3CC41

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc4100
1YIJ1 1VQNZ 1K732 3CC41 3CCM1 1M902 1KD11 3G6E1 1YI21 1K8A1 3CCMZ 3OW2Y 1KQSZ 1N8R2 3CCL1 3G6EZ 1NJI1 2OTJZ 3CPWY 3CCLZ 3CCU1 3CCS1 1KC82 1KD12 3I561 1YJ9Z 1VQK1 1VQ91 3I56Z 1K9M1 1VQ41 3CCRZ 1VQKZ 1VQLZ 3G4S1 3CXCZ 1QVGY 1VQ81 2QEXZ 1VQMZ 3G4SZ 1Q862 3CC21 2QA41 3CC2Z 1YIJZ 1M1K2 1Q812 1YJN1 2OTL1 3CC4Z 3CD61 3CPWZ 1YJW1 3CMA1 1YI2Z 2OTLZ 1YJWZ 1VQ51 1JJ2Y 3CCQ1 1QVFY 3CCUZ 3CCSZ 1K8A2 1W2BY 1QVGZ 3CME1 1NJI2 1VQ9Z 3I551 3CMEZ 1VQ4Z 3CCV1 1VQ8Z 1VQO1 3G711 3CCJ1 1K9M2 3OW2Z 1VQOZ 2QA4Z 1S721 3CCE1 3CCJZ 1KQSY 1VQP1 1YJNZ 1Q821 1VQ71 3CD6Z 1QVFZ 3CMAZ 1K731 1M901 1VQ5Z 1Q7Y1 3CC71 1YHQ1 3CCQZ 1YIT1 3CXCY 1YHQZ 1KC81 3I55Z 1Q7Y2 3CCVZ 2OTJ1 3G71Z 1YJ91 1S72Z 3CCEZ 1JJ2Z 1Q861 1VQ61 3CCR1 1VQPZ 1VQL1 1VQ7Z 2QEX1 1VQ6Z 1W2BZ 1VQM1 1M1K1 1Q811 1N8R1 1Q822 1VQN1 3CC7Z 1YITZ
chains in the Genus database with same CATH superfamily
1YIJ1 3S14I 3GTJI 2IZ3A 3D9XA 4E2ZA 1Y1VI 1WCMI 2E9HA 1KQSZ 1Y8CA 3CCL1 3CCLZ 2QRCB 1RO0A 3GCFA 3CCS1 3CCU1 5FLMI 3I561 2HF1A 4QTTA 5T64A 2LEXA 1KRLA 4A3FI 2YU9I 3I56Z 3CCRZ 3VMHA 1VQ81 1I3QI 1VQMZ 2H85A 3HKZA 2QA41 3ESWA 4MONA 4EWCA 1M1K2 2RIQA 2B63I 3CC4Z 2O53A 2E2JI 1YJW1 2IV2X 1YI2Z 1YJWZ 3P5JB 3RZDI 1NP6A 1W2BY 1QVGZ 2QREB 1ZB8A 3GTMS 4RVFA 1ML8A 2K3RA 1PFTA 2PMZA 2RBLA 3CCJ1 1K83I 3OW2Z 2V8IA 4E2XA 3CCE1 3CCJZ 1KQSY 4E31A 2V8KA 3S1QI 2HU9A 3CD6Z 1QVFZ 3CMAZ 5AN9F 3S1MI 1TWCI 2R7ZI 2O4HA 1YHQ1 3VTNA 3HOXI 2QRDB 1FDIA 1YHQZ 2BJOA 3HOUI 4E33A 1KC81 4DGLA 3I55Z 1Q7Y2 5IP9I 4BBRI 2V45A 1LQLA 4NBDA 1YJ91 1JJ2Z 1ZB9A 4S1TA 2EGTA 2JUBA 1X0TA 1WZNA 4Y52I 1QXFA 3H3VJ 1Q811 4NBAA 2JIRA 3G6E1 3OW2Y 3Q87A 3VMIA 3G6EZ 4NBBA 3GTGI 3IF8A 2OTJZ 2P3YA 3GTMI 1KC82 2NVXI 2JS4A 3GKQA 3TDHB 2E2II 1VQ91 3PO3S 1VQLZ 3EERA 3G4S1 3S2DI 2KPIA 3G4SZ 2WB1A 3IX0A 3MZKB 3H0GI 1YIJZ 1Q812 3J81f 3CPWZ 2OZKA 2RPRA 4RVGA 1VQ51 5FLXf 3J81b 1JJ2Y 2R92I 3CCQ1 4HGZA 3CCUZ 3CCSZ 5FLXb 2IZ4A 3F3FC 2WAQA 3FQMA 1X3WA 4NOZA 5A2Qf 2VUMI 3HOVI 3CCV1 3GTKI 2DE7A 1VQ8Z 4A3CI 2ZAEB 3S15I 1VQO1 4XX2A 1NUIA 2W04A 2QR1B 3KIFA 3S1RI 1VQOZ 