3CC41

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc4100
1YI21 3I561 1JJ2Y 1Q811 1VQP1 3G6E1 1VQ4Z 1YHQ1 1N8R2 1YJWZ 2OTJZ 1KD11 3CC4Z 1M902 1VQ91 2QEXZ 1YJN1 3CMAZ 1KC81 3CCVZ 1KQSY 1YIT1 3G711 2QA41 3G4SZ 3CCMZ 1YJ91 1VQ8Z 1QVFZ 3CD61 1KD12 1VQPZ 1S721 1VQ9Z 3OW2Z 3CXCY 1YJW1 1YI2Z 3CCRZ 3CCS1 1Q861 1VQ41 3OW2Y 3CPWY 1VQ61 3CD6Z 1YIJ1 3G71Z 3CCJ1 2QA4Z 3I55Z 1NJI2 1VQ71 3CPWZ 1Q821 3CME1 1VQ51 1QVGY 1QVFY 1K8A2 2OTLZ 2OTJ1 3CC21 3CMA1 1KQSZ 1K9M2 1YJNZ 3CCR1 3CCSZ 3CCUZ 1M1K2 3CC41 3CXCZ 1S72Z 3CCEZ 3CCQZ 1YJ9Z 3G4S1 1Q7Y2 1K731 1VQL1 2OTL1 1Q862 3CCLZ 3CCM1 3CC7Z 1VQN1 3I551 3CCJZ 1VQ6Z 1Q822 3CCE1 1K8A1 1VQM1 1Q812 3CCU1 1M1K1 1VQK1 1VQ7Z 3CC2Z 1Q7Y1 1VQNZ 1W2BZ 1VQOZ 3CCQ1 1W2BY 3CCV1 1JJ2Z 1VQLZ 1K9M1 1YHQZ 1N8R1 1VQMZ 3I56Z 1VQKZ 1M901 3G6EZ 1K732 1VQ81 1QVGZ 3CCL1 1YIJZ 1YITZ 3CC71 1VQO1 3CMEZ 1NJI1 2QEX1 1VQ5Z 1KC82
chains in the Genus database with same CATH superfamily
4RS4A 1RO4A 1X0TA 2JMOA 4E33A 1P9NA 3IFUA 1VQP1 2E2JI 3PO3S 3J80b 1N8R2 2VUMI 3CC4Z 3EERA 2V8JA 5C3EI 4E30A 2O53A 3CCVZ 3HOWI 3G711 4HGYA 4Y52I 4NFRA 3S17I 4E2ZA 3I4NI 4CL1A 3OW2Z 2NVXI 1YI2Z 3CCRZ 1Q861 1VQ41 5T6BA 5A2Qb 1YIJ1 2QA4Z 4A3KI 3NH5A 4BY1I 1X3ZA 3CME1 2HU9A 4MONA 1QVFY 2JS4A 1K9M2 3GCFA 1M1K2 3CXCZ 2JUBA 1WIIA 1Z03A 2E9HA 4NOZA 4TNUA 5IP9I 1TWCI 3CCM1 3PO2I 3RZOI 3TE5B 3FKII 2W03A 2F4MA 1Q822 1JWHC 3CCE1 4A93I 5A2Qf 2E2HI 5AN9F 3NH8A 3S1RI 1Q812 4NBGA 4RV9A 2V3VA 2EGTA 2V45A 4NBBA 2WAQA 1Q7Y1 1RQFA 1VQNZ 4BXXI 1USPA 2NVTI 2QR1B 3S1MI 1YHQZ 1N8R1 1VQMZ 1M901 3HKZA 3VMHA 4NBHA 2JA8I 2KPIA 3HOYI 4NBDA 3LUSA 3HOXI 2R93I 3G6EZ 4AYBA 1VQ81 2DE7A 4A3JI 5T64A 4BBRI 2K5RA 2R7ZI 2ZAEB 4NBCA 3CCL1 1YITZ 3HOVI 1VQO1 3CMEZ 2OOYB 1KRLA 4NBEA 1FDIA 4BBSI 3JAMf 1Z02A 3S1NI 1YJWZ 4NB8A 2JA7I 4XX2A 2QEXZ 1YJN1 4Y7NI 3CMAZ 4HGZA 4A3BI 4A3MI 2QA41 4RVFA 4DK1A 1VQ8Z 2GTHA 2OOXB 3VTNA 2E2II 2JIMA 1VQ9Z 4A3CI 2Q51A 3OW2Y 1USPB 1LQLA 3I55Z 4S1TA 1QF8A 3GTLI 1Q821 3HOUI 1Q16A 1QVGY 3M4OI 3S1QI 1TFIA 2OTJ1 3CMA1 1YJNZ 3CCSZ 3CCUZ 3TDHB 1YUKA 3F3FC 3CCEZ 3D9XA 4A3LI 2VF1A 2I3CA 2KI7B 3CC7Z 1L1OC 2JIPA 2J6AA 