 2QA4Z 2JA6I 5D1OA 1VQLZ 3FKII 5C4XI 3HOXI 3GTMS 4BBRI 3F3FC 3CCJ1 3I551 3RZDI 3U50C 5IT9f 5D1PA 1KQSZ 1VQ6Z 1VQ51 4Y7NI 4S1TA 3G4S1 4MONA 2RIQA 1NUIA 3CCVZ 1DL6A 1Q822 3HOWI 5A2Qf 1QVGY 4MD9A 3S15I 1Q812 2RBLA 4A3BI 3G6EZ 3S1QI 3VMGA 4MD7A 2IZ3A 3Q87A 1VQ91 2IZ4A 1K731 4RVFA 5FLXf 1WCMI 1YIJZ 2P3YA 1Q7Y1 1YIT1 2OTL1 4BY7I 1ML8A 2R7ZI 1ZB9A 1USPA 3CD61 4RVGA 4E30A 3CMEZ 1NJI1 2NVQI 2F4OA 2J6AA 3ESWA 2VF1A 3PO3I 1M901 2GU2A 1NP6A 3G711 3MZKB 1YUKA 2M6NA 3CCJZ 1YJN1 3I55Z 1X3WA 3EERA 2DE7A 2ZAEB 3D6WA 3IFUA 1Y1WI 1Y1VS 4A3FI 3RZOI 4AYBA 1VQ5Z 4E31A 3G4SZ 1K9M2 3OW2Z 4RV9A 1VQ4Z 2OZKA 1Z02A 1M1K1 2RHBA 3CCV1 2PK7A 4NBAA 1Z01A 3GTOI 1ZB8A 1VQ9Z 2V8JA 2JR6A 2JNYA 1YITZ 3J80f 2M48A 3GTKI 3CCQ1 1VQNZ 1S7MA 4E2WA 3KIFA 1QVFZ 1KQSY 4E2YA 4NBHA 2V8IA 1YJ9Z 1K9M1 3CCL1 4E2XA 3G71Z 3M3YI 2H85A 1TWCI 3CME1 4XX2A 4DGLA 2PM9A 1YJNZ 3FQMA 2HU9A 1RLYA 3I07A 2EGTA 4A3KI 1KC81 4NBCA 1K732 3TDHB 4NFRA 1I6HI 1Q7Y2 1VQMZ 1W2BZ 2OTJ1 1I3QI 3VTNA 3H3VJ 4BY1I 1TWHI 5T6BA 1NJI2 2W03A 3HOUI 3T4NB 1I50I 1KD11 3IX0A 1RO4A 1M902 1TWAI 1YUAA 3HKZA 5FLMI 3CCE1 1VQ41 1VQK1 1JJ2Z 4NB9A 1R9TI 2O53A 1YJW1 3S17I 1JWHC 3CCQZ 4NBFA 2Q4ZA 1YI21 2DE6A 3HOYI 2R6MA 2JA8I 1VQN1 1S721 1ZH1A 3CCLZ 4MRIA 3NH5A 3OW2Y 2R92I 1TFIA 2GTHA 1M1K2 4A3GI 1RO0A 3CCR1 2WB1A 3NH8A 1YJ91 3CPWZ 2JUBA 4TNUA 1WIIA 3NDIA 3J81b 4A3EI 2NVTI 3LUSA 3CCSZ 4X6AI 2F4MA 4E32A 5IP9I 2PMZA 3PO3S 3CC41 2QKDA 2WAQA 3QWUA 2OTJZ 5AN9F 1TWGI 3S1MI 3CC71 5C44I 1QVFY 3IF8A 3D9XA 4A3CI 4QTUA 3I4MI 3MZLB 1VQ8Z 1VQM1 5C4JI 4DQYB 3CCU1 1N8R2 3FQQA 2QRDB 3CCEZ 3CC2Z 1LQLA 1VQKZ 3GTQI 4HGZA 3BG0B 3JAMf 1YJWZ 2QR1B 2K3RA 1YHQ1 2I3CA 3CXCZ 1KC82 3I561 1YI2Z 3S2DI 1P9NA 1S72Z 1W2BY 1QYPA 3S1RI 3GTPI 2B63I 4NBDA 1KD12 2KI7B 2QLVB 5CM2M 2LIYA 3CCRZ 2VUMI 1N8R1 3P5JB 3J7A4 1PFTA 3CMA1 3GCFA 2QRCB 3MONA 1JJ2Y 4A3JI 4NH1C 3CC4Z 2E2HI 4NBBA 2E2II 2NVXI 1SFOI 1X3ZA 5D1OB 3CC7Z 2OOYB 2JA5I 3CCS1 4CL1A 3EEDA 3H0GI 3CCUZ 1VQ71 4HGYA 3J80b 2AKLA 3GTMI 4A3LI 1K8A1 2W04A 1L1OC 1VQ81 3I4NI 2YU9I 1YHQZ 3CPWY 2QEX1 4NB8A 4RS4A 3PO2I 1X0TA 3CC21 3I56Z 1RQFA 2OOXB 2RT9A 5T67A 2HF1A 3GTLI 2K5RA 