2QA4Z 1S721 1YUAA 3NDIA 5C44I 1AA6A 2M6NA 3RZOI 4E2WA 1K731 1M901 3CC7Z 1Q7Y1 4RVHA 1SIWA 2RHBA 3S17I 1TWAI 1RO2A 3GTPI 3NFZA 4E30A 3NH5A 2JIOA 2Q51A 4A3II 3PO3I 1SFOI 2JA8I 2NAPA 2JMOA 1S7MA 4MH4A 4A3KI 1RLYA 2Y0SA 3T4NB 4NBCA 3CCEZ 3NDJA 3LUSA 3MZLB 3VMGA 2VUGA 1Q861 4A93I 2NVTI 2GTHA 2I3CA 2QEX1 2LFUA 5D1OB 2V3VA 3F3PC 2R6MA 1RNIA 4E32A 5C3EI 1RQFA 3D6WA 1K732 3CCM1 1M902 4MD9A 1JWHC 4A3DI 1TWGI 3QWUA 1K8A1 3CCMZ 1N8R2 3D2LA 1NJI1 1Y1WI 4NBFA 4X6AI 2OOYB 4RV9A 1KD12 2JR6A 1YJ9Z 1VQ41 3CXCZ 3S2HI 2VPWA 1QVGY 2OOXB 2JIPA 1Q862 2PK7A 4A3EI 1N2FA 2NVQI 1YJN1 4HH4A 2OTL1 3TE5B 3GTOI 4MRIA 2OTLZ 4DK1A 2F4MA 1WJ2A 1QVFY 1K8A2 2PM9A 3CME1 1I50I 1NJI2 1VQ9Z 4BXXI 5C4XI 3CMEZ 2W03A 3I07A 3JAMf 1YUKA 4RS4A 3HOWI 4E2YA 3U50C 3G711 4A3GI 1Z01A 2JIQA 4TNUA 3J7A4 2RT9A 3JAMb 4A3LI 3FQQA 1Z03A 4CL1A 3S16I 1L1OC 1VQP1 1Q821 1VQ71 1Z02A 2P28A 3BG1B 1VQ5Z 5CM2M 3FKII 3CC71 2JA5I 3CCQZ 1YIT1 3I4NI 3CXCY 4BY7I 3GTLI 2AYDA 1QYPA 3IR7A 4RVDA 4DQYB 5A2Qb 3CCVZ 3GTQI 4NBGA 2E7ZA 1FDOA 3IFUA 1RO4A 5IT9f 1S72Z 3NH8A 3CCR1 2YADA 5IT9b 4MXUA 1USPB 2E2HI 2LIYA 1VQM1 3MONA 5D1OA 1N8R1 1Q822 1VQN1 4HGYA 2VPZA 2AKLA 1VQNZ 1WIIA 4QTUA 3CC41 1KD11 2JIMA 2DE5A 1YI21 3HOYI 2DE6A 1TFIA 3CPWY 2F4OA 2V8JA 1I6HI 2R93I 2J6AA 1DL6A 4A3BI 1R9TI 1VQK1 1P9NA 1K9M1 3CQZI 1VQKZ 4NB8A 2QEXZ 4NBHA 3BG0B 3CC21 4NB9A 2QKDA 2G2KA 3KIHA 4A3MI 3CC2Z 1WW9A 5T67A 3CD61 3CMA1 2JNYA 3M4OI 1Y1VS 1ZH1A 4A3JI 2K5RA 2KI7B 2JA7I 1X3ZA 3I551 3PO2I 1Q16A 1VQ4Z 1K9M2 4BY1I 4Y7NI 2VPXA 4AYBA 4BBSI 1YJNZ 5LL6f 1TWHI 2QLVB 4NFRA 2Q4ZA 4MD7A 3I4MI 5D1PA 3HOZI 3M3YI 4NH1C 3EEDA 3NH4A 3VB9A 2OTJ1 3G71Z 3J80f 5T6BA 1VLAA 2VF1A 2M48A 2GTIA 3J80b 2VPYA 2JA6I 3K7AI 4MD8A 1VQ61 1QF8A 1VQPZ 1VQL1 1VQ7Z 4NBEA 5C4JI 1W2BZ 1USPA 1VQ6Z 2NVYI 1M1K1 5IP7I 3S1NI 1TWFI 2GU2A 1YITZ
chains in the Genus database with same CATH topology