3BG0B 3CQZI 1VQ6Z 3S14I 2RBLA 5C4XI 2IZ4A 3Q87A 3GTMS 3HOZI 3CCU1 1ZB9A 3NFZA 2RHBA 2G2KA 2LFUA 1VQOZ 1W2BY 1K9M1 1TWFI 3I56Z 2AKLA 4MRIA 2IV2X 2JNYA 3J7A4 1NP6A 2AYDA 2VPXA 1S7MA 5FLXf 3P5JB 1YIJZ 3RZDI 3S2HI 1K83I 1NJI1 3D6WA 4HH4A 1Y8CA 5FLMI 1JJ2Y 1Q811 2F4OA 1YHQ1 2OTJZ 1KD11 1QYPA 5T67A 4A3GI 3GTMI 1VQ91 2M48A 3S15I 2YADA 3GKQA 5D1OB 5C44I 3QWUA 3MONA 1I50I 3G4SZ 3CCMZ 1DL6A 1QVFZ 3GTGI 3MZKB 1VQPZ 1SIWA 3MZLB 1SFOI 1R9TI 3CXCY 2QRCB 1YJW1 4BY7I 3U50C 5C4JI 1VQ61 3CD6Z 3CCJ1 1RNIA 3IX0A 1RO2A 1VQ51 3F3PC 3NH4A 3CC21 2PK7A 4MD9A 4DQYB 1N2FA 3CCR1 2JIOA 3VMGA 3CC41 3KIFA 3CCQZ 3G4S1 1Q7Y2 1K731 1VQL1 2OTL1 2V8IA 2JR6A 1Q862 2OZKA 3CCLZ 2QKDA 1VQN1 3GTJI 3I551 3I07A 4A3DI 2NAPA 1RO0A 1VQM1 5D1OA 1ZH1A 4NBAA 1ML8A 3GTPI 1M1K1 4A3FI 4MD8A 1VQ7Z 2NVQI 2M6NA 3CC2Z 1Y1VS 2PMZA 3I4MI 1W2BZ 3J81f 4E2YA 3CCQ1 2Q4ZA 1JJ2Z 1VQLZ 2IZ3A 1TWAI 2HF1A 1VQKZ 4NH1C 5LL6f 2BJOA 1PFTA 4E2XA 4E32A 5IT9b 1QVGZ 3FQQA 3EEDA 3H0GI 3D2LA 3GTOI 4NBFA 4RVGA 5D1PA 1WJ2A 2QEX1 1VQ5Z 3IF8A 5IP7I 3ESWA 3JAMb 4RVHA 1KC82 5FLXb 2GU2A 3GTQI 1YI21 3I561 3G6E1 1VQ4Z 1FDOA 4E31A 2GTIA 3H3VJ 1M902 1RLYA 2H85A 2QLVB 4E2WA 2RT9A 1KC81 3S16I 1WW9A 3NDJA 1KQSY 1YIT1 1YJ91 2WB1A 1NUIA 4QTTA 1Y1WI 2Y0SA 3CD61 1KD12 3PO3I 1Y1VI 3J81b 2NVYI 1S721 2O4HA 2QRDB 2JIQA 1X3WA 3CCS1 2K3RA 4RVDA 3CPWY 2DE6A 3G71Z 4DGLA 3J80f 1NJI2 3K7AI 3CPWZ 1VQ71 4QTUA 2R92I 2B63I 2VPWA 2R6MA 1WZNA 2W04A 2JA5I 3VMIA 1K8A2 2OTLZ 1ZB8A 4MH4A 1KQSZ 1TWGI 1AA6A 1WCMI 2P28A 3NDIA 2LIYA 1S72Z 4EWCA 4X6AI 2PM9A 5CM2M 1TWHI 1QXFA 1YJ9Z 2LEXA 3M3YI 3GTKI 3KIHA 2JIRA 3CCJZ 1YUAA 5IT9f 2VPZA 3FQMA 1K8A1 4A3II 3S2DI 3IR7A 1VQK1 4A3EI 3VB9A 4NB9A 3T4NB 2E7ZA 1Z01A 4MD7A 2QREB 3CCV1 4MXUA 2VUGA 1I3QI 2VPYA 2DE5A 1K732 2RPRA 2V8KA 2RIQA 1VLAA 2YU9I 3CC71 2JA6I 1I6HI 2P3YA 3BG1B
chains in the Genus database with same CATH topology
