3CC41

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc4100
1YHQ1 1YJN1 1W2BZ 3CC21 1VQ7Z 2QA41 3G4SZ 1VQ41 3CC41 1YHQZ 1VQ8Z 1YJNZ 3CME1 1K732 1NJI2 3CCJ1 1VQO1 3I551 1VQ61 1M1K2 1JJ2Y 1Q861 1VQ4Z 1KC82 3CCRZ 1VQN1 3CC4Z 2QEX1 3CMEZ 3CCJZ 3CMA1 1VQOZ 3I55Z 3CCM1 1YJ91 1Q822 1VQNZ 1N8R2 3CC71 1KQSZ 1YJWZ 3CXCZ 2QEXZ 1VQP1 3CMAZ 1YJ9Z 1Q7Y2 1YIT1 3CC7Z 3G711 1VQPZ 3OW2Z 1VQK1 1YITZ 3I561 1VQ91 3CC2Z 2QA4Z 1Q812 1K9M2 1VQKZ 1K731 1NJI1 3I56Z 1M902 1VQL1 1VQ9Z 1KC81 1VQ6Z 1KD12 1QVFY 1VQLZ 1KQSY 1YIJ1 1Q821 3CCMZ 1N8R1 1K8A2 3CPWY 1QVGZ 1YIJZ 1Q7Y1 3OW2Y 1W2BY 3G71Z 3CCS1 1YI21 1S721 1Q811 1K9M1 1M1K1 3CCE1 3CCL1 3CCV1 3G4S1 3CCSZ 1YI2Z 2OTL1 1S72Z 1VQ81 3CCU1 1KD11 3CCEZ 3CCLZ 3CCVZ 3CXCY 2OTJ1 2OTLZ 3CCR1 1VQM1 3CCUZ 1Q862 1K8A1 1JJ2Z 3CCQ1 2OTJZ 1QVGY 3CD61 1VQMZ 1VQ51 1YJW1 1QVFZ 3CCQZ 3G6E1 3CD6Z 1VQ5Z 3CPWZ 1VQ71 3G6EZ 1M901
chains in the Genus database with same CATH superfamily
1YUAA 4BY1I 3HOYI 5T6BA 2QA41 2Q4ZA 2P3YA 3D9XA 3Q87A 4A3JI 1YHQZ 3S16I 4BY7I 3CME1 1K732 1VQO1 3I551 1KRLA 3IF8A 1JJ2Y 4NFRA 3CCRZ 1VQN1 1FDOA 4MD8A 2QEX1 3CCJZ 2F4MA 1YJ91 2I3CA 3CXCZ 1VQP1 3CMAZ 2QRDB 2RPRA 1YIT1 3G711 3ESWA 5IT9f 3EERA 1VQK1 3F3FC 2M6NA 3PO3I 2R7ZI 1Q16A 1NP6A 1WCMI 3CC2Z 4E33A 2B63I 1ZB9A 3QWUA 3LUSA 5FLMI 3RZOI 2E2II 2P28A 1NJI1 2WB1A 5C3EI 5IT9b 4EWCA 4E32A 1VQ9Z 1KC81 3HOUI 3S15I 1KD12 5D1PA 4E2XA 3GTJI 1VQLZ 1YIJ1 1K8A2 3CPWY 3S14I 3I07A 3U50C 3I4NI 4X6AI 2R93I 2QRCB 2JIQA 3VMGA 2NVQI 3CCS1 4QTUA 3HOXI 4RVDA 1Q811 2PM9A 3CCE1 3CCV1 2H85A 4A3FI 3G4S1 4E2WA 1S72Z 3GTGI 3GTMI 1VQ81 3CCU1 3GCFA 5LL6f 2LEXA 2E2JI 3VMHA 2OOYB 2V8KA 3NDIA 2JA5I 3CCQ1 2R6MA 3VMIA 2ZAEB 1YJW1 4Y52I 1P9NA 3CD6Z 1R9TI 2VUMI 2G2KA 2V3VA 1VQ71 3G6EZ 4NB9A 4A3BI 1W2BZ 2DE7A 2PK7A 5C44I 1VQ41 3VB9A 2VF1A 1NJI2 1VQ61 1M1K2 1KC82 3PO2I 4A3GI 1Z02A 3CMEZ 2VPWA 5CM2M 4MXUA 3I55Z 1VQOZ 3HOZI 4NOZA 1Y1VS 2GTIA 1VQNZ 1X0TA 1KQSZ 2JUBA 2QEXZ 1K83I 3GTOI 2RBLA 2VPZA 1I3QI 1YJ9Z 5C4JI 2QR1B 3OW2Z 1VQPZ 3CQZI 1YITZ 3F3PC 3NDJA 4NBEA 3MZKB 1Q812 1VQKZ 1QYPA 4MD7A 1TWHI 1M902 2NVYI 2K5RA 4E2YA 3D6WA 2NAPA 1Q821 