5C3EI 2KPIA 2E2JI 1Z03A 3J81f 4DK1A 4HH4A 1Q861 4A3DI 5LL6f 3CMAZ 5IT9b 3NDJA 1USPB 2JMOA 2R93I 2VUGA 4A93I 3VMIA 3GTJI 1VQOZ 2P28A 4MXUA 5IP7I 1RO2A 3S16I 5A2Qb 1K83I 3CXCY 4BXXI 4NBEA 3TE5B 2E9HA 1VQ7Z 2G2KA 2V8KA 3CCM1 1QF8A 4RVDA 4QTTA 4NOZA 1VQPZ 1Q821 2Q51A 5FLXb 1QVGZ 2QEXZ 1Y1VI 1RNIA 3F3PC 1Q811 4EWCA 4Y52I 4MH4A 1WW9A 3VMHA 2YADA 2QA41 3NFZA 4E2ZA 3KIHA 1VQL1 3K7AI 2BJOA 3GTGI 3S1NI 1KRLA 2RPRA 3HOZI 3VB9A 2JA7I 4A3MI 1VQ61 2JS4A 1N2FA 4MD8A 1K8A2 4BBSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 1;  1K8A 1;  1VQN 1;  1S72 1;  3CCL Z;  1VQ5 Z;  2OTL Z;  3OW2 Y;  1VQ8 1;  3G4S Z;  3G6E 1;  1YHQ Z;  3CPW Y;  2QEX 1;  1VQO 1;  3CC2 1;  3CD6 Z;  3CCM Z;  1K9M 2;  3I56 Z;  1M1K 2;  3OW2 Z;  3CCR 1;  1VQ4 Z;  1YJ9 1;  3CPW Z;  1YIJ 1;  1M1K 1;  3CCV 1;  3CCS Z;  1Q86 2;  3CC4 1;  2OTJ Z;  1K8A 2;  1VQ9 Z;  1Q86 1;  3CC7 1;  1VQP 1;  1QVF Y;  3CMA Z;  1YIT Z;  2QA4 Z;  3CCQ 1;  1VQL Z;  1VQN Z;  1VQ8 Z;  1VQM 1;  3CCJ 1;  3CCU 1;  1N8R 2;  1QVF Z;  3I55 1;  1KQS Y;  1VQO Z;  3CCE Z;  3CC2 Z;  1VQK Z;  3CXC Y;  1YJ9 Z;  1K9M 1;  1KQS Z;  3CCL 1;  1VQ6 Z;  1VQ5 1;  1YJW Z;  3G71 Z;  3G4S 1;  3CME 1;  1YHQ 1;  3CCV Z;  1VQ7 Z;  3CXC Z;  1YJN Z;  1Q82 2;  1KC8 2;  3CCM 1;  3I56 1;  1YI2 Z;  1QVG Y;  1S72 Z;  1Q81 2;  1VQP Z;  1W2B Y;  1Q82 1;  1KC8 1;  1K73 2;  3G6E Z;  1QVG Z;  2QEX Z;  1Q7Y 2;  1VQM Z;  1KD1 2;  1W2B Z;  1Q81 1;  2OTJ 1;  3CCR Z;  1VQ9 1;  1K73 1;  1N8R 1;  1YIJ Z;  1Q7Y 1;  1NJI 2;  1YIT 1;  3CMA 1;  1VQ7 1;  2OTL 1;  2QA4 1;  1KD1 1;  1VQL 1;  1JJ2 Y;  1M90 2;  3CC4 Z;  3CD6 1;  3CME Z;  1NJI 1;  3CCE 1;  1VQ4 1;  1VQK 1;  1JJ2 Z;  1M90 1;  3CC7 Z;  1VQ6 1;  1YJW 1;  3CCS 1;  3G71 1;  3CCQ Z;  3CCJ Z;  3CCU Z;  1YJN 1;  3I55 Z; 
#chains in the Genus database with same CATH topology