1YIJ1 3S14I 3GTJI 2IZ3A 3D9XA 4E2ZA 1Y1VI 1WCMI 2E9HA 1KQSZ 3CCL1 3CCLZ 2QRCB 1RO0A 3GCFA 3CCS1 3CCU1 5FLMI 3I561 2HF1A 4QTTA 5T64A 4A3FI 1KRLA 2YU9I 3I56Z 3CCRZ 3VMHA 1VQ81 1I3QI 1VQMZ 2H85A 3HKZA 2QA41 3ESWA 4MONA 4EWCA 1M1K2 2RIQA 2B63I 3CC4Z 2O53A 2E2JI 1YJW1 1YI2Z 1YJWZ 3P5JB 3RZDI 1NP6A 1W2BY 1QVGZ 2QREB 1ZB8A 3GTMS 4RVFA 1ML8A 2K3RA 1PFTA 2PMZA 2RBLA 3CCJ1 1K83I 3OW2Z 2V8IA 4E2XA 3CCE1 3CCJZ 1KQSY 4E31A 2V8KA 3S1QI 2HU9A 3CD6Z 1QVFZ 3CMAZ 5AN9F 3S1MI 1TWCI 2R7ZI 2O4HA 1YHQ1 3VTNA 3HOXI 2QRDB 1YHQZ 2BJOA 3HOUI 4E33A 1KC81 4DGLA 3I55Z 1Q7Y2 5IP9I 4BBRI 1LQLA 4NBDA 1YJ91 1JJ2Z 1ZB9A 4S1TA 2EGTA 2JUBA 1X0TA 4Y52I 3H3VJ 1Q811 4NBAA 3G6E1 3OW2Y 3Q87A 3VMIA 3G6EZ 4NBBA 3GTGI 3IF8A 2OTJZ 2P3YA 3GTMI 1KC82 2NVXI 2JS4A 3GKQA 3TDHB 2E2II 1VQ91 3PO3S 1VQLZ 3EERA 3G4S1 3S2DI 2KPIA 3G4SZ 2WB1A 3IX0A 3MZKB 3H0GI 1YIJZ 1Q812 3J81f 3CPWZ 2OZKA 2RPRA 4RVGA 1VQ51 5FLXf 3J81b 1JJ2Y 2R92I 3CCQ1 4HGZA 3CCUZ 3CCSZ 5FLXb 2IZ4A 3F3FC 2WAQA 3FQMA 1X3WA 4NOZA 5A2Qf 2VUMI 3HOVI 3CCV1 3GTKI 2DE7A 1VQ8Z 4A3CI 2ZAEB 3S15I 1VQO1 4XX2A 1NUIA 2W04A 2QR1B 3KIFA 3S1RI 1VQOZ 2QA4Z 1S721 1YUAA 3NDIA 5C44I 2M6NA 3RZOI 4E2WA 1K731 1M901 1Q7Y1 4RVHA 2RHBA 3S17I 1TWAI 1RO2A 3GTPI 3NFZA 4E30A 3NH5A 2Q51A 4A3II 3PO3I 1SFOI 2JA8I 2JMOA 1S7MA 4MH4A 4A3KI 1RLYA 2Y0SA 3T4NB 4NBCA 3CCEZ 3NDJA 3LUSA 3MZLB 3VMGA 2VUGA 1Q861 4A93I 2NVTI 2GTHA 2I3CA 2QEX1 2LFUA 5D1OB 3F3PC 2R6MA 1RNIA 4E32A 5C3EI 1RQFA 3D6WA 1K732 3CCM1 1M902 4MD9A 1JWHC 4A3DI 1TWGI 3QWUA 1K8A1 3CCMZ 1N8R2 1NJI1 1Y1WI 4NBFA 4X6AI 2OOYB 4RV9A 1KD12 2JR6A 1YJ9Z 1VQ41 3CXCZ 3S2HI 1QVGY 2OOXB 1Q862 2PK7A 4A3EI 1N2FA 1TWFI 2NVQI 1YJN1 4HH4A 2OTL1 3TE5B 3GTOI 4MRIA 2OTLZ 4DK1A 2F4MA 1QVFY 1K8A2 2PM9A 3CME1 1I50I 1NJI2 1VQ9Z 4BXXI 5C4XI 3CMEZ 2W03A 3I07A 3JAMf 1YUKA 4RS4A 3HOWI 4E2YA 3U50C 3G711 4A3GI 1Z01A 4TNUA 3J7A4 2RT9A 3JAMb 4A3LI 3FQQA 1Z03A 4CL1A 3S16I 1L1OC 1VQP1 1Q821 1VQ71 1Z02A 2P28A 3BG1B 1VQ5Z 5CM2M 3FKII 3CC71 2JA5I 3CCQZ 1YIT1 3I4NI 3CXCY 4BY7I 3GTLI 1QYPA 4RVDA 4DQYB 5A2Qb 3CCVZ 3GTQI 4NBGA 3IFUA 1RO4A 5IT9f 1S72Z 3NH8A 3CCR1 2YADA 5IT9b 4MXUA 1USPB 2E2HI 2LIYA 1VQM1 3MONA 5D1OA 1N8R1 1Q822 1VQN1 4HGYA 2AKLA 1VQNZ 1WIIA 4QTUA 3CC41 1KD11 2DE5A 1YI21 3HOYI 2DE6A 1TFIA 3CPWY 2F4OA 2V8JA 1I6HI 2R93I 2J6AA 1DL6A 4A3BI 1R9TI 1VQK1 1P9NA 1K9M1 3CQZI 1VQKZ 4NB8A 2QEXZ 4NBHA 3BG0B 3CC21 