3CCMZ 4Y7NI 1N8R1 4NBFA 4A3II 1QF8A 2JA8I 1RO4A 5FLXf 4DQYB 1QVGZ 1PFTA 1YIJZ 2WAQA 1Q7Y1 2IZ3A 4RVFA 3IR7A 1LQLA 3S2HI 4E30A 3FQMA 1ZB8A 4A3LI 1YI21 2DE6A 3J7A4 5FLXb 1N2FA 4DGLA 2J6AA 2PMZA 1FDIA 1K9M1 2R92I 1M1K1 4E2ZA 3CCL1 3S1MI 1Y1WI 3CCSZ 2OTL1 3GTKI 1JWHC 2AKLA 2V8JA 4AYBA 3CCEZ 3CCVZ 2IZ4A 3HKZA 2OTJ1 3J81f 3CCR1 1DL6A 1I6HI 5D1OB 3CCUZ 1NUIA 4BBRI 4NH1C 2EGTA 1VQ51 3J81b 3D2LA 3CCQZ 2LFUA 2V45A 2K3RA 3CPWZ 4MH4A 3S2DI 1M901 1YUKA 2E2HI 1YJN1 3EEDA 3KIFA 3CC21 1VQ7Z 4NBHA 4RVGA 2V8IA 2RHBA 3CC41 3GKQA 1ML8A 3MONA 4RS4A 1Q861 1VQ4Z 4A3CI 3S17I 1QXFA 1VLAA 5IP9I 1Q822 1N8R2 3CC71 4BBSI 2NVTI 5AN9F 1L1OC 2BJOA 1Q7Y2 3BG1B 2Y0SA 2QLVB 2DE5A 1WJ2A 3GTLI 3S1RI 3I561 1SFOI 3PO3S 2O53A 2QA4Z 1K9M2 3FKII 3HOWI 2JIRA 1TWAI 1QVFY 2JR6A 1KQSY 1SIWA 3NH5A 2OOXB 2HU9A 1X3ZA 3OW2Y 1RQFA 3G71Z 3H3VJ 4A3MI 2JA6I 1Z01A 1TWFI 4NBAA 3NH8A 1YI2Z 3J80f 1S7MA 1TFIA 3GTMS 3CCLZ 3CXCY 2OTLZ 4XX2A 1VQM1 2RT9A 1Q862 2VUGA 4CL1A 2VPYA 3J80b 2JIMA 1JJ2Z 2OTJZ 1RLYA 1QVGY 3IFUA 3P5JB 3IX0A 2JS4A 2IV2X 4A93I 3KIHA 3K7AI 3GTPI 4DK1A 1VQ5Z 1Z03A 4MRIA 4E31A 2OZKA 3NFZA 1YHQ1 2E9HA 2LIYA 3GTQI 3G4SZ 1VQ8Z 4NBGA 1YJNZ 3CCJ1 2GU2A 2YADA 4MD9A 3CC4Z 2JA7I 3CMA1 3CCM1 1Y1VI 4RVHA 2GTHA 5D1OA 1YJWZ 3H0GI 1RO2A 3CC7Z 2JIOA 4BXXI 2KPIA 4A3EI 1AA6A 1TWGI 1Y8CA 4RV9A 1VQ91 2Q51A 1K731 1WIIA 2JIPA 3I56Z 1VQL1 3NH4A 1USPB 1TWCI 2RIQA 1VQ6Z 3HOVI 2NVXI 3S1NI 3S1QI 4QTTA 2AYDA 4A3KI 1ZH1A 2VPXA 2W04A 5T64A 2W03A 2JMOA 1USPA 5T67A 1W2BY 3TDHB 4TNUA 3M3YI 2QKDA 4NBBA 2YU9I 3M4OI 4NB8A 1RO0A 1S721 2E7ZA 4NBDA 4HH4A 3MZLB 1WW9A 1KD11 3VTNA 3BG0B 5C4XI 4HGZA 3I4MI 3RZDI 5A2Qf 3JAMf 5IP7I 1K8A1 1I50I 4A3DI 1RNIA 2KI7B 3CD61 3FQQA 1VQMZ 2HF1A 4MONA 4NBCA 4HGYA 5A2Qb 2JNYA 2M48A 3JAMb 1QVFZ 4S1TA 3T4NB 3G6E1 3TE5B 2F4OA 2O4HA 1X3WA 1WZNA 2QREB
chains in the Genus database with same CATH topology