 4RVH A;  3HOV I;  3S14 I;  1TWF I;  2GTI A;  3GKQ A;  2OTL Z;  3G6E 1;  2Y0S A;  4E33 A;  1VQO 1;  1VLA A;  2DE5 A;  3JAM b;  3CD6 Z;  2LFU A;  3NH4 A;  3CCM Z;  1YIJ 1;  4NBG A;  3M4O I;  2O4H A;  2AYD A;  2QRE B;  1Q86 2;  4A3I I;  3S2H I;  3BG1 B;  2NVY I;  1VQP 1;  5T64 A;  3CQZ I;  2QA4 Z;  2JA6 I;  5D1O A;  1VQL Z;  3FKI I;  5C4X I;  3HOX I;  3GTM S;  4BBR I;  3F3F C;  3CCJ 1;  3I55 1;  3RZD I;  3U50 C;  5IT9 f;  5D1P A;  1KQS Z;  1VQ6 Z;  1VQ5 1;  4Y7N I;  3G4S 1;  4S1T A;  4MON A;  2RIQ A;  1NUI A;  3CCV Z;  1DL6 A;  1Q82 2;  3HOW I;  5A2Q f;  1QVG Y;  4MD9 A;  3S15 I;  1Q81 2;  2RBL A;  4A3B I;  3G6E Z;  3S1Q I;  3VMG A;  4MD7 A;  1Y8C A;  1WZN A;  2IZ3 A;  3Q87 A;  1VQ9 1;  2IZ4 A;  1K73 1;  4RVF A;  5FLX f;  1WCM I;  1YIJ Z;  2P3Y A;  1Q7Y 1;  1YIT 1;  2OTL 1;  4BY7 I;  1ML8 A;  2R7Z I;  1ZB9 A;  1USP A;  3CD6 1;  4RVG A;  4E30 A;  3CME Z;  1NJI 1;  2NVQ I;  2F4O A;  2J6A A;  3ESW A;  2VF1 A;  3PO3 I;  1M90 1;  2GU2 A;  1NP6 A;  2VPZ A;  3G71 1;  3MZK B;  1YUK A;  2M6N A;  3CCJ Z;  1YJN 1;  3I55 Z;  1X3W A;  3EER A;  2DE7 A;  2ZAE B;  3D6W A;  2LEX A;  3IFU A;  1Y1W I;  1Y1V S;  4A3F I;  3RZO I;  4AYB A;  1VQ5 Z;  4E31 A;  3G4S Z;  2JIQ A;  1K9M 2;  3OW2 Z;  4RV9 A;  1VQ4 Z;  2OZK A;  1Z02 A;  1M1K 1;  2RHB A;  3CCV 1;  2PK7 A;  4NBA A;  1Z01 A;  3GTO I;  1ZB8 A;  1VQ9 Z;  2V8J A;  2JR6 A;  2JNY A;  1YIT Z;  3J80 f;  2M48 A;  3GTK I;  3CCQ 1;  1VQN Z;  3IR7 A;  1S7M A;  4E2W A;  3KIF A;  1QVF Z;  1KQS Y;  4E2Y A;  4NBH A;  2V8I A;  1YJ9 Z;  1K9M 1;  3CCL 1;  4E2X A;  3G71 Z;  3M3Y I;  2H85 A;  1TWC I;  3CME 1;  4XX2 A;  4DGL A;  2PM9 A;  1YJN Z;  3FQM A;  2HU9 A;  1RLY A;  3I07 A;  2EGT A;  4A3K I;  1KC8 1;  4NBC A;  1QXF A;  1K73 2;  3TDH B;  4NFR A;  1I6H I;  1FDI A;  1Q7Y 2;  1VQM Z;  1W2B Z;  2OTJ 1;  1AA6 A;  1I3Q I;  3VTN A;  3H3V J;  4BY1 I;  1TWH I;  5T6B A;  1NJI 2;  2W03 A;  3HOU I;  3T4N B;  1I50 I;  1KD1 1;  2JIR A;  3IX0 A;  1RO4 A;  1M90 2;  1TWA I;  1YUA A;  3HKZ A;  5FLM I;  3CCE 1;  1VQ4 1;  1VQK 1;  1JJ2 Z;  4NB9 A;  1R9T I;  2O53 A;  1YJW 1;  3S17 I;  1JWH C;  3CCQ Z;  1WJ2 A;  4NBF A;  2Q4Z A;  1YI2 1;  2DE6 A;  3HOY I;  2R6M A;  2JA8 I;  1VQN 1;  1S72 1;  1ZH1 A;  3CCL Z;  4MRI A;  3NH5 A;  3OW2 Y;  2R92 I;  1TFI A;  2GTH A;  1M1K 2;  4A3G I;  1RO0 A;  3CCR 1;  2WB1 A;  3NH8 A;  1YJ9 1;  3CPW Z;  2JUB A;  4TNU A;  1WII A;  3NDI A;  2VPX