4NB9A 2QKDA 2G2KA 3KIHA 4A3MI 3CC2Z 1WW9A 5T67A 3CD61 3CMA1 2JNYA 3M4OI 1Y1VS 1ZH1A 4A3JI 2K5RA 2KI7B 2JA7I 1X3ZA 3I551 3PO2I 1VQ4Z 1K9M2 4BY1I 4Y7NI 4AYBA 4BBSI 1YJNZ 5LL6f 1TWHI 2QLVB 4NFRA 2Q4ZA 4MD7A 3I4MI 5D1PA 3HOZI 3M3YI 4NH1C 3EEDA 3NH4A 3VB9A 2OTJ1 3G71Z 3J80f 5T6BA 1VLAA 2VF1A 2M48A 2GTIA 3J80b 2JA6I 3K7AI 4MD8A 1VQ61 1QF8A 1VQPZ 1VQL1 1VQ7Z 4NBEA 5C4JI 1W2BZ 1USPA 1VQ6Z 2NVYI 1M1K1 5IP7I 3S1NI 3CC7Z 2GU2A 1YITZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 1;  1VQN Z;  1K73 2;  3CC4 1;  3CCM 1;  1M90 2;  1KD1 1;  3G6E 1;  1YI2 1;  1K8A 1;  3CCM Z;  3OW2 Y;  1KQS Z;  1N8R 2;  3CCL 1;  3G6E Z;  1NJI 1;  2OTJ Z;  3CPW Y;  3CCL Z;  3CCU 1;  3CCS 1;  1KC8 2;  1KD1 2;  3I56 1;  1YJ9 Z;  1VQK 1;  1VQ9 1;  3I56 Z;  1K9M 1;  1VQ4 1;  3CCR Z;  1VQK Z;  1VQL Z;  3G4S 1;  3CXC Z;  1QVG Y;  1VQ8 1;  2QEX Z;  1VQM Z;  3G4S Z;  1Q86 2;  3CC2 1;  2QA4 1;  3CC2 Z;  1YIJ Z;  1M1K 2;  1Q81 2;  1YJN 1;  2OTL 1;  3CC4 Z;  3CD6 1;  3CPW Z;  1YJW 1;  3CMA 1;  1YI2 Z;  2OTL Z;  1YJW Z;  1VQ5 1;  1JJ2 Y;  3CCQ 1;  1QVF Y;  3CCU Z;  3CCS Z;  1K8A 2;  1W2B Y;  1QVG Z;  3CME 1;  1NJI 2;  1VQ9 Z;  3I55 1;  3CME Z;  1VQ4 Z;  3CCV 1;  1VQ8 Z;  1VQO 1;  3G71 1;  3CCJ 1;  1K9M 2;  3OW2 Z;  1VQO Z;  2QA4 Z;  1S72 1;  3CCE 1;  3CCJ Z;  1KQS Y;  1VQP 1;  1YJN Z;  1Q82 1;  1VQ7 1;  3CD6 Z;  1QVF Z;  3CMA Z;  1K73 1;  1M90 1;  1VQ5 Z;  1Q7Y 1;  3CC7 1;  1YHQ 1;  3CCQ Z;  1YIT 1;  3CXC Y;  1YHQ Z;  1KC8 1;  3I55 Z;  1Q7Y 2;  3CCV Z;  2OTJ 1;  3G71 Z;  1YJ9 1;  1S72 Z;  3CCE Z;  1JJ2 Z;  1Q86 1;  1VQ6 1;  3CCR 1;  1VQP Z;  1VQL 1;  1VQ7 Z;  2QEX 1;  1VQ6 Z;  1W2B Z;  1VQM 1;  1M1K 1;  1Q81 1;  1N8R 1;  1Q82 2;  1VQN 1;  3CC7 Z;  1YIT Z; 
#chains in the Genus database with same CATH topology
 1YIJ 1;  3S14 I;  3GTJ I;  2IZ3 A;  3D9X A;  4E2Z A;  1Y1V I;  1WCM I;  2E9H A;  1KQS Z;  1Y8C A;  3CCL 1;  3CCL Z;  2QRC B;  1RO0 A;  3GCF A;  3CCS 1;  3CCU 1;  5FLM I;  3I56 1;  2HF1 A;  4QTT A;  5T64 A;  2LEX A;  1KRL A;  4A3F I;  2YU9 I;  3I56 Z;  3CCR Z;  3VMH A;  1VQ8 1;  1I3Q I;  1VQM Z;  2H85 A;  3HKZ A;  