4RS4A 1RO4A 1X0TA 2JMOA 4E33A 1P9NA 3IFUA 1VQP1 2E2JI 3PO3S 3J80b 1N8R2 2VUMI 3CC4Z 3EERA 2V8JA 5C3EI 4E30A 2O53A 3CCVZ 3HOWI 3G711 4HGYA 4Y52I 4NFRA 3S17I 4E2ZA 3I4NI 4CL1A 3OW2Z 2NVXI 1YI2Z 3CCRZ 1Q861 1VQ41 5T6BA 5A2Qb 1YIJ1 2QA4Z 4A3KI 3NH5A 4BY1I 1X3ZA 3CME1 2HU9A 4MONA 1QVFY 2JS4A 1K9M2 3GCFA 1M1K2 3CXCZ 2JUBA 1WIIA 1Z03A 2E9HA 4NOZA 4TNUA 5IP9I 1TWCI 3CCM1 3PO2I 3RZOI 3TE5B 3FKII 2W03A 2F4MA 1Q822 1JWHC 3CCE1 4A93I 5A2Qf 2E2HI 5AN9F 3NH8A 3S1RI 1Q812 4NBGA 4RV9A 2EGTA 4NBBA 2WAQA 1Q7Y1 1RQFA 1VQNZ 4BXXI 1USPA 2NVTI 2QR1B 3S1MI 1YHQZ 1N8R1 1VQMZ 1M901 3HKZA 3VMHA 4NBHA 2JA8I 2KPIA 3HOYI 4NBDA 3LUSA 3HOXI 2R93I 3G6EZ 4AYBA 1VQ81 2DE7A 4A3JI 5T64A 4BBRI 2K5RA 2R7ZI 2ZAEB 4NBCA 3CCL1 1YITZ 3HOVI 1VQO1 3CMEZ 2OOYB 1KRLA 4NBEA 4BBSI 3JAMf 1Z02A 3S1NI 1YJWZ 4NB8A 2JA7I 4XX2A 2QEXZ 1YJN1 4Y7NI 3CMAZ 4HGZA 4A3BI 4A3MI 2QA41 4RVFA 4DK1A 1VQ8Z 2GTHA 2OOXB 3VTNA 2E2II 1VQ9Z 4A3CI 2Q51A 3OW2Y 1USPB 1LQLA 3I55Z 4S1TA 1QF8A 3GTLI 1Q821 3HOUI 1QVGY 3M4OI 3S1QI 1TFIA 2OTJ1 3CMA1 1YJNZ 3CCSZ 3CCUZ 3TDHB 1YUKA 3F3FC 3CCEZ 3D9XA 4A3LI 2VF1A 2I3CA 2KI7B 3CC7Z 1L1OC 2J6AA 3BG0B 3CQZI 1VQ6Z 3S14I 2RBLA 5C4XI 2IZ4A 3Q87A 3GTMS 3HOZI 3CCU1 1ZB9A 3NFZA 2RHBA 2G2KA 2LFUA 1VQOZ 1W2BY 1K9M1 1TWFI 3I56Z 2AKLA 4MRIA 2JNYA 3J7A4 1NP6A 1S7MA 5FLXf 3P5JB 1YIJZ 3RZDI 3S2HI 1K83I 1NJI1 3D6WA 4HH4A 5FLMI 1JJ2Y 1Q811 2F4OA 1YHQ1 2OTJZ 1KD11 1QYPA 5T67A 4A3GI 3GTMI 1VQ91 2M48A 3S15I 2YADA 3GKQA 5D1OB 5C44I 3QWUA 3MONA 1I50I 3G4SZ 3CCMZ 1DL6A 1QVFZ 3GTGI 3MZKB 1VQPZ 3MZLB 1SFOI 1R9TI 3CXCY 2QRCB 1YJW1 4BY7I 3U50C 5C4JI 1VQ61 3CD6Z 3CCJ1 1RNIA 3IX0A 1RO2A 1VQ51 3F3PC 3NH4A 3CC21 2PK7A 4MD9A 4DQYB 1N2FA 3CCR1 3VMGA 3CC41 3KIFA 3CCQZ 3G4S1 1Q7Y2 1K731 1VQL1 2OTL1 2V8IA 2JR6A 1Q862 2OZKA 3CCLZ 2QKDA 1VQN1 3GTJI 3I551 3I07A 4A3DI 1RO0A 1VQM1 5D1OA 1ZH1A 4NBAA 1ML8A 3GTPI 1M1K1 4A3FI 4MD8A 1VQ7Z 2NVQI 2M6NA 3CC2Z 1Y1VS 2PMZA 3I4MI 1W2BZ 3J81f 4E2YA 3CCQ1 2Q4ZA 1JJ2Z 1VQLZ 2IZ3A 1TWAI 2HF1A 1VQKZ 4NH1C 5LL6f 2BJOA 1PFTA 4E2XA 4E32A 5IT9b 1QVGZ 3FQQA 3EEDA 3H0GI 3GTOI 4NBFA 4RVGA 5D1PA 2QEX1 1VQ5Z 3IF8A 5IP7I 3ESWA 3JAMb 4RVHA 1KC82 5FLXb 2GU2A 3GTQI 1YI21 3I561 3G6E1 1VQ4Z 4E31A 2GTIA 3H3VJ 1M902 1RLYA 2H85A 2QLVB 4E2WA 2RT9A 1KC81 3S16I 1WW9A 3NDJA 1KQSY 1YIT1 1YJ91 2WB1A 1NUIA 4QTTA 1Y1WI 2Y0SA 3CD61 1KD12 3PO3I 1Y1VI 3J81b 2NVYI 1S721 2O4HA 2QRDB 