A;  2E7Z A;  3J81 b;  4A3E I;  1Q16 A;  3LUS A;  3CCS Z;  2NVT I;  4X6A I;  2F4M A;  4E32 A;  5IP9 I;  2PMZ A;  3PO3 S;  3CC4 1;  2QKD A;  2WAQ A;  3QWU A;  2OTJ Z;  5AN9 F;  1TWG I;  3S1M I;  3CC7 1;  5C44 I;  1QVF Y;  3IF8 A;  3D9X A;  4A3C I;  4QTU A;  3I4M I;  3MZL B;  1VQ8 Z;  1VQM 1;  5C4J I;  4DQY B;  3CCU 1;  1N8R 2;  3FQQ A;  2QRD B;  3CCE Z;  3CC2 Z;  1LQL A;  1VQK Z;  3GTQ I;  4HGZ A;  3BG0 B;  3JAM f;  1YJW Z;  2QR1 B;  2K3R A;  2JIO A;  1YHQ 1;  2I3C A;  2VPY A;  3CXC Z;  1KC8 2;  3I56 1;  1YI2 Z;  3S2D I;  1P9N A;  1S72 Z;  1W2B Y;  1QYP A;  3S1R I;  3GTP I;  2B63 I;  4NBD A;  1KD1 2;  2KI7 B;  2QLV B;  5CM2 M;  2V3V A;  2LIY A;  3CCR Z;  2VUM I;  1N8R 1;  3P5J B;  3J7A 4;  1PFT A;  3CMA 1;  3GCF A;  2QRC B;  3MON A;  1JJ2 Y;  4A3J I;  4NH1 C;  3CC4 Z;  2E2H I;  1SIW A;  4NBB A;  2E2I I;  2NVX I;  1SFO I;  1X3Z A;  5D1O B;  3CC7 Z;  2OOY B;  2JA5 I;  3CCS 1;  4CL1 A;  1FDO A;  3EED A;  3H0G I;  3CCU Z;  1VQ7 1;  4HGY A;  3J80 b;  2AKL A;  3GTM I;  4A3L I;  2VPW A;  1K8A 1;  2W04 A;  1L1O C;  1VQ8 1;  3I4N I;  2YU9 I;  1YHQ Z;  3CPW Y;  2QEX 1;  4NB8 A;  4RS4 A;  3PO2 I;  1X0T A;  3CC2 1;  3I56 Z;  1RQF A;  2OOX B;  2RT9 A;  5T67 A;  2NAP A;  2HF1 A;  3GTL I;  2K5R A;  5C3E I;  2KPI A;  2E2J I;  1Z03 A;  3J81 f;  4DK1 A;  4HH4 A;  1Q86 1;  4A3D I;  5LL6 f;  3CMA Z;  5IT9 b;  3NDJ A;  1USP B;  2JMO A;  2R93 I;  2VUG A;  4A93 I;  3VMI A;  2V45 A;  3GTJ I;  1VQO Z;  2P28 A;  2JIM A;  4MXU A;  5IP7 I;  1RO2 A;  3S16 I;  5A2Q b;  1K83 I;  3D2L A;  3CXC Y;  4BXX I;  4NBE A;  2IV2 X;  3TE5 B;  2E9H A;  1VQ7 Z;  2G2K A;  2V8K A;  3CCM 1;  1QF8 A;  4RVD A;  4QTT A;  4NOZ A;  1VQP Z;  1Q82 1;  2Q51 A;  5FLX b;  1QVG Z;  2JIP A;  2QEX Z;  1Y1V I;  1RNI A;  3F3P C;  1Q81 1;  4EWC A;  4Y52 I;  4MH4 A;  1WW9 A;  3VMH A;  2YAD A;  2QA4 1;  3NFZ A;  4E2Z A;  3KIH A;  1VQL 1;  3K7A I;  2BJO A;  3GTG I;  3S1N I;  1KRL A;  2RPR A;  3HOZ I;  3VB9 A;  2JA7 I;  4A3M I;  1VQ6 1;  2JS4 A;  1N2F A;  4MD8 A;  1K8A 2;  4BBS I; 
#chains in the Genus database with same CATH homology