1YUAA 4BY1I 3HOYI 5T6BA 2QA41 2Q4ZA 2P3YA 3D9XA 3Q87A 4A3JI 1YHQZ 3S16I 4BY7I 3CME1 1K732 1VQO1 3I551 1KRLA 3IF8A 1JJ2Y 4NFRA 3CCRZ 1VQN1 4MD8A 2QEX1 3CCJZ 2F4MA 1YJ91 2I3CA 3CXCZ 1VQP1 3CMAZ 2QRDB 2RPRA 1YIT1 3G711 3ESWA 5IT9f 3EERA 1VQK1 3F3FC 2M6NA 3PO3I 2R7ZI 1NP6A 1WCMI 3CC2Z 4E33A 2B63I 1ZB9A 3QWUA 3LUSA 5FLMI 3RZOI 2E2II 2P28A 1NJI1 2WB1A 5C3EI 5IT9b 4EWCA 4E32A 1VQ9Z 1KC81 3HOUI 3S15I 1KD12 5D1PA 4E2XA 3GTJI 1VQLZ 1YIJ1 1K8A2 3CPWY 3S14I 3I07A 3U50C 3I4NI 4X6AI 2R93I 2QRCB 3VMGA 2NVQI 3CCS1 4QTUA 3HOXI 4RVDA 1Q811 2PM9A 3CCE1 3CCV1 2H85A 4A3FI 3G4S1 4E2WA 1S72Z 3GTGI 3GTMI 1VQ81 3CCU1 3GCFA 5LL6f 2E2JI 3VMHA 2OOYB 2V8KA 3NDIA 2JA5I 3CCQ1 2R6MA 3VMIA 2ZAEB 1YJW1 4Y52I 1P9NA 3CD6Z 1R9TI 2VUMI 2G2KA 1VQ71 3G6EZ 4NB9A 4A3BI 1W2BZ 2DE7A 2PK7A 5C44I 1VQ41 3VB9A 2VF1A 1NJI2 1VQ61 1M1K2 1KC82 3PO2I 4A3GI 1Z02A 3CMEZ 5CM2M 4MXUA 3I55Z 1VQOZ 3HOZI 4NOZA 1Y1VS 2GTIA 1VQNZ 1X0TA 1KQSZ 2JUBA 2QEXZ 1K83I 3GTOI 2RBLA 1I3QI 1YJ9Z 5C4JI 2QR1B 3OW2Z 1VQPZ 3CQZI 1YITZ 3F3PC 3NDJA 4NBEA 3MZKB 1Q812 1VQKZ 1QYPA 4MD7A 1TWHI 1M902 2NVYI 2K5RA 4E2YA 3D6WA 1Q821 3CCMZ 4Y7NI 1N8R1 4NBFA 4A3II 1QF8A 2JA8I 1RO4A 5FLXf 4DQYB 1QVGZ 1PFTA 1YIJZ 2WAQA 1Q7Y1 2IZ3A 4RVFA 1LQLA 3S2HI 4E30A 3FQMA 1ZB8A 4A3LI 1YI21 2DE6A 3J7A4 5FLXb 1N2FA 4DGLA 2J6AA 2PMZA 2R92I 1K9M1 1M1K1 4E2ZA 3CCL1 3S1MI 1Y1WI 3CCSZ 2OTL1 3GTKI 1JWHC 2AKLA 2V8JA 4AYBA 3CCEZ 3CCVZ 2IZ4A 3HKZA 2OTJ1 3J81f 3CCR1 1DL6A 1I6HI 5D1OB 3CCUZ 1NUIA 4BBRI 4NH1C 2EGTA 1VQ51 3J81b 3CCQZ 2LFUA 2K3RA 3CPWZ 4MH4A 3S2DI 1M901 1YUKA 2E2HI 1YJN1 3EEDA 3KIFA 3CC21 1VQ7Z 4NBHA 4RVGA 2V8IA 2RHBA 3CC41 3GKQA 1ML8A 3MONA 4RS4A 1Q861 1VQ4Z 4A3CI 3S17I 1VLAA 5IP9I 1Q822 1N8R2 3CC71 4BBSI 2NVTI 5AN9F 1L1OC 2BJOA 1Q7Y2 3BG1B 2Y0SA 2QLVB 2DE5A 3GTLI 3S1RI 3I561 1SFOI 3PO3S 2O53A 2QA4Z 1K9M2 3FKII 3HOWI 1TWAI 1QVFY 2JR6A 1KQSY 3NH5A 2OOXB 2HU9A 1X3ZA 3OW2Y 1RQFA 3G71Z 3H3VJ 4A3MI 2JA6I 1Z01A 1TWFI 4NBAA 3NH8A 1YI2Z 3J80f 1S7MA 1TFIA 3GTMS 3CCLZ 3CXCY 2OTLZ 4XX2A 1VQM1 2RT9A 1Q862 2VUGA 4CL1A 3J80b 1JJ2Z 2OTJZ 1RLYA 1QVGY 3IFUA 3P5JB 3IX0A 2JS4A 4A93I 3KIHA 3K7AI 3GTPI 4DK1A 1VQ5Z 1Z03A 4MRIA 4E31A 2OZKA 3NFZA 1YHQ1 2E9HA 2LIYA 3GTQI 3G4SZ 1VQ8Z 4NBGA 1YJNZ 3CCJ1 2GU2A 2YADA 4MD9A 3CC4Z 2JA7I 3CMA1 3CCM1 1Y1VI 4RVHA 2GTHA 5D1OA 1YJWZ 3H0GI 1RO2A 3CC7Z 4BXXI 2KPIA 4A3EI 1TWGI 4RV9A 1VQ91 2Q51A 1K731 