2QA4 1;  3ESW A;  4MON A;  4EWC A;  1M1K 2;  2RIQ A;  2B63 I;  3CC4 Z;  2O53 A;  2E2J I;  1YJW 1;  2IV2 X;  1YI2 Z;  1YJW Z;  3P5J B;  3RZD I;  1NP6 A;  1W2B Y;  1QVG Z;  2QRE B;  1ZB8 A;  3GTM S;  4RVF A;  1ML8 A;  2K3R A;  1PFT A;  2PMZ A;  2RBL A;  3CCJ 1;  1K83 I;  3OW2 Z;  2V8I A;  4E2X A;  3CCE 1;  3CCJ Z;  1KQS Y;  4E31 A;  2V8K A;  3S1Q I;  2HU9 A;  3CD6 Z;  1QVF Z;  3CMA Z;  5AN9 F;  3S1M I;  1TWC I;  2R7Z I;  2O4H A;  1YHQ 1;  3VTN A;  3HOX I;  2QRD B;  1FDI A;  1YHQ Z;  2BJO A;  3HOU I;  4E33 A;  1KC8 1;  4DGL A;  3I55 Z;  1Q7Y 2;  5IP9 I;  4BBR I;  2V45 A;  1LQL A;  4NBD A;  1YJ9 1;  1JJ2 Z;  1ZB9 A;  4S1T A;  2EGT A;  2JUB A;  1X0T A;  1WZN A;  4Y52 I;  1QXF A;  3H3V J;  1Q81 1;  4NBA A;  2JIR A;  3G6E 1;  3OW2 Y;  3Q87 A;  3VMI A;  3G6E Z;  4NBB A;  3GTG I;  3IF8 A;  2OTJ Z;  2P3Y A;  3GTM I;  1KC8 2;  2NVX I;  2JS4 A;  3GKQ A;  3TDH B;  2E2I I;  1VQ9 1;  3PO3 S;  1VQL Z;  3EER A;  3G4S 1;  3S2D I;  2KPI A;  3G4S Z;  2WB1 A;  3IX0 A;  3MZK B;  3H0G I;  1YIJ Z;  1Q81 2;  3J81 f;  3CPW Z;  2OZK A;  2RPR A;  4RVG A;  1VQ5 1;  5FLX f;  3J81 b;  1JJ2 Y;  2R92 I;  3CCQ 1;  4HGZ A;  3CCU Z;  3CCS Z;  5FLX b;  2IZ4 A;  3F3F C;  2WAQ A;  3FQM A;  1X3W A;  4NOZ A;  5A2Q f;  2VUM I;  3HOV I;  3CCV 1;  3GTK I;  2DE7 A;  1VQ8 Z;  4A3C I;  2ZAE B;  3S15 I;  1VQO 1;  4XX2 A;  1NUI A;  2W04 A;  2QR1 B;  3KIF A;  3S1R I;  1VQO Z;  2QA4 Z;  1S72 1;  1YUA A;  3NDI A;  5C44 I;  1AA6 A;  2M6N A;  3RZO I;  4E2W A;  1K73 1;  1M90 1;  3CC7 Z;  1Q7Y 1;  4RVH A;  1SIW A;  2RHB A;  3S17 I;  1TWA I;  1RO2 A;  3GTP I;  3NFZ A;  4E30 A;  3NH5 A;  2JIO A;  2Q51 A;  4A3I I;  3PO3 I;  1SFO I;  2JA8 I;  2NAP A;  2JMO A;  1S7M A;  4MH4 A;  4A3K I;  1RLY A;  2Y0S A;  3T4N B;  4NBC A;  3CCE Z;  3NDJ A;  3LUS A;  3MZL B;  3VMG A;  2VUG A;  1Q86 1;  4A93 I;  2NVT I;  2GTH A;  2I3C A;  2QEX 1;  2LFU A;  5D1O B;  2V3V A;  3F3P C;  2R6M A;  1RNI A;  4E32 A;  5C3E I;  1RQF A;  3D6W A;  1K73 2;  3CCM 1;  1M90 2;  4MD9 A;  1JWH C;  4A3D I;  1TWG I;  3QWU A;  1K8A 1;  3CCM Z;  1N8R 2;  3D2L A;  1NJI 1;  1Y1W I;  