1X3WA 3CCS1 2K3RA 4RVDA 3CPWY 2DE6A 3G71Z 4DGLA 3J80f 1NJI2 3K7AI 3CPWZ 1VQ71 4QTUA 2R92I 2B63I 2R6MA 2W04A 2JA5I 3VMIA 1K8A2 2OTLZ 1ZB8A 4MH4A 1KQSZ 1TWGI 1WCMI 2P28A 3NDIA 2LIYA 1S72Z 4EWCA 4X6AI 2PM9A 5CM2M 1TWHI 1YJ9Z 3M3YI 3GTKI 3KIHA 3CCJZ 1YUAA 5IT9f 3FQMA 1K8A1 4A3II 3S2DI 1VQK1 4A3EI 3VB9A 4NB9A 3T4NB 1Z01A 4MD7A 2QREB 3CCV1 4MXUA 2VUGA 1I3QI 2DE5A 1K732 2RPRA 2V8KA 2RIQA 1VLAA 2YU9I 3CC71 2JA6I 1I6HI 2P3YA 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 1;  3I56 1;  1JJ2 Y;  1Q81 1;  1VQP 1;  3G6E 1;  1VQ4 Z;  1YHQ 1;  1N8R 2;  1YJW Z;  2OTJ Z;  1KD1 1;  3CC4 Z;  1M90 2;  1VQ9 1;  2QEX Z;  1YJN 1;  3CMA Z;  1KC8 1;  3CCV Z;  1KQS Y;  1YIT 1;  3G71 1;  2QA4 1;  3G4S Z;  3CCM Z;  1YJ9 1;  1VQ8 Z;  1QVF Z;  3CD6 1;  1KD1 2;  1VQP Z;  1S72 1;  1VQ9 Z;  3OW2 Z;  3CXC Y;  1YJW 1;  1YI2 Z;  3CCR Z;  3CCS 1;  1Q86 1;  1VQ4 1;  3OW2 Y;  3CPW Y;  1VQ6 1;  3CD6 Z;  1YIJ 1;  3G71 Z;  3CCJ 1;  2QA4 Z;  3I55 Z;  1NJI 2;  1VQ7 1;  3CPW Z;  1Q82 1;  3CME 1;  1VQ5 1;  1QVG Y;  1QVF Y;  1K8A 2;  2OTL Z;  2OTJ 1;  3CC2 1;  3CMA 1;  1KQS Z;  1K9M 2;  1YJN Z;  3CCR 1;  3CCS Z;  3CCU Z;  1M1K 2;  3CC4 1;  3CXC Z;  1S72 Z;  3CCE Z;  3CCQ Z;  1YJ9 Z;  3G4S 1;  1Q7Y 2;  1K73 1;  1VQL 1;  2OTL 1;  1Q86 2;  3CCL Z;  3CCM 1;  3CC7 Z;  1VQN 1;  3I55 1;  3CCJ Z;  1VQ6 Z;  1Q82 2;  3CCE 1;  1K8A 1;  1VQM 1;  1Q81 2;  3CCU 1;  1M1K 1;  1VQK 1;  1VQ7 Z;  3CC2 Z;  1Q7Y 1;  1VQN Z;  1W2B Z;  1VQO Z;  3CCQ 1;  1W2B Y;  3CCV 1;  1JJ2 Z;  1VQL Z;  1K9M 1;  1YHQ Z;  1N8R 1;  1VQM Z;  3I56 Z;  1VQK Z;  1M90 1;  3G6E Z;  1K73 2;  1VQ8 1;  1QVG Z;  3CCL 1;  1YIJ Z;  1YIT Z;  3CC7 1;  1VQO 1;  3CME Z;  1NJI 1;  2QEX 1;  1VQ5 Z;  1KC8 2; 
#chains in the Genus database with same CATH topology
 4RS4 A;  1RO4 A;  1X0T A;  2JMO A;  4E33 A;  1P9N A;  3IFU A;  1VQP 1;  2E2J I;  3PO3 S;  3J80 b;  1N8R 2;  2VUM I;  3CC4 Z;  3EER A;  2V8J A;  5C3E I;  4E30 A;  2O53 A;  3CCV Z;  3HOW I;  3G71 1;  4HGY A;  4Y52 I;  4NFR A;  3S17 I;  4E2Z A;  3I4N I;  4CL1 A;  3OW2 Z;  2NVX I;  1YI2 Z;  3CCR Z;  1Q86 1;  1VQ4 1;  