1WIIA 3I56Z 1VQL1 3NH4A 1USPB 1TWCI 2RIQA 1VQ6Z 3HOVI 2NVXI 3S1NI 3S1QI 4QTTA 4A3KI 1ZH1A 2W04A 5T64A 2W03A 2JMOA 1USPA 5T67A 1W2BY 3TDHB 4TNUA 3M3YI 2QKDA 4NBBA 2YU9I 3M4OI 4NB8A 1RO0A 1S721 4NBDA 4HH4A 3MZLB 1WW9A 1KD11 3VTNA 3BG0B 5C4XI 4HGZA 3I4MI 3RZDI 5A2Qf 3JAMf 5IP7I 1K8A1 1I50I 4A3DI 1RNIA 2KI7B 3CD61 3FQQA 1VQMZ 2HF1A 4MONA 4NBCA 4HGYA 5A2Qb 2JNYA 2M48A 3JAMb 1QVFZ 4S1TA 3T4NB 3G6E1 3TE5B 2F4OA 2O4HA 1X3WA 2QREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ 1;  1YJN 1;  1W2B Z;  3CC2 1;  1VQ7 Z;  2QA4 1;  3G4S Z;  1VQ4 1;  3CC4 1;  1YHQ Z;  1VQ8 Z;  1YJN Z;  3CME 1;  1K73 2;  1NJI 2;  3CCJ 1;  1VQO 1;  3I55 1;  1VQ6 1;  1M1K 2;  1JJ2 Y;  1Q86 1;  1VQ4 Z;  1KC8 2;  3CCR Z;  1VQN 1;  3CC4 Z;  2QEX 1;  3CME Z;  3CCJ Z;  3CMA 1;  1VQO Z;  3I55 Z;  3CCM 1;  1YJ9 1;  1Q82 2;  1VQN Z;  1N8R 2;  3CC7 1;  1KQS Z;  1YJW Z;  3CXC Z;  2QEX Z;  1VQP 1;  3CMA Z;  1YJ9 Z;  1Q7Y 2;  1YIT 1;  3CC7 Z;  3G71 1;  1VQP Z;  3OW2 Z;  1VQK 1;  1YIT Z;  3I56 1;  1VQ9 1;  3CC2 Z;  2QA4 Z;  1Q81 2;  1K9M 2;  1VQK Z;  1K73 1;  1NJI 1;  3I56 Z;  1M90 2;  1VQL 1;  1VQ9 Z;  1KC8 1;  1VQ6 Z;  1KD1 2;  1QVF Y;  1VQL Z;  1KQS Y;  1YIJ 1;  1Q82 1;  3CCM Z;  1N8R 1;  1K8A 2;  3CPW Y;  1QVG Z;  1YIJ Z;  1Q7Y 1;  3OW2 Y;  1W2B Y;  3G71 Z;  3CCS 1;  1YI2 1;  1S72 1;  1Q81 1;  1K9M 1;  1M1K 1;  3CCE 1;  3CCL 1;  3CCV 1;  3G4S 1;  3CCS Z;  1YI2 Z;  2OTL 1;  1S72 Z;  1VQ8 1;  3CCU 1;  1KD1 1;  3CCE Z;  3CCL Z;  3CCV Z;  3CXC Y;  2OTJ 1;  2OTL Z;  3CCR 1;  1VQM 1;  3CCU Z;  1Q86 2;  1K8A 1;  1JJ2 Z;  3CCQ 1;  2OTJ Z;  1QVG Y;  3CD6 1;  1VQM Z;  1VQ5 1;  1YJW 1;  1QVF Z;  3CCQ Z;  3G6E 1;  3CD6 Z;  1VQ5 Z;  3CPW Z;  1VQ7 1;  3G6E Z;  1M90 1; 
#chains in the Genus database with same CATH topology
 1YUA A;  4BY1 I;  3HOY I;  5T6B A;  2QA4 1;  2Q4Z A;  2P3Y A;  3D9X A;  3Q87 A;  4A3J I;  1YHQ Z;  3S16 I;  4BY7 I;  3CME 1;  1K73 2;  1VQO 1;  3I55 1;  1KRL A;  3IF8 A;  1JJ2 Y;  4NFR A;  3CCR Z;  1VQN 1;  1FDO A;  4MD8 A;  2QEX 1;  3CCJ Z;  2F4M A;  1YJ9 1;  2I3C A;  3CXC Z;  1VQP 1;  3CMA Z;  2QRD B;  2RPR A;  