4NBF A;  4X6A I;  2OOY B;  4RV9 A;  1KD1 2;  2JR6 A;  1YJ9 Z;  1VQ4 1;  3CXC Z;  3S2H I;  2VPW A;  1QVG Y;  2OOX B;  2JIP A;  1Q86 2;  2PK7 A;  4A3E I;  1N2F A;  2NVQ I;  1YJN 1;  4HH4 A;  2OTL 1;  3TE5 B;  3GTO I;  4MRI A;  2OTL Z;  4DK1 A;  2F4M A;  1WJ2 A;  1QVF Y;  1K8A 2;  2PM9 A;  3CME 1;  1I50 I;  1NJI 2;  1VQ9 Z;  4BXX I;  5C4X I;  3CME Z;  2W03 A;  3I07 A;  3JAM f;  1YUK A;  4RS4 A;  3HOW I;  4E2Y A;  3U50 C;  3G71 1;  4A3G I;  1Z01 A;  2JIQ A;  4TNU A;  3J7A 4;  2RT9 A;  3JAM b;  4A3L I;  3FQQ A;  1Z03 A;  4CL1 A;  3S16 I;  1L1O C;  1VQP 1;  1Q82 1;  1VQ7 1;  1Z02 A;  2P28 A;  3BG1 B;  1VQ5 Z;  5CM2 M;  3FKI I;  3CC7 1;  2JA5 I;  3CCQ Z;  1YIT 1;  3I4N I;  3CXC Y;  4BY7 I;  3GTL I;  2AYD A;  1QYP A;  3IR7 A;  4RVD A;  4DQY B;  5A2Q b;  3CCV Z;  3GTQ I;  4NBG A;  2E7Z A;  1FDO A;  3IFU A;  1RO4 A;  5IT9 f;  1S72 Z;  3NH8 A;  3CCR 1;  2YAD A;  5IT9 b;  4MXU A;  1USP B;  2E2H I;  2LIY A;  1VQM 1;  3MON A;  5D1O A;  1N8R 1;  1Q82 2;  1VQN 1;  4HGY A;  2VPZ A;  2AKL A;  1VQN Z;  1WII A;  4QTU A;  3CC4 1;  1KD1 1;  2JIM A;  2DE5 A;  1YI2 1;  3HOY I;  2DE6 A;  1TFI A;  3CPW Y;  2F4O A;  2V8J A;  1I6H I;  2R93 I;  2J6A A;  1DL6 A;  4A3B I;  1R9T I;  1VQK 1;  1P9N A;  1K9M 1;  3CQZ I;  1VQK Z;  4NB8 A;  2QEX Z;  4NBH A;  3BG0 B;  3CC2 1;  4NB9 A;  2QKD A;  2G2K A;  3KIH A;  4A3M I;  3CC2 Z;  1WW9 A;  5T67 A;  3CD6 1;  3CMA 1;  2JNY A;  3M4O I;  1Y1V S;  1ZH1 A;  4A3J I;  2K5R A;  2KI7 B;  2JA7 I;  1X3Z A;  3I55 1;  3PO2 I;  1Q16 A;  1VQ4 Z;  1K9M 2;  4BY1 I;  4Y7N I;  2VPX A;  4AYB A;  4BBS I;  1YJN Z;  5LL6 f;  1TWH I;  2QLV B;  4NFR A;  2Q4Z A;  4MD7 A;  3I4M I;  5D1P A;  3HOZ I;  3M3Y I;  4NH1 C;  3EED A;  3NH4 A;  3VB9 A;  2OTJ 1;  3G71 Z;  3J80 f;  5T6B A;  1VLA A;  2VF1 A;  2M48 A;  2GTI A;  3J80 b;  2VPY A;  2JA6 I;  3K7A I;  4MD8 A;  1VQ6 1;  1QF8 A;  1VQP Z;  1VQL 1;  1VQ7 Z;  4NBE A;  5C4J I;  1W2B Z;  1USP A;  1VQ6 Z;  2NVY I;  1M1K 1;  5IP7 I;  3S1N I;  1TWF I;  2GU2 A;  1YIT Z; 
#chains in the Genus database with same CATH homology