5T6B A;  5A2Q b;  1YIJ 1;  2QA4 Z;  4A3K I;  3NH5 A;  4BY1 I;  1X3Z A;  3CME 1;  2HU9 A;  4MON A;  1QVF Y;  2JS4 A;  1K9M 2;  3GCF A;  1M1K 2;  3CXC Z;  2JUB A;  1WII A;  1Z03 A;  2E9H A;  4NOZ A;  4TNU A;  5IP9 I;  1TWC I;  3CCM 1;  3PO2 I;  3RZO I;  3TE5 B;  3FKI I;  2W03 A;  2F4M A;  1Q82 2;  1JWH C;  3CCE 1;  4A93 I;  5A2Q f;  2E2H I;  5AN9 F;  3NH8 A;  3S1R I;  1Q81 2;  4NBG A;  4RV9 A;  2V3V A;  2EGT A;  2V45 A;  4NBB A;  2WAQ A;  1Q7Y 1;  1RQF A;  1VQN Z;  4BXX I;  1USP A;  2NVT I;  2QR1 B;  3S1M I;  1YHQ Z;  1N8R 1;  1VQM Z;  1M90 1;  3HKZ A;  3VMH A;  4NBH A;  2JA8 I;  2KPI A;  3HOY I;  4NBD A;  3LUS A;  3HOX I;  2R93 I;  3G6E Z;  4AYB A;  1VQ8 1;  2DE7 A;  4A3J I;  5T64 A;  4BBR I;  2K5R A;  2R7Z I;  2ZAE B;  4NBC A;  3CCL 1;  1YIT Z;  3HOV I;  1VQO 1;  3CME Z;  2OOY B;  1KRL A;  4NBE A;  1FDI A;  4BBS I;  3JAM f;  1Z02 A;  3S1N I;  1YJW Z;  4NB8 A;  2JA7 I;  4XX2 A;  2QEX Z;  1YJN 1;  4Y7N I;  3CMA Z;  4HGZ A;  4A3B I;  4A3M I;  2QA4 1;  4RVF A;  4DK1 A;  1VQ8 Z;  2GTH A;  2OOX B;  3VTN A;  2E2I I;  2JIM A;  1VQ9 Z;  4A3C I;  2Q51 A;  3OW2 Y;  1USP B;  1LQL A;  3I55 Z;  4S1T A;  1QF8 A;  3GTL I;  1Q82 1;  3HOU I;  1Q16 A;  1QVG Y;  3M4O I;  3S1Q I;  1TFI A;  2OTJ 1;  3CMA 1;  1YJN Z;  3CCS Z;  3CCU Z;  3TDH B;  1YUK A;  3F3F C;  3CCE Z;  3D9X A;  4A3L I;  2VF1 A;  2I3C A;  2KI7 B;  3CC7 Z;  1L1O C;  2JIP A;  2J6A A;  3BG0 B;  3CQZ I;  1VQ6 Z;  3S14 I;  2RBL A;  5C4X I;  2IZ4 A;  3Q87 A;  3GTM S;  3HOZ I;  3CCU 1;  1ZB9 A;  3NFZ A;  2RHB A;  2G2K A;  2LFU A;  1VQO Z;  1W2B Y;  1K9M 1;  1TWF I;  3I56 Z;  2AKL A;  4MRI A;  2IV2 X;  2JNY A;  3J7A 4;  1NP6 A;  2AYD A;  2VPX A;  1S7M A;  5FLX f;  3P5J B;  1YIJ Z;  3RZD I;  3S2H I;  1K83 I;  1NJI 1;  3D6W A;  4HH4 A;  1Y8C A;  5FLM I;  1JJ2 Y;  1Q81 1;  2F4O A;  1YHQ 1;  2OTJ Z;  1KD1 1;  1QYP A;  5T67 A;  4A3G I;  3GTM I;  1VQ9 1;  2M48 A;  3S15 I;  2YAD A;  3GKQ A;  5D1O B;  5C44 I;  3QWU A;  3MON A;  1I50 I;  3G4S Z;  3CCM Z;  1DL6 A;  1QVF Z;  3GTG I;  3MZK B;  1VQP Z;  1SIW A;  3MZL B;  1SFO I;  1R9T I;  3CXC Y;  2QRC B;  