1YIT 1;  3G71 1;  3ESW A;  5IT9 f;  3EER A;  1VQK 1;  3F3F C;  2M6N A;  3PO3 I;  2R7Z I;  1Q16 A;  1NP6 A;  1WCM I;  3CC2 Z;  4E33 A;  2B63 I;  1ZB9 A;  3QWU A;  3LUS A;  5FLM I;  3RZO I;  2E2I I;  2P28 A;  1NJI 1;  2WB1 A;  5C3E I;  5IT9 b;  4EWC A;  4E32 A;  1VQ9 Z;  1KC8 1;  3HOU I;  3S15 I;  1KD1 2;  5D1P A;  4E2X A;  3GTJ I;  1VQL Z;  1YIJ 1;  1K8A 2;  3CPW Y;  3S14 I;  3I07 A;  3U50 C;  3I4N I;  4X6A I;  2R93 I;  2QRC B;  2JIQ A;  3VMG A;  2NVQ I;  3CCS 1;  4QTU A;  3HOX I;  4RVD A;  1Q81 1;  2PM9 A;  3CCE 1;  3CCV 1;  2H85 A;  4A3F I;  3G4S 1;  4E2W A;  1S72 Z;  3GTG I;  3GTM I;  1VQ8 1;  3CCU 1;  3GCF A;  5LL6 f;  2LEX A;  2E2J I;  3VMH A;  2OOY B;  2V8K A;  3NDI A;  2JA5 I;  3CCQ 1;  2R6M A;  3VMI A;  2ZAE B;  1YJW 1;  4Y52 I;  1P9N A;  3CD6 Z;  1R9T I;  2VUM I;  2G2K A;  2V3V A;  1VQ7 1;  3G6E Z;  4NB9 A;  4A3B I;  1W2B Z;  2DE7 A;  2PK7 A;  5C44 I;  1VQ4 1;  3VB9 A;  2VF1 A;  1NJI 2;  1VQ6 1;  1M1K 2;  1KC8 2;  3PO2 I;  4A3G I;  1Z02 A;  3CME Z;  2VPW A;  5CM2 M;  4MXU A;  3I55 Z;  1VQO Z;  3HOZ I;  4NOZ A;  1Y1V S;  2GTI A;  1VQN Z;  1X0T A;  1KQS Z;  2JUB A;  2QEX Z;  1K83 I;  3GTO I;  2RBL A;  2VPZ A;  1I3Q I;  1YJ9 Z;  5C4J I;  2QR1 B;  3OW2 Z;  1VQP Z;  3CQZ I;  1YIT Z;  3F3P C;  3NDJ A;  4NBE A;  3MZK B;  1Q81 2;  1VQK Z;  1QYP A;  4MD7 A;  1TWH I;  1M90 2;  2NVY I;  2K5R A;  4E2Y A;  3D6W A;  2NAP A;  1Q82 1;  3CCM Z;  4Y7N I;  1N8R 1;  4NBF A;  4A3I I;  1QF8 A;  2JA8 I;  1RO4 A;  5FLX f;  4DQY B;  1QVG Z;  1PFT A;  1YIJ Z;  2WAQ A;  1Q7Y 1;  2IZ3 A;  4RVF A;  3IR7 A;  1LQL A;  3S2H I;  4E30 A;  3FQM A;  1ZB8 A;  4A3L I;  1YI2 1;  2DE6 A;  3J7A 4;  5FLX b;  1N2F A;  4DGL A;  2J6A A;  2PMZ A;  1FDI A;  1K9M 1;  2R92 I;  1M1K 1;  4E2Z A;  3CCL 1;  3S1M I;  1Y1W I;  3CCS Z;  2OTL 1;  3GTK I;  1JWH C;  2AKL A;  2V8J A;  4AYB A;  3CCE Z;  3CCV Z;  2IZ4 A;  3HKZ A;  2OTJ 1;  3J81 f;  3CCR 1;  1DL6 A;  1I6H I;  5D1O B;  3CCU Z;  1NUI A;  4BBR I;  4NH1 C;  2EGT A;  1VQ5 1;  3J81 b;  3D2L A;  3CCQ Z;  2LFU A;  2V45 A;  2K3R A;  3CPW Z;  4MH4 A;  3S2D I;  1M90 1;  1YUK A;  