 1YIJ 1;  3S14 I;  3GTJ I;  2IZ3 A;  3D9X A;  4E2Z A;  1Y1V I;  1WCM I;  2E9H A;  1KQS Z;  3CCL 1;  3CCL Z;  2QRC B;  1RO0 A;  3GCF A;  3CCS 1;  3CCU 1;  5FLM I;  3I56 1;  2HF1 A;  4QTT A;  5T64 A;  4A3F I;  1KRL A;  2YU9 I;  3I56 Z;  3CCR Z;  3VMH A;  1VQ8 1;  1I3Q I;  1VQM Z;  2H85 A;  3HKZ A;  2QA4 1;  3ESW A;  4MON A;  4EWC A;  1M1K 2;  2RIQ A;  2B63 I;  3CC4 Z;  2O53 A;  2E2J I;  1YJW 1;  1YI2 Z;  1YJW Z;  3P5J B;  3RZD I;  1NP6 A;  1W2B Y;  1QVG Z;  2QRE B;  1ZB8 A;  3GTM S;  4RVF A;  1ML8 A;  2K3R A;  1PFT A;  2PMZ A;  2RBL A;  3CCJ 1;  1K83 I;  3OW2 Z;  2V8I A;  4E2X A;  3CCE 1;  3CCJ Z;  1KQS Y;  4E31 A;  2V8K A;  3S1Q I;  2HU9 A;  3CD6 Z;  1QVF Z;  3CMA Z;  5AN9 F;  3S1M I;  1TWC I;  2R7Z I;  2O4H A;  1YHQ 1;  3VTN A;  3HOX I;  2QRD B;  1YHQ Z;  2BJO A;  3HOU I;  4E33 A;  1KC8 1;  4DGL A;  3I55 Z;  1Q7Y 2;  5IP9 I;  4BBR I;  1LQL A;  4NBD A;  1YJ9 1;  1JJ2 Z;  1ZB9 A;  4S1T A;  2EGT A;  2JUB A;  1X0T A;  4Y52 I;  3H3V J;  1Q81 1;  4NBA A;  3G6E 1;  3OW2 Y;  3Q87 A;  3VMI A;  3G6E Z;  4NBB A;  3GTG I;  3IF8 A;  2OTJ Z;  2P3Y A;  3GTM I;  1KC8 2;  2NVX I;  2JS4 A;  3GKQ A;  3TDH B;  2E2I I;  1VQ9 1;  3PO3 S;  1VQL Z;  3EER A;  3G4S 1;  3S2D I;  2KPI A;  3G4S Z;  2WB1 A;  3IX0 A;  3MZK B;  3H0G I;  1YIJ Z;  1Q81 2;  3J81 f;  3CPW Z;  2OZK A;  2RPR A;  4RVG A;  1VQ5 1;  5FLX f;  3J81 b;  1JJ2 Y;  2R92 I;  3CCQ 1;  4HGZ A;  3CCU Z;  3CCS Z;  5FLX b;  2IZ4 A;  3F3F C;  2WAQ A;  3FQM A;  1X3W A;  4NOZ A;  5A2Q f;  2VUM I;  3HOV I;  3CCV 1;  3GTK I;  2DE7 A;  1VQ8 Z;  4A3C I;  2ZAE B;  3S15 I;  1VQO 1;  4XX2 A;  1NUI A;  2W04 A;  2QR1 B;  3KIF A;  3S1R I;  1VQO Z;  2QA4 Z;  1S72 1;  1YUA A;  3NDI A;  5C44 I;  2M6N A;  3RZO I;  4E2W A;  1K73 1;  1M90 1;  1Q7Y 1;  4RVH A;  2RHB A;  3S17 I;  1TWA I;  1RO2 A;  3GTP I;  3NFZ A;  4E30 A;  3NH5 A;  2Q51 A;  4A3I I;  3PO3 I;  1SFO I;  2JA8 I;  2JMO A;  1S7M A;  4MH4 A;  4A3K I;  1RLY A;  2Y0S A;  3T4N B;  4NBC A;  3CCE Z;  3NDJ A;  3LUS A;  3MZL B;  3VMG A;  2VUG A;  1Q86 1;  4A93 I;  2NVT I;  2GTH A;  2I3C A;  2QEX 1;  2LFU A;  5D1O B;  3F3P C;  2R6M A;  1RNI A;  4E32 A;  