 4RVH A;  3HOV I;  3S14 I;  1TWF I;  2GTI A;  3GKQ A;  2OTL Z;  3G6E 1;  2Y0S A;  4E33 A;  1VQO 1;  1VLA A;  2DE5 A;  3JAM b;  3CD6 Z;  2LFU A;  3NH4 A;  3CCM Z;  1YIJ 1;  4NBG A;  3M4O I;  2O4H A;  2QRE B;  1Q86 2;  4A3I I;  3S2H I;  3BG1 B;  2NVY I;  1VQP 1;  5T64 A;  3CQZ I;  2QA4 Z;  2JA6 I;  5D1O A;  1VQL Z;  3FKI I;  5C4X I;  3HOX I;  3GTM S;  4BBR I;  3F3F C;  3CCJ 1;  3I55 1;  3RZD I;  3U50 C;  5IT9 f;  5D1P A;  1KQS Z;  1VQ6 Z;  1VQ5 1;  4Y7N I;  4S1T A;  3G4S 1;  4MON A;  2RIQ A;  1NUI A;  3CCV Z;  1DL6 A;  1Q82 2;  3HOW I;  5A2Q f;  1QVG Y;  4MD9 A;  3S15 I;  1Q81 2;  2RBL A;  4A3B I;  3G6E Z;  3S1Q I;  3VMG A;  4MD7 A;  2IZ3 A;  3Q87 A;  1VQ9 1;  2IZ4 A;  1K73 1;  4RVF A;  5FLX f;  1WCM I;  1YIJ Z;  2P3Y A;  1Q7Y 1;  1YIT 1;  2OTL 1;  4BY7 I;  1ML8 A;  2R7Z I;  1ZB9 A;  1USP A;  3CD6 1;  4RVG A;  4E30 A;  3CME Z;  1NJI 1;  2NVQ I;  2F4O A;  2J6A A;  3ESW A;  2VF1 A;  3PO3 I;  1M90 1;  2GU2 A;  1NP6 A;  3G71 1;  3MZK B;  1YUK A;  2M6N A;  3CCJ Z;  1YJN 1;  3I55 Z;  1X3W A;  3EER A;  2DE7 A;  2ZAE B;  3D6W A;  3IFU A;  1Y1W I;  1Y1V S;  4A3F I;  3RZO I;  4AYB A;  1VQ5 Z;  4E31 A;  3G4S Z;  1K9M 2;  3OW2 Z;  4RV9 A;  1VQ4 Z;  2OZK A;  1Z02 A;  1M1K 1;  2RHB A;  3CCV 1;  2PK7 A;  4NBA A;  1Z01 A;  3GTO I;  1ZB8 A;  1VQ9 Z;  2V8J A;  2JR6 A;  2JNY A;  1YIT Z;  3J80 f;  2M48 A;  3GTK I;  3CCQ 1;  1VQN Z;  1S7M A;  4E2W A;  3KIF A;  1QVF Z;  1KQS Y;  4E2Y A;  4NBH A;  2V8I A;  1YJ9 Z;  1K9M 1;  3CCL 1;  4E2X A;  3G71 Z;  3M3Y I;  2H85 A;  1TWC I;  3CME 1;  4XX2 A;  4DGL A;  2PM9 A;  1YJN Z;  3FQM A;  2HU9 A;  1RLY A;  3I07 A;  2EGT A;  4A3K I;  1KC8 1;  4NBC A;  1K73 2;  3TDH B;  4NFR A;  1I6H I;  1Q7Y 2;  1VQM Z;  1W2B Z;  2OTJ 1;  1I3Q I;  3VTN A;  3H3V J;  4BY1 I;  1TWH I;  5T6B A;  1NJI 2;  2W03 A;  3HOU I;  3T4N B;  1I50 I;  1KD1 1;  3IX0 A;  1RO4 A;  1M90 2;  1TWA I;  1YUA A;  3HKZ A;  5FLM I;  3CCE 1;  1VQ4 1;  1VQK 1;  1JJ2 Z;  4NB9 A;  1R9T I;  2O53 A;  1YJW 1;  3S17 I;  1JWH C;  3CCQ Z;  4NBF A;  2Q4Z A;  1YI2 1;  2DE6 A;  3HOY I;  2R6M A;  2JA8 I;  1VQN 1;  1S72 1;  1ZH1 A;  3CCL Z;  4MRI A;  