2E2H I;  1YJN 1;  3EED A;  3KIF A;  3CC2 1;  1VQ7 Z;  4NBH A;  4RVG A;  2V8I A;  2RHB A;  3CC4 1;  3GKQ A;  1ML8 A;  3MON A;  4RS4 A;  1Q86 1;  1VQ4 Z;  4A3C I;  3S17 I;  1QXF A;  1VLA A;  5IP9 I;  1Q82 2;  1N8R 2;  3CC7 1;  4BBS I;  2NVT I;  5AN9 F;  1L1O C;  2BJO A;  1Q7Y 2;  3BG1 B;  2Y0S A;  2QLV B;  2DE5 A;  1WJ2 A;  3GTL I;  3S1R I;  3I56 1;  1SFO I;  3PO3 S;  2O53 A;  2QA4 Z;  1K9M 2;  3FKI I;  3HOW I;  2JIR A;  1TWA I;  1QVF Y;  2JR6 A;  1KQS Y;  1SIW A;  3NH5 A;  2OOX B;  2HU9 A;  1X3Z A;  3OW2 Y;  1RQF A;  3G71 Z;  3H3V J;  4A3M I;  2JA6 I;  1Z01 A;  1TWF I;  4NBA A;  3NH8 A;  1YI2 Z;  3J80 f;  1S7M A;  1TFI A;  3GTM S;  3CCL Z;  3CXC Y;  2OTL Z;  4XX2 A;  1VQM 1;  2RT9 A;  1Q86 2;  2VUG A;  4CL1 A;  2VPY A;  3J80 b;  2JIM A;  1JJ2 Z;  2OTJ Z;  1RLY A;  1QVG Y;  3IFU A;  3P5J B;  3IX0 A;  2JS4 A;  2IV2 X;  4A93 I;  3KIH A;  3K7A I;  3GTP I;  4DK1 A;  1VQ5 Z;  1Z03 A;  4MRI A;  4E31 A;  2OZK A;  3NFZ A;  1YHQ 1;  2E9H A;  2LIY A;  3GTQ I;  3G4S Z;  1VQ8 Z;  4NBG A;  1YJN Z;  3CCJ 1;  2GU2 A;  2YAD A;  4MD9 A;  3CC4 Z;  2JA7 I;  3CMA 1;  3CCM 1;  1Y1V I;  4RVH A;  2GTH A;  5D1O A;  1YJW Z;  3H0G I;  1RO2 A;  3CC7 Z;  2JIO A;  4BXX I;  2KPI A;  4A3E I;  1AA6 A;  1TWG I;  1Y8C A;  4RV9 A;  1VQ9 1;  2Q51 A;  1K73 1;  1WII A;  2JIP A;  3I56 Z;  1VQL 1;  3NH4 A;  1USP B;  1TWC I;  2RIQ A;  1VQ6 Z;  3HOV I;  2NVX I;  3S1N I;  3S1Q I;  4QTT A;  2AYD A;  4A3K I;  1ZH1 A;  2VPX A;  2W04 A;  5T64 A;  2W03 A;  2JMO A;  1USP A;  5T67 A;  1W2B Y;  3TDH B;  4TNU A;  3M3Y I;  2QKD A;  4NBB A;  2YU9 I;  3M4O I;  4NB8 A;  1RO0 A;  1S72 1;  2E7Z A;  4NBD A;  4HH4 A;  3MZL B;  1WW9 A;  1KD1 1;  3VTN A;  3BG0 B;  5C4X I;  4HGZ A;  3I4M I;  3RZD I;  5A2Q f;  3JAM f;  5IP7 I;  1K8A 1;  1I50 I;  4A3D I;  1RNI A;  2KI7 B;  3CD6 1;  3FQQ A;  1VQM Z;  2HF1 A;  4MON A;  4NBC A;  4HGY A;  5A2Q b;  2JNY A;  2M48 A;  3JAM b;  1QVF Z;  4S1T A;  3T4N B;  3G6E 1;  3TE5 B;  2F4O A;  2O4H A;  1X3W A;  1WZN A;  2QRE B; 
#chains in the Genus database with same CATH homology