1YJW 1;  4BY7 I;  3U50 C;  5C4J I;  1VQ6 1;  3CD6 Z;  3CCJ 1;  1RNI A;  3IX0 A;  1RO2 A;  1VQ5 1;  3F3P C;  3NH4 A;  3CC2 1;  2PK7 A;  4MD9 A;  4DQY B;  1N2F A;  3CCR 1;  2JIO A;  3VMG A;  3CC4 1;  3KIF A;  3CCQ Z;  3G4S 1;  1Q7Y 2;  1K73 1;  1VQL 1;  2OTL 1;  2V8I A;  2JR6 A;  1Q86 2;  2OZK A;  3CCL Z;  2QKD A;  1VQN 1;  3GTJ I;  3I55 1;  3I07 A;  4A3D I;  2NAP A;  1RO0 A;  1VQM 1;  5D1O A;  1ZH1 A;  4NBA A;  1ML8 A;  3GTP I;  1M1K 1;  4A3F I;  4MD8 A;  1VQ7 Z;  2NVQ I;  2M6N A;  3CC2 Z;  1Y1V S;  2PMZ A;  3I4M I;  1W2B Z;  3J81 f;  4E2Y A;  3CCQ 1;  2Q4Z A;  1JJ2 Z;  1VQL Z;  2IZ3 A;  1TWA I;  2HF1 A;  1VQK Z;  4NH1 C;  5LL6 f;  2BJO A;  1PFT A;  4E2X A;  4E32 A;  5IT9 b;  1QVG Z;  3FQQ A;  3EED A;  3H0G I;  3D2L A;  3GTO I;  4NBF A;  4RVG A;  5D1P A;  1WJ2 A;  2QEX 1;  1VQ5 Z;  3IF8 A;  5IP7 I;  3ESW A;  3JAM b;  4RVH A;  1KC8 2;  5FLX b;  2GU2 A;  3GTQ I;  1YI2 1;  3I56 1;  3G6E 1;  1VQ4 Z;  1FDO A;  4E31 A;  2GTI A;  3H3V J;  1M90 2;  1RLY A;  2H85 A;  2QLV B;  4E2W A;  2RT9 A;  1KC8 1;  3S16 I;  1WW9 A;  3NDJ A;  1KQS Y;  1YIT 1;  1YJ9 1;  2WB1 A;  1NUI A;  4QTT A;  1Y1W I;  2Y0S A;  3CD6 1;  1KD1 2;  3PO3 I;  1Y1V I;  3J81 b;  2NVY I;  1S72 1;  2O4H A;  2QRD B;  2JIQ A;  1X3W A;  3CCS 1;  2K3R A;  4RVD A;  3CPW Y;  2DE6 A;  3G71 Z;  4DGL A;  3J80 f;  1NJI 2;  3K7A I;  3CPW Z;  1VQ7 1;  4QTU A;  2R92 I;  2B63 I;  2VPW A;  2R6M A;  1WZN A;  2W04 A;  2JA5 I;  3VMI A;  1K8A 2;  2OTL Z;  1ZB8 A;  4MH4 A;  1KQS Z;  1TWG I;  1AA6 A;  1WCM I;  2P28 A;  3NDI A;  2LIY A;  1S72 Z;  4EWC A;  4X6A I;  2PM9 A;  5CM2 M;  1TWH I;  1QXF A;  1YJ9 Z;  2LEX A;  3M3Y I;  3GTK I;  3KIH A;  2JIR A;  3CCJ Z;  1YUA A;  5IT9 f;  2VPZ A;  3FQM A;  1K8A 1;  4A3I I;  3S2D I;  3IR7 A;  1VQK 1;  4A3E I;  3VB9 A;  4NB9 A;  3T4N B;  2E7Z A;  1Z01 A;  4MD7 A;  2QRE B;  3CCV 1;  4MXU A;  2VUG A;  1I3Q I;  2VPY A;  2DE5 A;  1K73 2;  2RPR A;  2V8K A;  2RIQ A;  1VLA A;  2YU9 I;  3CC7 1;  2JA6 I;  1I6H I;  2P3Y A;  3BG1 B; 
#chains in the Genus database with same CATH homology