3NH5 A;  3OW2 Y;  2R92 I;  1TFI A;  2GTH A;  1M1K 2;  4A3G I;  1RO0 A;  3CCR 1;  2WB1 A;  3NH8 A;  1YJ9 1;  3CPW Z;  2JUB A;  4TNU A;  1WII A;  3NDI A;  3J81 b;  4A3E I;  2NVT I;  3LUS A;  3CCS Z;  4X6A I;  2F4M A;  4E32 A;  5IP9 I;  2PMZ A;  3PO3 S;  3CC4 1;  2QKD A;  2WAQ A;  3QWU A;  2OTJ Z;  5AN9 F;  1TWG I;  3S1M I;  3CC7 1;  5C44 I;  1QVF Y;  3IF8 A;  3D9X A;  4A3C I;  4QTU A;  3I4M I;  3MZL B;  1VQ8 Z;  1VQM 1;  5C4J I;  4DQY B;  3CCU 1;  1N8R 2;  3FQQ A;  2QRD B;  3CCE Z;  3CC2 Z;  1LQL A;  1VQK Z;  3GTQ I;  4HGZ A;  3BG0 B;  3JAM f;  1YJW Z;  2QR1 B;  2K3R A;  1YHQ 1;  2I3C A;  3CXC Z;  1KC8 2;  3I56 1;  1YI2 Z;  3S2D I;  1P9N A;  1S72 Z;  1W2B Y;  1QYP A;  3S1R I;  3GTP I;  2B63 I;  4NBD A;  1KD1 2;  2KI7 B;  2QLV B;  5CM2 M;  2LIY A;  3CCR Z;  2VUM I;  1N8R 1;  3P5J B;  3J7A 4;  1PFT A;  3CMA 1;  3GCF A;  2QRC B;  3MON A;  1JJ2 Y;  4A3J I;  4NH1 C;  3CC4 Z;  2E2H I;  4NBB A;  2E2I I;  2NVX I;  1SFO I;  1X3Z A;  5D1O B;  3CC7 Z;  2OOY B;  2JA5 I;  3CCS 1;  4CL1 A;  3EED A;  3H0G I;  3CCU Z;  1VQ7 1;  4HGY A;  3J80 b;  2AKL A;  3GTM I;  4A3L I;  1K8A 1;  2W04 A;  1L1O C;  1VQ8 1;  3I4N I;  2YU9 I;  1YHQ Z;  3CPW Y;  2QEX 1;  4NB8 A;  4RS4 A;  3PO2 I;  1X0T A;  3CC2 1;  3I56 Z;  1RQF A;  2OOX B;  2RT9 A;  5T67 A;  2HF1 A;  3GTL I;  2K5R A;  5C3E I;  2KPI A;  2E2J I;  1Z03 A;  3J81 f;  4DK1 A;  4HH4 A;  1Q86 1;  4A3D I;  5LL6 f;  3CMA Z;  5IT9 b;  3NDJ A;  1USP B;  2JMO A;  2R93 I;  2VUG A;  4A93 I;  3VMI A;  3GTJ I;  1VQO Z;  2P28 A;  4MXU A;  5IP7 I;  1RO2 A;  3S16 I;  5A2Q b;  1K83 I;  3CXC Y;  4BXX I;  4NBE A;  3TE5 B;  2E9H A;  1VQ7 Z;  2G2K A;  2V8K A;  3CCM 1;  1QF8 A;  4RVD A;  4QTT A;  4NOZ A;  1VQP Z;  1Q82 1;  2Q51 A;  5FLX b;  1QVG Z;  2QEX Z;  1Y1V I;  1RNI A;  3F3P C;  1Q81 1;  4EWC A;  4Y52 I;  4MH4 A;  1WW9 A;  3VMH A;  2YAD A;  2QA4 1;  3NFZ A;  4E2Z A;  3KIH A;  1VQL 1;  3K7A I;  2BJO A;  3GTG I;  3S1N I;  1KRL A;  2RPR A;  3HOZ I;  3VB9 A;  2JA7 I;  4A3M I;  1VQ6 1;  2JS4 A;  1N2F A;  4MD8 A;  1K8A 2;  4BBS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...