 1YUA A;  4BY1 I;  3HOY I;  5T6B A;  2QA4 1;  2Q4Z A;  2P3Y A;  3D9X A;  3Q87 A;  4A3J I;  1YHQ Z;  3S16 I;  4BY7 I;  3CME 1;  1K73 2;  1VQO 1;  3I55 1;  1KRL A;  3IF8 A;  1JJ2 Y;  4NFR A;  3CCR Z;  1VQN 1;  4MD8 A;  2QEX 1;  3CCJ Z;  2F4M A;  1YJ9 1;  2I3C A;  3CXC Z;  1VQP 1;  3CMA Z;  2QRD B;  2RPR A;  1YIT 1;  3G71 1;  3ESW A;  5IT9 f;  3EER A;  1VQK 1;  3F3F C;  2M6N A;  3PO3 I;  2R7Z I;  1NP6 A;  1WCM I;  3CC2 Z;  4E33 A;  2B63 I;  1ZB9 A;  3QWU A;  3LUS A;  5FLM I;  3RZO I;  2E2I I;  2P28 A;  1NJI 1;  2WB1 A;  5C3E I;  5IT9 b;  4EWC A;  4E32 A;  1VQ9 Z;  1KC8 1;  3HOU I;  3S15 I;  1KD1 2;  5D1P A;  4E2X A;  3GTJ I;  1VQL Z;  1YIJ 1;  1K8A 2;  3CPW Y;  3S14 I;  3I07 A;  3U50 C;  3I4N I;  4X6A I;  2R93 I;  2QRC B;  3VMG A;  2NVQ I;  3CCS 1;  4QTU A;  3HOX I;  4RVD A;  1Q81 1;  2PM9 A;  3CCE 1;  3CCV 1;  2H85 A;  4A3F I;  3G4S 1;  4E2W A;  1S72 Z;  3GTG I;  3GTM I;  1VQ8 1;  3CCU 1;  3GCF A;  5LL6 f;  2E2J I;  3VMH A;  2OOY B;  2V8K A;  3NDI A;  2JA5 I;  3CCQ 1;  2R6M A;  3VMI A;  2ZAE B;  1YJW 1;  4Y52 I;  1P9N A;  3CD6 Z;  1R9T I;  2VUM I;  2G2K A;  1VQ7 1;  3G6E Z;  4NB9 A;  4A3B I;  1W2B Z;  2DE7 A;  2PK7 A;  5C44 I;  1VQ4 1;  3VB9 A;  2VF1 A;  1NJI 2;  1VQ6 1;  1M1K 2;  1KC8 2;  3PO2 I;  4A3G I;  1Z02 A;  3CME Z;  5CM2 M;  4MXU A;  3I55 Z;  1VQO Z;  3HOZ I;  4NOZ A;  1Y1V S;  2GTI A;  1VQN Z;  1X0T A;  1KQS Z;  2JUB A;  2QEX Z;  1K83 I;  3GTO I;  2RBL A;  1I3Q I;  1YJ9 Z;  5C4J I;  2QR1 B;  3OW2 Z;  1VQP Z;  3CQZ I;  1YIT Z;  3F3P C;  3NDJ A;  4NBE A;  3MZK B;  1Q81 2;  1VQK Z;  1QYP A;  4MD7 A;  1TWH I;  1M90 2;  2NVY I;  2K5R A;  4E2Y A;  3D6W A;  1Q82 1;  3CCM Z;  4Y7N I;  1N8R 1;  4NBF A;  4A3I I;  1QF8 A;  2JA8 I;  1RO4 A;  5FLX f;  4DQY B;  1QVG Z;  1PFT A;  1YIJ Z;  2WAQ A;  1Q7Y 1;  2IZ3 A;  4RVF A;  1LQL A;  3S2H I;  4E30 A;  3FQM A;  1ZB8 A;  4A3L I;  1YI2 1;  2DE6 A;  3J7A 4;  5FLX b;  1N2F A;  4DGL A;  2J6A A;  2PMZ A;  2R92 I;  1K9M 1;  1M1K 1;  4E2Z A;  3CCL 1;  3S1M I;  1Y1W I;  3CCS Z;  2OTL 1;  3GTK I;  1JWH C;  2AKL A;  2V8J A;  4AYB A;  3CCE Z;  3CCV Z;  2IZ4 A;  3HKZ A;  2OTJ 1;  3J81 