5C3E I;  1RQF A;  3D6W A;  1K73 2;  3CCM 1;  1M90 2;  4MD9 A;  1JWH C;  4A3D I;  1TWG I;  3QWU A;  1K8A 1;  3CCM Z;  1N8R 2;  1NJI 1;  1Y1W I;  4NBF A;  4X6A I;  2OOY B;  4RV9 A;  1KD1 2;  2JR6 A;  1YJ9 Z;  1VQ4 1;  3CXC Z;  3S2H I;  1QVG Y;  2OOX B;  1Q86 2;  2PK7 A;  4A3E I;  1N2F A;  1TWF I;  2NVQ I;  1YJN 1;  4HH4 A;  2OTL 1;  3TE5 B;  3GTO I;  4MRI A;  2OTL Z;  4DK1 A;  2F4M A;  1QVF Y;  1K8A 2;  2PM9 A;  3CME 1;  1I50 I;  1NJI 2;  1VQ9 Z;  4BXX I;  5C4X I;  3CME Z;  2W03 A;  3I07 A;  3JAM f;  1YUK A;  4RS4 A;  3HOW I;  4E2Y A;  3U50 C;  3G71 1;  4A3G I;  1Z01 A;  4TNU A;  3J7A 4;  2RT9 A;  3JAM b;  4A3L I;  3FQQ A;  1Z03 A;  4CL1 A;  3S16 I;  1L1O C;  1VQP 1;  1Q82 1;  1VQ7 1;  1Z02 A;  2P28 A;  3BG1 B;  1VQ5 Z;  5CM2 M;  3FKI I;  3CC7 1;  2JA5 I;  3CCQ Z;  1YIT 1;  3I4N I;  3CXC Y;  4BY7 I;  3GTL I;  1QYP A;  4RVD A;  4DQY B;  5A2Q b;  3CCV Z;  3GTQ I;  4NBG A;  3IFU A;  1RO4 A;  5IT9 f;  1S72 Z;  3NH8 A;  3CCR 1;  2YAD A;  5IT9 b;  4MXU A;  1USP B;  2E2H I;  2LIY A;  1VQM 1;  3MON A;  5D1O A;  1N8R 1;  1Q82 2;  1VQN 1;  4HGY A;  2AKL A;  1VQN Z;  1WII A;  4QTU A;  3CC4 1;  1KD1 1;  2DE5 A;  1YI2 1;  3HOY I;  2DE6 A;  1TFI A;  3CPW Y;  2F4O A;  2V8J A;  1I6H I;  2R93 I;  2J6A A;  1DL6 A;  4A3B I;  1R9T I;  1VQK 1;  1P9N A;  1K9M 1;  3CQZ I;  1VQK Z;  4NB8 A;  2QEX Z;  4NBH A;  3BG0 B;  3CC2 1;  4NB9 A;  2QKD A;  2G2K A;  3KIH A;  4A3M I;  3CC2 Z;  1WW9 A;  5T67 A;  3CD6 1;  3CMA 1;  2JNY A;  3M4O I;  1Y1V S;  1ZH1 A;  4A3J I;  2K5R A;  2KI7 B;  2JA7 I;  1X3Z A;  3I55 1;  3PO2 I;  1VQ4 Z;  1K9M 2;  4BY1 I;  4Y7N I;  4AYB A;  4BBS I;  1YJN Z;  5LL6 f;  1TWH I;  2QLV B;  4NFR A;  2Q4Z A;  4MD7 A;  3I4M I;  5D1P A;  3HOZ I;  3M3Y I;  4NH1 C;  3EED A;  3NH4 A;  3VB9 A;  2OTJ 1;  3G71 Z;  3J80 f;  5T6B A;  1VLA A;  2VF1 A;  2M48 A;  2GTI A;  3J80 b;  2JA6 I;  3K7A I;  4MD8 A;  1VQ6 1;  1QF8 A;  1VQP Z;  1VQL 1;  1VQ7 Z;  4NBE A;  5C4J I;  1W2B Z;  1USP A;  1VQ6 Z;  2NVY I;  1M1K 1;  5IP7 I;  3S1N I;  3CC7 Z;  2GU2 A;  1YIT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...