 4RS4 A;  1RO4 A;  1X0T A;  2JMO A;  4E33 A;  1P9N A;  3IFU A;  1VQP 1;  2E2J I;  3PO3 S;  3J80 b;  1N8R 2;  2VUM I;  3CC4 Z;  3EER A;  2V8J A;  5C3E I;  4E30 A;  2O53 A;  3CCV Z;  3HOW I;  3G71 1;  4HGY A;  4Y52 I;  4NFR A;  3S17 I;  4E2Z A;  3I4N I;  4CL1 A;  3OW2 Z;  2NVX I;  1YI2 Z;  3CCR Z;  1Q86 1;  1VQ4 1;  5T6B A;  5A2Q b;  1YIJ 1;  2QA4 Z;  4A3K I;  3NH5 A;  4BY1 I;  1X3Z A;  3CME 1;  2HU9 A;  4MON A;  1QVF Y;  2JS4 A;  1K9M 2;  3GCF A;  1M1K 2;  3CXC Z;  2JUB A;  1WII A;  1Z03 A;  2E9H A;  4NOZ A;  4TNU A;  5IP9 I;  1TWC I;  3CCM 1;  3PO2 I;  3RZO I;  3TE5 B;  3FKI I;  2W03 A;  2F4M A;  1Q82 2;  1JWH C;  3CCE 1;  4A93 I;  5A2Q f;  2E2H I;  5AN9 F;  3NH8 A;  3S1R I;  1Q81 2;  4NBG A;  4RV9 A;  2EGT A;  4NBB A;  2WAQ A;  1Q7Y 1;  1RQF A;  1VQN Z;  4BXX I;  1USP A;  2NVT I;  2QR1 B;  3S1M I;  1YHQ Z;  1N8R 1;  1VQM Z;  1M90 1;  3HKZ A;  3VMH A;  4NBH A;  2JA8 I;  2KPI A;  3HOY I;  4NBD A;  3LUS A;  3HOX I;  2R93 I;  3G6E Z;  4AYB A;  1VQ8 1;  2DE7 A;  4A3J I;  5T64 A;  4BBR I;  2K5R A;  2R7Z I;  2ZAE B;  4NBC A;  3CCL 1;  1YIT Z;  3HOV I;  1VQO 1;  3CME Z;  2OOY B;  1KRL A;  4NBE A;  4BBS I;  3JAM f;  1Z02 A;  3S1N I;  1YJW Z;  4NB8 A;  2JA7 I;  4XX2 A;  2QEX Z;  1YJN 1;  4Y7N I;  3CMA Z;  4HGZ A;  4A3B I;  4A3M I;  2QA4 1;  4RVF A;  4DK1 A;  1VQ8 Z;  2GTH A;  2OOX B;  3VTN A;  2E2I I;  1VQ9 Z;  4A3C I;  2Q51 A;  3OW2 Y;  1USP B;  1LQL A;  3I55 Z;  4S1T A;  1QF8 A;  3GTL I;  1Q82 1;  3HOU I;  1QVG Y;  3M4O I;  3S1Q I;  1TFI A;  2OTJ 1;  3CMA 1;  1YJN Z;  3CCS Z;  3CCU Z;  3TDH B;  1YUK A;  3F3F C;  3CCE Z;  3D9X A;  4A3L I;  2VF1 A;  2I3C A;  2KI7 B;  3CC7 Z;  1L1O C;  2J6A A;  3BG0 B;  3CQZ I;  1VQ6 Z;  3S14 I;  2RBL A;  5C4X I;  2IZ4 A;  3Q87 A;  3GTM S;  3HOZ I;  3CCU 1;  1ZB9 A;  3NFZ A;  2RHB A;  2G2K A;  2LFU A;  1VQO Z;  1W2B Y;  1K9M 1;  1TWF I;  3I56 Z;  2AKL A;  4MRI A;  2JNY A;  3J7A 4;  1NP6 A;  1S7M A;  5FLX f;  3P5J B;  1YIJ Z;  3RZD I;  3S2H I;  1K83 I;  1NJI 1;  3D6W A;  4HH4 A;  5FLM I;  1JJ2 Y;  1Q81 1;  2F4O A;  1YHQ 1;  2OTJ Z;  1KD1 1;  1QYP A;  5T67 A;  4A3G I;  3GTM I;  1VQ9 1;  