f;  3CCR 1;  1DL6 A;  1I6H I;  5D1O B;  3CCU Z;  1NUI A;  4BBR I;  4NH1 C;  2EGT A;  1VQ5 1;  3J81 b;  3CCQ Z;  2LFU A;  2K3R A;  3CPW Z;  4MH4 A;  3S2D I;  1M90 1;  1YUK A;  2E2H I;  1YJN 1;  3EED A;  3KIF A;  3CC2 1;  1VQ7 Z;  4NBH A;  4RVG A;  2V8I A;  2RHB A;  3CC4 1;  3GKQ A;  1ML8 A;  3MON A;  4RS4 A;  1Q86 1;  1VQ4 Z;  4A3C I;  3S17 I;  1VLA A;  5IP9 I;  1Q82 2;  1N8R 2;  3CC7 1;  4BBS I;  2NVT I;  5AN9 F;  1L1O C;  2BJO A;  1Q7Y 2;  3BG1 B;  2Y0S A;  2QLV B;  2DE5 A;  3GTL I;  3S1R I;  3I56 1;  1SFO I;  3PO3 S;  2O53 A;  2QA4 Z;  1K9M 2;  3FKI I;  3HOW I;  1TWA I;  1QVF Y;  2JR6 A;  1KQS Y;  3NH5 A;  2OOX B;  2HU9 A;  1X3Z A;  3OW2 Y;  1RQF A;  3G71 Z;  3H3V J;  4A3M I;  2JA6 I;  1Z01 A;  1TWF I;  4NBA A;  3NH8 A;  1YI2 Z;  3J80 f;  1S7M A;  1TFI A;  3GTM S;  3CCL Z;  3CXC Y;  2OTL Z;  4XX2 A;  1VQM 1;  2RT9 A;  1Q86 2;  2VUG A;  4CL1 A;  3J80 b;  1JJ2 Z;  2OTJ Z;  1RLY A;  1QVG Y;  3IFU A;  3P5J B;  3IX0 A;  2JS4 A;  4A93 I;  3KIH A;  3K7A I;  3GTP I;  4DK1 A;  1VQ5 Z;  1Z03 A;  4MRI A;  4E31 A;  2OZK A;  3NFZ A;  1YHQ 1;  2E9H A;  2LIY A;  3GTQ I;  3G4S Z;  1VQ8 Z;  4NBG A;  1YJN Z;  3CCJ 1;  2GU2 A;  2YAD A;  4MD9 A;  3CC4 Z;  2JA7 I;  3CMA 1;  3CCM 1;  1Y1V I;  4RVH A;  2GTH A;  5D1O A;  1YJW Z;  3H0G I;  1RO2 A;  3CC7 Z;  4BXX I;  2KPI A;  4A3E I;  1TWG I;  4RV9 A;  1VQ9 1;  2Q51 A;  1K73 1;  1WII A;  3I56 Z;  1VQL 1;  3NH4 A;  1USP B;  1TWC I;  2RIQ A;  1VQ6 Z;  3HOV I;  2NVX I;  3S1N I;  3S1Q I;  4QTT A;  4A3K I;  1ZH1 A;  2W04 A;  5T64 A;  2W03 A;  2JMO A;  1USP A;  5T67 A;  1W2B Y;  3TDH B;  4TNU A;  3M3Y I;  2QKD A;  4NBB A;  2YU9 I;  3M4O I;  4NB8 A;  1RO0 A;  1S72 1;  4NBD A;  4HH4 A;  3MZL B;  1WW9 A;  1KD1 1;  3VTN A;  3BG0 B;  5C4X I;  4HGZ A;  3I4M I;  3RZD I;  5A2Q f;  3JAM f;  5IP7 I;  1K8A 1;  1I50 I;  4A3D I;  1RNI A;  2KI7 B;  3CD6 1;  3FQQ A;  1VQM Z;  2HF1 A;  4MON A;  4NBC A;  4HGY A;  5A2Q b;  2JNY A;  2M48 A;  3JAM b;  1QVF Z;  4S1T A;  3T4N B;  3G6E 1;  3TE5 B;  2F4O A;  2O4H A;  1X3W A;  2QRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...