2M48 A;  3S15 I;  2YAD A;  3GKQ A;  5D1O B;  5C44 I;  3QWU A;  3MON A;  1I50 I;  3G4S Z;  3CCM Z;  1DL6 A;  1QVF Z;  3GTG I;  3MZK B;  1VQP Z;  3MZL B;  1SFO I;  1R9T I;  3CXC Y;  2QRC B;  1YJW 1;  4BY7 I;  3U50 C;  5C4J I;  1VQ6 1;  3CD6 Z;  3CCJ 1;  1RNI A;  3IX0 A;  1RO2 A;  1VQ5 1;  3F3P C;  3NH4 A;  3CC2 1;  2PK7 A;  4MD9 A;  4DQY B;  1N2F A;  3CCR 1;  3VMG A;  3CC4 1;  3KIF A;  3CCQ Z;  3G4S 1;  1Q7Y 2;  1K73 1;  1VQL 1;  2OTL 1;  2V8I A;  2JR6 A;  1Q86 2;  2OZK A;  3CCL Z;  2QKD A;  1VQN 1;  3GTJ I;  3I55 1;  3I07 A;  4A3D I;  1RO0 A;  1VQM 1;  5D1O A;  1ZH1 A;  4NBA A;  1ML8 A;  3GTP I;  1M1K 1;  4A3F I;  4MD8 A;  1VQ7 Z;  2NVQ I;  2M6N A;  3CC2 Z;  1Y1V S;  2PMZ A;  3I4M I;  1W2B Z;  3J81 f;  4E2Y A;  3CCQ 1;  2Q4Z A;  1JJ2 Z;  1VQL Z;  2IZ3 A;  1TWA I;  2HF1 A;  1VQK Z;  4NH1 C;  5LL6 f;  2BJO A;  1PFT A;  4E2X A;  4E32 A;  5IT9 b;  1QVG Z;  3FQQ A;  3EED A;  3H0G I;  3GTO I;  4NBF A;  4RVG A;  5D1P A;  2QEX 1;  1VQ5 Z;  3IF8 A;  5IP7 I;  3ESW A;  3JAM b;  4RVH A;  1KC8 2;  5FLX b;  2GU2 A;  3GTQ I;  1YI2 1;  3I56 1;  3G6E 1;  1VQ4 Z;  4E31 A;  2GTI A;  3H3V J;  1M90 2;  1RLY A;  2H85 A;  2QLV B;  4E2W A;  2RT9 A;  1KC8 1;  3S16 I;  1WW9 A;  3NDJ A;  1KQS Y;  1YIT 1;  1YJ9 1;  2WB1 A;  1NUI A;  4QTT A;  1Y1W I;  2Y0S A;  3CD6 1;  1KD1 2;  3PO3 I;  1Y1V I;  3J81 b;  2NVY I;  1S72 1;  2O4H A;  2QRD B;  1X3W A;  3CCS 1;  2K3R A;  4RVD A;  3CPW Y;  2DE6 A;  3G71 Z;  4DGL A;  3J80 f;  1NJI 2;  3K7A I;  3CPW Z;  1VQ7 1;  4QTU A;  2R92 I;  2B63 I;  2R6M A;  2W04 A;  2JA5 I;  3VMI A;  1K8A 2;  2OTL Z;  1ZB8 A;  4MH4 A;  1KQS Z;  1TWG I;  1WCM I;  2P28 A;  3NDI A;  2LIY A;  1S72 Z;  4EWC A;  4X6A I;  2PM9 A;  5CM2 M;  1TWH I;  1YJ9 Z;  3M3Y I;  3GTK I;  3KIH A;  3CCJ Z;  1YUA A;  5IT9 f;  3FQM A;  1K8A 1;  4A3I I;  3S2D I;  1VQK 1;  4A3E I;  3VB9 A;  4NB9 A;  3T4N B;  1Z01 A;  4MD7 A;  2QRE B;  3CCV 1;  4MXU A;  2VUG A;  1I3Q I;  2DE5 A;  1K73 2;  2RPR A;  2V8K A;  2RIQ A;  1VLA A;  2YU9 I;  3CC7 1;  2JA6 I;  1I6H I;  2P3Y A;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...